Element No(Glass)	Spot No	Clone name	Putative Identification	Destination Platei96j	Dplate Pos	Source Plate Name	Clone Pos in STAFFDWP	Accession No(A)	Accession No(Z)	Primer No.	to Full Spot No	384Plate	384Plate Pos.
4609	g_4609	EG0066	">TOBEXTS_1(D13951|pid:g505144) Tobacco gene for extensin, complete   cds. "	DPlate 049	A01			AU029869				13	A01
4610	g_4610	EG0787	>(P20346) PROBABLE PROTEASE INHIBITOR P322 PRECURSOR.   &S05594(S05594;S45659) &ST322R_1(X13180|pid:g21394) 	DPlate 051	A01			AU065648	AU030229			13	B01
4611	g_4611	EG0075		DPlate 049	B01			AU058176	AU095001			13	C01
4612	g_4612	EG0795		DPlate 051	B01			AU030232	AU030233			13	D01
4613	g_4613	EG0004	">ATF23E13_14(AL022141|pid:g2961384) Arabidopsis thaliana DNA   chromosome 4, BAC clone F23E13 (ESSAII project); strong   similarity to aldehyde dehydrogenase (NAD+) (EC 1.2.1.3)   4, microsomal, rat, PIR2:A41028; contains EST gb:R83981,   Z33684, Z33966, AA585726. "	DPlate 049	C01			AU029836	AU077684			13	E01
4614	g_4614	EG0716		DPlate 051	C01			AU095024	AU058368			13	F01
4615	g_4615	EG0005		DPlate 049	D01			AU029837	AU029838			13	G01
4616	g_4616	EG0740		DPlate 051	D01			AU058374	AU101477			13	H01
4617	g_4617	EG0013		DPlate 049	E01			AU029841	AU077687			13	I01
4618	g_4618	EG0748	">F21M12_6(AC000132|pid:g2160184) Sequence of BAC F21M12 from   Arabidopsis thaliana chromosome 1, complete sequence;   ESTs gb|H37208,gb|H36853 come from this gene.. "	DPlate 051	E01			AU030198	AU030199			13	J01
4619	g_4619	EG0061		DPlate 049	F01			AU029868	AU101463			13	K01
4620	g_4620	EG0764		DPlate 051	F01			AU058380	AU095032			13	L01
4621	g_4621	EG0079		DPlate 049	G01			C74655				13	M01
4622	g_4622	EG0817		DPlate 051	G01			AU065655	AU030252			13	N01
4623	g_4623	EG0095		DPlate 049	H01			AU029873	AU101466			13	O01
4624	g_4624	EG0825		DPlate 051	H01			AU030258	AU030259			13	P01
4625	g_4625	EG0278		DPlate 049	A07			AU029934	AU029935			13	A13
4626	g_4626	EG0950		DPlate 051	A07			AU166219	AU030362			13	B13
4627	g_4627	EG0207		DPlate 049	B07			AU075755	AU075756			13	C13
4628	g_4628	EG0966	">F20D22_15(AC002411|pid:g3142296) Arabidopsis thaliana chromosome 1   BAC F20D22 sequence, complete sequence; Contains   similarity to hypothetical mitochondrial import receptor   subunit gb|Z98597 from S. pombe. ESTs gb|T45575 and   gb|Z26435 and gb|AA394576 come from this gene.. "	DPlate 051	B07			AU162296	AU058402			13	D13
4629	g_4629	EG0248		DPlate 049	C07			AU172943				13	E13
4630	g_4630	EG0974	">OSOSR40C1_1(X95402|pid:g1296955) O.sativa mRNA for novel protein,   osr40c1; duplicated domain structure protein. "	DPlate 051	C07			AU166220	AU058403			13	F13
4631	g_4631	EG0280	">D86854_1(D86854|pid:g1486265) Catharanthus roseus cyc17 mRNA for   extensin, complete cds. "	DPlate 049	D07			AU091969	AU058258			13	G13
4632	g_4632	EG0927	">AF051898_1(AF051898|pid:g2952545) Dictyostelium discoideum coronin   binding protein (DB10) mRNA, complete cds. "	DPlate 051	D07			AU172973	AU030342			13	H13
4633	g_4633	EG0296	">(P31691) ADP,ATP CARRIER PROTEIN PRECURSOR (ADP/ATP TRANSLOCASE)   (ADENINE NUCLEOTIDE TRANSLOCATOR) (ANT).   &RICATADPT_1(D12637|pid:g218145) "	DPlate 049	E07			AU172944	AU172945			13	I13
4634	g_4634	EG0935	">LILLIM09_1(D21815|pid:g431176) Lily mRNA for serine proteinase,   partial cds. "	DPlate 051	E07			AU065677	AU030354			13	J13
4635	g_4635	EG0309	>S48690(S48690;S55873;S45021) ubiquinol--cytochrome-c reductase (EC   1.10.2.2) 11K protein - potato   &STCR7_1(X79273|pid:g488712) 	DPlate 049	F07			AU065588	AU029943			13	K13
4636	g_4636	EG0951	">ATF7L13_6(AL049524|pid:g4539408) Arabidopsis thaliana DNA   chromosome 4, BAC clone F7L13 (ESSA project); stong   similarity to Nascent polypeptide associated complex   alpha chain - human, PIR2:S49326; contains EST   gb:Z30528, Z30529. "	DPlate 051	F07			AU172974				13	L13
4637	g_4637	EG0317	">ATAC004218_5(AC004218|pid:g3355468) Arabidopsis thaliana chromosome   II BAC F12L6 genomic sequence, complete sequence; "	DPlate 049	G07			AU029945	AU101472			13	M13
4638	g_4638	EG0975	">AF010579_1(AF010579|pid:g2331131) Oryza sativa glycine-rich protein   (OSGRP1) mRNA, complete cds. "	DPlate 051	G07			AU172976				13	N13
4639	g_4639	EG0325		DPlate 049	H07			AU029949				13	O13
4640	g_4640	EG0904		DPlate 051	H07			AU095045	AU058398			13	P13
4641	g_4641	EH0278		DPlate 053	A01			AU030810				14	A01
4642	g_4642	EH1051	">SBY14274_1(Y14274|pid:g3256035) Sorghum bicolor mRNA for SNFL3,   putative serine/threonine protein kinase. "	DPlate 055	A01			AU164732	AU164733			14	B01
4643	g_4643	EH0271		DPlate 053	B01			AU091429	AU030806			14	C01
4644	g_4644	EH1059		DPlate 055	B01			AU162332				14	D01
4645	g_4645	EH0287		DPlate 053	C01			AU091432				14	E01
4646	g_4646	EH1044		DPlate 055	C01			AU173037	AU077738			14	F01
4647	g_4647	EH0240		DPlate 053	D01			AU065172	AU091417			14	G01
4648	g_4648	EH1052		DPlate 055	D01			AU164734	AU164735			14	H01
4649	g_4649	EH0272		DPlate 053	E01			AU095152	AU030807			14	I01
4650	g_4650	EH1060	">AF081802_1(AF081802|pid:g3789911) Dictyostelium discoideum   developmental protein DG1118 (DG1118) gene, complete   cds; disruption of this gene results in morphological   defect; similar to Schizosaccharomyces pombe   hypothetical protein encoded by sequence in GenBank   Accession Number AL022600. "	DPlate 055	E01			AU164739	AU031160			14	J01
4651	g_4651	EH0317	">ATAC006232_4(AC006232|pid:g4314378) Arabidopsis thaliana chromosome   II BAC F10A12 genomic sequence, complete sequence; "	DPlate 053	F01			AU172992	AU030833			14	K01
4652	g_4652	EH1021	>A35068(A35068;B35068;C35068;D35068;E35068;F35068;G35068) complement   factor H-related protein 3A4/5G4 - mouse (fragment)   &MUSCFHRC_1(M29010|pid:g387128) 	DPlate 055	F01			AU076207	AU076208			14	L01
4653	g_4653	EH0349	">AF026538_1(AF026538|pid:g4103635) Hordeum vulgare ABA-responsive   protein mRNA, complete cds. "	DPlate 053	G01			AU030854	AU030855			14	M01
4654	g_4654	EH1045	">ATF17I5_11(AL031032|pid:g3297816) Arabidopsis thaliana DNA   chromosome 4, BAC clone F17I5 (ESSAII project);   similarity to protein phosphatase Wip1, Homo sapiens,   PID:g2218063; Contains Protein phosphatase 2C signature   [YVGVYDGHG]. "	DPlate 055	G01			AU076214	AU076215			14	N01
4655	g_4655	EH0365	">ATAC004521_5(AC004521|pid:g3128199) Arabidopsis thaliana chromosome   II BAC F4I1 genomic sequence, complete sequence; "	DPlate 053	H01			AU172999	AU091447			14	O01
4656	g_4656	EH1069	">CAR012688_1(AJ012688|pid:g3860323) Cicer arietinum mRNA for   hypothetical protein, clone Can40-1; ORF1. "	DPlate 055	H01			AU164741	AU164742			14	P01
4657	g_4657	EH0459	">ATAC007019_17(AC007019|pid:g4417280) Arabidopsis thaliana   chromosome II BAC F7D8 genomic sequence, complete   sequence; "	DPlate 053	A07			AU065191	AU091980			14	A13
4658	g_4658	EH1290		DPlate 055	A07			AU162338				14	B13
4659	g_4659	EH0483	>(P43119) PROSTACYCLIN RECEPTOR (PROSTANOID IP RECEPTOR) (PGI   RECEPTOR). &A57066(A57066;S43952;A53587;I52867)   &D29634_1(D29634|pid:g577630)   &HUMHPR_1(D25418|pid:g467510)   &HUMIP2_1(D38128|pid:g1136739)   &HUMPIR_1(L29016|pid:g495043) 	DPlate 053	B07			AU030959	AU030958			14	C13
4660	g_4660	EH1267		DPlate 055	B07			AU173042				14	D13
4661	g_4661	EH0460	">OSU65956_1(U65956|pid:g1519249) Oryza sativa GF14-b protein mRNA,   complete cds; rice 14-3-3 protein homolog; osGF14b. "	DPlate 053	C07			AU165904	AU030936			14	E13
4662	g_4662	EH1244	">PAPMPL146A_1(L06467|pid:g294060) Papaver somniferum major latex   protein (MLP146) gene, complete cds. "	DPlate 055	C07			AU164780	AU031268			14	F13
4663	g_4663	EH0468		DPlate 053	D07			AU173007				14	G13
4664	g_4664	EH1253	>S51932(S51932) calmodulin cam1 - maize   &ZMCAM1_1(X77396|pid:g747915) 	DPlate 055	D07			AU081349				14	H13
4665	g_4665	EH0405		DPlate 053	E07			AU030894	AU030895			14	I13
4666	g_4666	EH1222		DPlate 055	E07			AU031256				14	J13
4667	g_4667	EH0421		DPlate 053	F07			AU030904	AU030905			14	K13
4668	g_4668	EH1230	">MSU09462_1(U09462|pid:g488571) Medicago sativa Regen S clone   pH3c126 histone H3.2 mRNA, partial cds. "	DPlate 055	F07			AU078144				14	L13
4669	g_4669	EH0437	">ATFCA2_21(Z97337|pid:g2244850) Arabidopsis thaliana DNA chromosome   4, ESSA I contig fragment No. 2; similarity to surE   survival protein homolog - Methanococcus jannaschii.   &F71412(F71412) "	DPlate 053	G07			AU162321	AU030916			14	M13
4670	g_4670	EH1238		DPlate 055	G07			AU173041	AU164778			14	N13
4671	g_4671	EH0406	">AF006492_1(AF006492|pid:g2252814) Mus musculus friend of GATA-1   (FOG) mRNA, complete cds; zinc finger protein. "	DPlate 053	H07			AU173006	AU030896			14	O13
4672	g_4672	EH1254	>(P93433) METALLOTHIONEIN-LIKE PROTEIN TYPE 2.   &AF048750_1(AF048750|pid:g4105603)   &OSMETALLO_1(Y08529|pid:g2326785)   &OSU57638_1(U57638|pid:g4097338)   &OSU77294_1(U77294|pid:g1667588) 	DPlate 055	H07			AU031271	AU166250			14	P13
4673	g_4673	EH1803		DPlate 057	A01			AU097582	AU097583			15	A01
4674	g_4674	FE0306	>(Q10213) PROBABLE ATP-DEPENDENT DNA HELICASE C4H3.05 (EC 3.6.1.-).    &SPAC4H3_5(Z69380|pid:g1184018) 	DPlate 059	A01			AU174748	AU174749			15	B01
4675	g_4675	EH1827	>(Q43317) CYSTEINE SYNTHASE (EC 4.2.99.8) (O-ACETYLSERINE   SULFHYDRYLASE) (O-ACETYLSERINE (THIOL)-LYASE) (CSASE).   &CNAPCCS7_1(D28777|pid:g540497) &S46438(S46438) 	DPlate 057	B01			AU164935	AU164936			15	C01
4676	g_4676	FE0338		DPlate 059	B01			AU174768				15	D01
4677	g_4677	EH1875	>(P31851) TABA PROTEIN. &PSETABA_3(M88485|pid:g151571)   &S27649(S27649) 	DPlate 057	C01			AU031573				15	E01
4678	g_4678	FE0354		DPlate 059	C01			AU174778				15	F01
4679	g_4679	EH1812	>PCMUTSIGN_1(X92351|pid:g1103489) P.coerulescens complete mutant   self-incompatibilty gene; leads to loss of   self-incompatibility phenotype.   &PCS1_1(X81991|pid:g556831) &S49352(S49352) 	DPlate 057	D01			AU065328	AU082256			15	G01
4680	g_4680	FE0362	>F6N15_16(AF069299|pid:g3193330) Arabidopsis thaliana BAC F6N15;   contains similarity to Medicago sativa corC (GB:L22305);   coded for by A. thaliana cDNA R65504. 	DPlate 059	D01			AU174785	AU174784			15	H01
4681	g_4681	EH1844	">HS1119A7_2(AL022313|pid:g4200328) Human DNA sequence from clone   1119A7 on chromosome 22q12.2-12.3 thioredoxin, nuclear   gene encoding mitochondrial protein, translation   initiation factor EIF3-P66 subunit, EST, GSS, STS, CpG   island, complete sequence;   &HSU54558_1(U54558|pid:g2351378) "	DPlate 057	E01			AU031556	AU101584			15	I01
4682	g_4682	FE0386	>STDNAGBSS_1(X83220|pid:g602594) S.tuberosum GBSS gene. 	DPlate 059	E01			AU174800	AU174801			15	J01
4683	g_4683	EH1852	">ATAC006224_8(AC006224|pid:g4531440) Arabidopsis thaliana chromosome   II P1 MFL8 genomic sequence, complete sequence; unknown   protein. "	DPlate 057	F01			AU173057	AU065335			15	K01
4684	g_4684	FE0307		DPlate 059	F01			AU174750				15	L01
4685	g_4685	EH1868	">ATAC006340_17(AC006340|pid:g4314371) Arabidopsis thaliana chromosome   II BAC T9I22 genomic sequence, complete sequence; "	DPlate 057	G01			AU031569				15	M01
4686	g_4686	FE0331		DPlate 059	G01			AU174763				15	N01
4687	g_4687	EH1805		DPlate 057	H01			AU031531				15	O01
4688	g_4688	FE0339		DPlate 059	H01			AU174770	AU174769			15	P01
4689	g_4689	FE0089		DPlate 057	A07			AU174598	AU174597			15	A13
4690	g_4690	FE0478		DPlate 059	A07			AU174865	AU174864			15	B13
4691	g_4691	FE0002	">ATF13D4_15(AL031369|pid:g3482979) Arabidopsis thaliana DNA   chromosome 2, BAC clone F13D4 (ESSAII project);   similarity to predicted protein, Arabidopsis thaliana. "	DPlate 057	B07			AU174541	AU174540			15	C13
4692	g_4692	FE0415	">ATAC005496_25(AC005496|pid:g3582333) Arabidopsis thaliana   chromosome II BAC T27A16 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 059	B07			AU174813	AU174814			15	D13
4693	g_4693	FE0018		DPlate 057	C07			AU174556				15	E13
4694	g_4694	FE0431	">ATAC006284_19(AC006284|pid:g4335761) Arabidopsis thaliana   chromosome II BAC T4M8 genomic sequence, complete   sequence; unknown protein. "	DPlate 059	C07			AU174827	AU174826			15	F13
4695	g_4695	FE0026	">HUMPRP11_1(K02575|pid:g190474) Human salivary proline-rich protein   1 gene, segment 1; salivary proline-rich protein 1. "	DPlate 057	D07			AU174558				15	G13
4696	g_4696	FE0447	>(Q40863) LATE EMBRYOGENESIS ABUNDANT PROTEIN EMB8.   &PIAEMB8R_1(L47118|pid:g1350545) 	DPlate 059	D07			AU174838	AU174839			15	H13
4697	g_4697	FE0034	">ATAC005967_7(AC005967|pid:g4115377) Arabidopsis thaliana chromosome   II BAC F27D4 genomic sequence, complete sequence;   unknown protein. "	DPlate 057	E07			AU174562	AU174561			15	I13
4698	g_4698	FE0455	>JC6317(JC6317) glutamate dehydrogenase (EC 1.4.1.2) - tomato   &SLU48695_1(U48695|pid:g1762148) 	DPlate 059	E07			AU174847	AU174846			15	J13
4699	g_4699	FE0050	">ATAC004681_4(AC004681|pid:g3298536) Arabidopsis thaliana chromosome   II BAC T26B15 genomic sequence, complete sequence;   unknown protein. "	DPlate 057	F07			AU174567	AU174568			15	K13
4700	g_4700	FE0416	">ATT13J8_3(AL035524|pid:g4455351) Arabidopsis thaliana DNA   chromosome 4, BAC clone T13J8 (ESSAII project);   similarity to various predicted proteins. "	DPlate 059	F07			AU174816	AU174815			15	L13
4701	g_4701	FE0058	">ATAC007017_26(AC007017|pid:g4510386) Arabidopsis thaliana   chromosome II BAC F11F19 genomic sequence, complete   sequence; unknown protein. "	DPlate 057	G07			AU174577	AU174576			15	M13
4702	g_4702	FE0424	">AB012570_1(AB012570|pid:g4156245) Arabidopsis thaliana mRNA for   ATHP3, complete cds. &AB015141_1(AB015141|pid:g4107099)   "	DPlate 059	G07			AU174822				15	N13
4703	g_4703	FE0066		DPlate 057	H07			AU174580	AU174579			15	O13
4704	g_4704	FE0448	">AF030555_1(AF030555|pid:g3158351) Homo sapiens acyl-CoA synthetase   4 (ACS4) mRNA, complete cds. "	DPlate 059	H07			AU174840	AU174841			15	P13
4705	g_4705	RA0132	">AC002329_18(AC002329|pid:g2262173) DNA sequence of Arabidopsis   thaliana BAC F5J6 from chromosome IV, complete sequence;   signature for active site of class II pyridine   nucleotide-disulphide oxidoreductases located from   residues 197 to 219 [CAVCD...IGGGD]. "	DPlate 061	A01			D23778				16	A01
4706	g_4706	RA1065	>PSPP24KD_1(AJ001009|pid:g2764574) Pisum sativum mRNA for pore   protein of 24 kD OEP24. 	DPlate 063	A01			AU173124	AU173125			16	B01
4707	g_4707	RA0180		DPlate 061	B01			AU173066				16	C01
4708	g_4708	RA1081	>(Q09473) PUTATIVE ER LUMEN PROTEIN RETAINING RECEPTOR C28H8.4.   &CELC28H8_7(U20861|pid:g669010) 	DPlate 063	B01			AU173126				16	D01
4709	g_4709	RA0257	">AF030027_24(AF030027|pid:g2605967) Equine herpesvirus 4 strain   NS80567, complete genome; counterpart of HSV-1 gene UL36   and VZV gene 22. "	DPlate 061	C01			AU091985	AU091986			16	E01
4710	g_4710	RA1010	">ATM4I22_8(AL030978|pid:g3269288) Arabidopsis thaliana DNA   chromosome 4, P1 clone M4I22 (ESSAII project); strong   similarity to LEDI-3 protein, Lithospermum   erythrorhizon. "	DPlate 063	C01			D28297	AU031729			16	F01
4711	g_4711	RA0202	">(P05100) DNA-3-METHYLADENINE GLYCOSIDASE I (EC 3.2.2.20)   (3-METHYLADENINE-DNA GLYCOSYLASE I, CONSTITUTIVE) (TAG   I). &AE000432_4(AE000432|pid:g1789971)   &DGECM1(A24604;S47770;I58249;G65153)   &ECOTAG_1(J02606|pid:g147920)   &ECOUW76_105(U00039|pid:g466687)   &ECTAG_1(X03845|pid:g43030) "	DPlate 061	D01			D23802	AU031650			16	G01
4712	g_4712	RA1066		DPlate 063	D01			AU101646	AU101647			16	H01
4713	g_4713	RA0290		DPlate 061	E01			C23560				16	I01
4714	g_4714	RA1043		DPlate 063	E01			D24065	AU162397			16	J01
4715	g_4715	RA0204	">ATHUBQ10R_1(L05361|pid:g870792) Arabidopsis thaliana polyubiquitin   (ubq10) mRNA, complete cds.   &L81139_1(L81139|pid:g4115333)   &L81140_1(L81140|pid:g4115335)   &TOBUBI11A_1(M74101|pid:g170352) "	DPlate 061	F01			D23803				16	K01
4716	g_4716	RA1067	>(P53780) CYSTATHIONINE BETA-LYASE PRECURSOR (EC 4.4.1.8) (CBL)   (BETA- CYSTATHIONASE) (CYSTEINE LYASE).   &ATHCBL_1(L40511|pid:g704397) &S61429(S61429) 	DPlate 063	F01			D39050	AU082558			16	L01
4717	g_4717	RA0220	">AC004493_2(AC004493|pid:g2996650) Homo sapiens chromosome 16, cosmid   clone 373C8 (LANL), complete sequence. "	DPlate 061	G01			D23808	AU101599			16	M01
4718	g_4718	RA1012	>BNACS7_1(X94624|pid:g1617270) B.napus mRNA for acyl-CoA synthetase   (2360 bp). 	DPlate 063	G01			D24049	AU031730			16	N01
4719	g_4719	RA0244	>HVUDPGPP_1(X91347|pid:g1212996) H.vulgare mRNA for UDP-glucose   pyrophosphorylase. &JC4785(JC4785) 	DPlate 061	H01			D23817	AU173068			16	O01
4720	g_4720	RA1028	">ATAC004680_12(AC004680|pid:g3420055) Arabidopsis thaliana   chromosome II BAC F23F1 genomic sequence, complete   sequence; "	DPlate 063	H01			D24058	AU101645			16	P01
4721	g_4721	RA0491	">ATAC004005_25(AC004005|pid:g3212879) Arabidopsis thaliana   chromosome II BAC F6E13 genomic sequence, complete   sequence; "	DPlate 061	A07			AU164554				16	A13
4722	g_4722	RA1391	">ATAC006592_9(AC006592|pid:g4544443) Arabidopsis thaliana chromosome   II BAC F14M13 genomic sequence, complete sequence; "	DPlate 063	A07			D24123	AU173145			16	B13
4723	g_4723	RA0404	">AF007552_1(AF007552|pid:g2253428) Mus musculus Bet1p homolog   (mbet1) mRNA, complete cds; similar to yeast Bet1p;   integral membrane protein. "	DPlate 061	B07			D23851	AU031664			16	C13
4724	g_4724	RA1312		DPlate 063	B07			D24105	AU173139			16	D13
4725	g_4725	RA0412	">ATAC004561_8(AC004561|pid:g3980382) Arabidopsis thaliana chromosome   II BAC F16P2 genomic sequence, complete sequence;   &ATU35049_1(U35049|pid:g1184686)   &ATU35050_1(U35050|pid:g1184688) &JC4847(JC4847) "	DPlate 061	C07			AU101603	AU101604			16	E13
4726	g_4726	RA1313	">ATFCA5_25(Z97340|pid:g2244975) Arabidopsis thaliana DNA chromosome   4, ESSA I contig fragment No. 5; hypothetical protein.   &B71428(B71428) "	DPlate 063	C07			D24106	AU101650			16	F13
4727	g_4727	RA0413	">AB018353_1(AB018353|pid:g3882341) Homo sapiens mRNA for KIAA0810   protein, partial cds; hk05647 cDNA clone for KIAA0810 has   a 142-bp insertion at position 1028 of the sequence of   KIAA0810.. "	DPlate 061	D07			D23853	AU031667			16	G13
4728	g_4728	RA1329	">ATU31752_1(U31752|pid:g1399267) Arabidopsis thaliana   calmodulin-domain protein kinase CDPK isoform 4 (CPK4)   mRNA, partial cds; calcium dependent protein kinase. "	DPlate 063	D07			D24109	AU173142			16	H13
4729	g_4729	RA0445	>(P16498) 50S RIBOSOMAL PROTEIN L34. &PPORIGS_1(X62540|pid:g45706)   &R6PS34(S18090;C34835;JQ1218) 	DPlate 061	E07			AU101607	AU101608			16	I13
4730	g_4730	RA1369		DPlate 063	E07			D24118	AU164662			16	J13
4731	g_4731	RA0469		DPlate 061	F07			D23871	AU101610			16	K13
4732	g_4732	RA1393	">S57792(S57792)acetyl-CoA C-acyltransferase (EC 2.3.1.16) B   precursor, peroxisomal - mango (fragment) "	DPlate 063	F07			AU173146	AU173147			16	L13
4733	g_4733	RA0493	">ATF21P8_3(AL022347|pid:g3021266) Arabidopsis thaliana DNA   chromosome 4, BAC clone F21P8 (ESSAII project);   similarity to KI domain interacting kinase 1 (KIK1), Zea   mays; Contains Protein kinases signatures and profile,   [IGRGGFGEVYKGTFSNGKEVAVK][IIHRDLKASNILL]; contains EST   gb:AA712364, AA712368.   &ATF7H19_33(AL031018|pid:g3292840) "	DPlate 061	G07			AU101613	AU101614			16	M13
4734	g_4734	RA1394	>U01058_1(U01058|pid:g405080) Entamoeba histolytica HM-1:IHSS   ABC-family transporter gene complete cds. 	DPlate 063	G07			D24124	AU031741			16	N13
4735	g_4735	RA0414	">ATF20D10_26(AL035538|pid:g4467120) Arabidopsis thaliana DNA   chromosome 4, BAC clone F20D10 (ESSA project);   similarity to RING-H2 zinc finger protein RHA1a   -Arabidopsis thaliana, PID:g3790554. "	DPlate 061	H07			AU173092	AU101605			16	O13
4736	g_4736	RA1340	">AF042384_1(AF042384|pid:g2828147) Homo sapiens BC-2 protein mRNA,   complete cds; p32; putative breast adenocarcinoma   marker. "	DPlate 063	H07			D24113	AU162410			16	P13
4737	g_4737	RA1818		DPlate 065	A01			D24384	AU173237			17	A01
4738	g_4738	RA2419	">ATAC002387_2(AC002387|pid:g2583108) Arabidopsis thaliana chromosome   II BAC F4L23 genomic sequence, complete sequence; "	DPlate 067	A01			D24713	AU031891			17	B01
4739	g_4739	RA1858	">ATF17A8_18(AL049482|pid:g4538913) Arabidopsis thaliana DNA   chromosome 4, BAC clone F17A8 (ESSA project); contains   EST gb:T75653, R64736, R90206, T04549, R84034, Aa728462.   "	DPlate 065	B01			D39079	AU173244			17	C01
4740	g_4740	RA2435	">ATU75603_1(U75603|pid:g2231312) Arabidopsis thaliana AtRab18   (AtRAB18) mRNA, complete cds; ras-related small GTPase. "	DPlate 067	B01			AU173364	AU173365			17	D01
4741	g_4741	RA1866	">AF078916_1(AF078916|pid:g3342913) Trypanosoma brucei brucei   oligopeptidase B (opb) gene, complete cds; OP; similar   to Trypanosoma cruzi and Escherichia coli oligopeptidase   B. "	DPlate 065	C01			D24419	AU173248			17	E01
4742	g_4742	RA2443	">AF062878_1(AF062878|pid:g3941448) Arabidopsis thaliana putative   transcription factor (MYB36) mRNA, complete cds; MYB36;   R2R3-MYB factor family member. "	DPlate 067	C01			D24724	AU031895			17	F01
4743	g_4743	RA1811	">AC005223_10(AC005223|pid:g4204265) Arabidopsis thaliana chromosome   I BAC T5A14 genomic sequence, complete sequence;   Hypothetical protein. "	DPlate 065	D01			D24378	AU031800			17	G01
4744	g_4744	RA2451	">F8K4_15(AC004392|pid:g3367526) Arabidopsis thaliana chromosome 1   BAC F8K4 sequence, complete sequence; Strong similarity   to gi|2160136 F19K23.4 gene product from A. thaliana BAC   gb|AC000375.. "	DPlate 067	D01			D24730	AU173369			17	H01
4745	g_4745	RA1843	>CELK04G7_2(U21320|pid:g687844) Caenorhabditis elegans cosmid K04G7;   contains TPR domain-like repeats; coded for by C. elegans   cDNA yk2g5.3; coded for by C. elegans cDNA yk5g7.3; coded   for by C. elegans cDNA yk1d1.3; coded for by C. elegans   cDNA yk13c2.3; coded for by C. elegans cDNA CEESN40F;   coded for by C. elegans cDNA yk2g5.5; coded for by C.   elegans cDNA yk1d1.5; coded for by C. elegans cDNA   yk5g7.5. 	DPlate 065	E01			D24403	AU031805			17	I01
4746	g_4746	RA2444	">ATAC006955_14(AC006955|pid:g4544419) Arabidopsis thaliana   chromosome II BAC F28I8 genomic sequence, complete   sequence; unknown protein. "	DPlate 067	E01			D24725	AU173368			17	J01
4747	g_4747	RA1804	">CPU90262_1(U90262|pid:g1899175) Cucurbita pepo calcium-dependent   calmodulin-independent protein kinase CDPK (cpCPK1)   mRNA, complete cds; serine/threonine protein kinase that   is activated by direct binding of calcium. "	DPlate 065	F01			D24372	C22587			17	K01
4748	g_4748	RA2460	">ATAC004165_19(AC004165|pid:g3150415) Arabidopsis thaliana   chromosome II BAC T27E13 genomic sequence, complete   sequence; &ATAC004680_3(AC004680|pid:g3420046) "	DPlate 067	F01			D24736	AU031899			17	L01
4749	g_4749	RA1812	>ZMB3TUB_1(X74654|pid:g398845) Z.mays mRNA for beta 3 tubulin. 	DPlate 065	G01			D24379	AU173234			17	M01
4750	g_4750	RA2468	">ATAC005169_14(AC005169|pid:g3687235) Arabidopsis thaliana   chromosome II BAC F6F22 genomic sequence, complete   sequence; "	DPlate 067	G01			AU173372	AU173373			17	N01
4751	g_4751	RA1836	">AF064542_1(AF064542|pid:g3142698) Arabidopsis thaliana protein   farnesyltransferase subunit A (FTA) mRNA, complete cds. "	DPlate 065	H01			D24398	AU173239			17	O01
4752	g_4752	RA2484	>(P46265) TUBULIN BETA CHAIN. &RICBTB_1(D30717|pid:g493710) 	DPlate 067	H01			D24746	AU031904			17	P01
4753	g_4753	RA1985	">ATHPK5_1(D10909|pid:g217861) Arabidopsis thaliana gene for   serine/threonine protein kinase, complete cds; putative.   &JN0505(JN0505) "	DPlate 065	A07			D24464	AU031829			17	A13
4754	g_4754	RA2722	">SPAC19A8_9(Z98974|pid:g2388908) S.pombe chromosome I cosmid c19A8;   SPAC19A8.09, unknown, len:81aa. "	DPlate 067	A07			D24891	AU095487			17	B13
4755	g_4755	RA1993	">ATAC002387_15(AC002387|pid:g2583121) Arabidopsis thaliana   chromosome II BAC F4L23 genomic sequence, complete   sequence; "	DPlate 065	B07			D39115	AU173280			17	C13
4756	g_4756	RA2746		DPlate 067	B07			AU173391				17	D13
4757	g_4757	RA1922	">AF007785_1(AF007785|pid:g2198851) Zea mays cystathionine   gamma-synthase (CGS1) mRNA, complete cds. "	DPlate 065	C07			D24443	AU173258			17	E13
4758	g_4758	RA2754	>(Q42456) ASPARTIC PROTEINASE ORYZASIN 1 PRECURSOR (EC 3.4.23.-).   &RICAPA_1(D32144|pid:g1711289)   &RICAP_1(D32165|pid:g1030715) &S66516(S66516;S66517) 	DPlate 067	C07			D24912	AU031945			17	F13
4759	g_4759	RA1930	">AF030517_1(AF030517|pid:g2996096) Oryza sativa translation   elongation factor-1 alpha mRNA, complete cds; EF-1   alpha. "	DPlate 065	D07			AU181014				17	G13
4760	g_4760	RA2770		DPlate 067	D07			AU173396				17	H13
4761	g_4761	RA1938	">POPPOP3A_1(M18538|pid:g169459) Populus balsamifera subsp.   trichocarpa X Populus deltoides pop3 peptide mRNA,   complete cds; pop3 peptide. "	DPlate 065	E07			D24446	AU031818			17	I13
4762	g_4762	RA2778	">AF016713_1(AF016713|pid:g4102839) Lycopersicon esculentum   oligopeptide transporter (LeOPT1) mRNA, complete cds;   oligopeptide transporter. "	DPlate 067	E07			D24915	AU031946			17	J13
4763	g_4763	RA1946	">TOBCPI40KB_1(D42065|pid:g575605) Tobacco mRNA for cationic   peroxidase isozyme 40K precursor, complete cds. "	DPlate 065	F07			D24453	C20493			17	K13
4764	g_4764	RA2786	">ATAC004684_21(AC004684|pid:g3236253) Arabidopsis thaliana   chromosome II BAC F13M22 genomic sequence, complete   sequence; "	DPlate 067	F07			D24921				17	L13
4765	g_4765	RA1954	>ATH010818_1(AJ010818|pid:g4127456) Arabidopsis thaliana mRNA for   chloroplast Cpn21 protein. 	DPlate 065	G07			D24459	AU031822			17	M13
4766	g_4766	RA2794	>(P52588) PROTEIN DISULFIDE ISOMERASE PRECURSOR (PDI) (EC 5.3.4.1) /   DOLICHYL- DIPHOSPHOOLIGOSACCHARIDE-PROTEIN   GLYCOTRANSFERASE (EC 2.4.1.119) (GLYCOSYLATION   SITE-BINDING CHAIN) (GSBP).   &MZEPDI_1(L39014|pid:g625148) &S69181(S69181) 	DPlate 067	G07			D39164	AU031950			17	N13
4767	g_4767	RA1962		DPlate 065	H07			D28309	AU031825			17	O13
4768	g_4768	RA2707	>LUS6957_1(AJ006957|pid:g3355632) Linum usitatissimum sad1 gene. 	DPlate 067	H07			AU173387	AU173388			17	P13
4769	g_4769	RA3295		DPlate 069	A01			AU173477				18	A01
4770	g_4770	RA3913	">ATAC006403_21(AC006403|pid:g4337206) Arabidopsis thaliana   chromosome II BAC T28I24 genomic sequence, complete   sequence; "	DPlate 071	A01			AU090513	AU032338			18	B01
4771	g_4771	RA3208	">AC004557_24(AC004557|pid:g3935181) Genomic sequence for Arabidopsis   thaliana BAC F17L21, complete sequence; similar to   multiple exostoses type II protein EXT2.I (U72263);   similar to ESTs dbj|D39982, gb|L37635, and dbj|C28418. "	DPlate 069	B01			D39259	AU032020			18	C01
4772	g_4772	RA3929	">ATAP22_38(Z99708|pid:g4006913) Arabidopsis thaliana DNA chromosome   4, ESSA I AP2 contig fragment No. 2; "	DPlate 071	B01			AU162551	AU032353			18	D01
4773	g_4773	RA3272	">MMPLD2G4_1(AF052294|pid:g3168864) Mus musculus phospholipase D2 gene,   exons 13 through 25 and complete cds.   &MMU87557_1(U87557|pid:g2088545) "	DPlate 069	C01			AU173473	AU173474			18	E01
4774	g_4774	RA3961	">AF033536_1(AF033536|pid:g3252868) Arabidopsis thaliana putative   zinc transporter (ZIP2) mRNA, complete cds. "	DPlate 071	C01			AU032374	AU032375			18	F01
4775	g_4775	RA3296	">D26015_1(D26015|pid:g2541876) Nicotiana tabacum mRNA for CND41,   chloroplast nucleoid DNA binding protein, complete cds. "	DPlate 069	D01			D39303	AU032042			18	G01
4776	g_4776	RA3969	">ATAC004077_19(AC004077|pid:g3128228) Arabidopsis thaliana   chromosome II BAC T31E10 genomic sequence, complete   sequence; &ATAC004481_31(AC004481|pid:g3337376) "	DPlate 071	D01			AU162559	AU032380			18	H01
4777	g_4777	RA3341		DPlate 069	E01			D39327				18	I01
4778	g_4778	RA3985	>(Q06967) 14-3-3-LIKE PROTEIN S94. &RICS94A_1(D16140|pid:g303859)   &S30927(S30927) 	DPlate 071	E01			AU032393	AU032394			18	J01
4779	g_4779	RA3357	>BJGSHII_1(Y10984|pid:g2243118) B.juncea mRNA for glutathione   synthetase. 	DPlate 069	F01			D39333	AU173495			18	K01
4780	g_4780	RA3914	>BTCIB14_1(X63211|pid:g240) B.taurus CI-B14 mRNA for ubiquinone   oxidoreductase complex. &S28245(S28245) 	DPlate 071	F01			AU162548	AU032339			18	L01
4781	g_4781	RA3365		DPlate 069	G01			D39337	AU173497			18	M01
4782	g_4782	RA3922	>(P34106) ALANINE AMINOTRANSFERASE 2 (EC 2.6.1.2) (GPT)   (GLUTAMIC--PYRUVIC TRANSAMINASE 2) (GLUTAMIC--ALANINE   TRANSAMINASE 2) (ALAAT-2).   &PMPALAAT2_1(X69421|pid:g296204) &S28429(S28429) 	DPlate 071	G01			AU032346				18	N01
4783	g_4783	RA3381		DPlate 069	H01			D39347	AU173502			18	O01
4784	g_4784	RA3930	>(P31924) SUCROSE SYNTHASE 2 (EC 2.4.1.13) (SUCROSE-UDP   GLUCOSYLTRANSFERASE 2). &ORRSS2_1(X59046|pid:g20095) 	DPlate 071	H01			AU032354				18	P01
4785	g_4785	RA3418	">T8F5_23(AC004512|pid:g3335350) Arabidopsis thaliana chromosome 1   BAC T8F5 sequence, complete sequence; Similar to   gb|Z84386 anthranilat. "	DPlate 069	A07			AU065346	AU097585			18	A13
4786	g_4786	RB0080		DPlate 071	A07			AU173835				18	B13
4787	g_4787	RA3426	">(P37120) FLAVONOID 3',5'-HYDROXYLASE (EC 1.14.-.-) (F3'5'H)   (CYTOCHROME P450 LXXVA2) (P-450EG1). &S43342(S43342)   &SMPEG1_1(X70824|pid:g395261) "	DPlate 069	B07			AU032067				18	C13
4788	g_4788	RB0109		DPlate 071	B07			AU070694				18	D13
4789	g_4789	RA3458	">PSEEST5_1(D14529|pid:g402521) Pseudomonas sp. est5 gene for   esterase V, complete cds. &S34609(S34609) "	DPlate 069	C07			AU065358	AU173511			18	E13
4790	g_4790	RB0133	">ATT19P19_11(AL022605|pid:g3080441) Arabidopsis thaliana DNA   chromosome 4, BAC clone T19P19 (ESSAII project);   similarity to predicted protein, Arabidopsis thaliana. "	DPlate 071	C07			AU173844				18	F13
4791	g_4791	RA3474		DPlate 069	D07			AU173515				18	G13
4792	g_4792	RB0141		DPlate 071	D07			AU070716				18	H13
4793	g_4793	RA3482	">ATAC005824_16(AC005824|pid:g3860259) Arabidopsis thaliana   chromosome II BAC F15K20 genomic sequence, complete   sequence; unknown protein. "	DPlate 069	E07			AU070198				18	I13
4794	g_4794	RB0126		DPlate 071	E07			AU173843				18	J13
4795	g_4795	RA3411	">RICRCC3_1(L27208|pid:g786132) Oryza sativa root-specific RCc3 mRNA,   complete cds. &S53012(S53012) "	DPlate 069	F07			AU065344	AU082161			18	K13
4796	g_4796	RB0142		DPlate 071	F07			AU070717	AU163459			18	L13
4797	g_4797	RA3419		DPlate 069	G07			AU173506				18	M13
4798	g_4798	RB0158	">AB013874_1(AB013874|pid:g3869145) Mus musculus mRNA for Low Density   Lipoprotein Receptor Related Protein 4, complete cds. "	DPlate 071	G07			AU162569	AU070729			18	N13
4799	g_4799	RA3443		DPlate 069	H07			AU032072	AU101678			18	O13
4800	g_4800	RB0166	">ATAP21_1(Z99707|pid:g4006850) Arabidopsis thaliana DNA chromosome   4, ESSA I AP2 contig fragment No. 1; similarity to   cytochrome P450, Nicotiana tabacum, PATX:E1188611;   Contains Cytochrome P450 cysteine heme-iron ligand   signature [FGLGRRACPG]. "	DPlate 071	H07			AU070733				18	P13
4801	g_4801	RB0768		DPlate 073	A01			AU078045	AU078046			19	A01
4802	g_4802	SA0268	>S75995(S75995) hypothetical protein - Synechocystis sp. (strain PCC   6803) &SYCSLLLH_64(D64006|pid:g1001355) 	DPlate 075	A01			AU056074	AU056075			19	B01
4803	g_4803	RB0776		DPlate 073	B01			AU071121				19	C01
4804	g_4804	SA0284		DPlate 075	B01			AU056094	AU056095			19	D01
4805	g_4805	RB0721		DPlate 073	C01			AU071088	AU095606			19	E01
4806	g_4806	SA0292		DPlate 075	C01			AU056107				19	F01
4807	g_4807	RB0729	">AGU13940_1(U13940|pid:g535454) Alnus glutinosa cysteine proteinase   mRNA, complete cds; putative preproprotein. "	DPlate 073	D01			AU071094				19	G01
4808	g_4808	SA0221	">ATAC004683_10(AC004683|pid:g3395431) Arabidopsis thaliana   chromosome II BAC T19C21 genomic sequence, complete   sequence; unknown protein. "	DPlate 075	D01			AU056010	AU056011			19	H01
4809	g_4809	RB0737	">AF000940_1(AF000940|pid:g2150002) Hordeum vulgare ribonuclease   gene, complete cds. "	DPlate 073	E01			AU162624	AU162625			19	I01
4810	g_4810	SA0229	">ATAC005727_6(AC005727|pid:g3927828) Arabidopsis thaliana chromosome   II BAC F8N16 genomic sequence, complete sequence;   &ATU89272_1(U89272|pid:g2209332) "	DPlate 075	E01			AU173869	AU056023			19	J01
4811	g_4811	RB0761		DPlate 073	F01			AU078043				19	K01
4812	g_4812	SA0245	">OSU74321_1(U74321|pid:g1778414) Oryza sativa   ribulose-1,5-bisphosphate carboxylase/oxygenase activase   (rca) mRNA, complete cds; rubisco activase. "	DPlate 075	F01			AU056045	AU056046			19	L01
4813	g_4813	RB0730	>(Q41001) BLUE COPPER PROTEIN PRECURSOR.   &PSBLUCUPA_1(Z25471|pid:g562779) 	DPlate 073	G01			AU071095				19	M01
4814	g_4814	SA0253	">SPBC530_7(AL023634|pid:g3150254) S.pombe chromosome II cosmid c530;   SPBC530.07c, unknown, len:242aa. "	DPlate 075	G01			AU162647	AU056054			19	N01
4815	g_4815	RB0738	">AB004242_1(AB004242|pid:g2190012) Raphanus sativus mRNA for din1,   complete cds. "	DPlate 073	H01			AU071099	AU095611			19	O01
4816	g_4816	SA0293	">ATF13M23_3(AL035523|pid:g4455232) Arabidopsis thaliana DNA   chromosome 4, BAC clone F13M23 (ESSAII project);   similarity to acid phosphatase (EC 3.1.3.2) PAP,   Phaseolus vulgaris, PIR1:S51031. "	DPlate 075	H01			AU056108	AU056109			19	P01
4817	g_4817	RB0965	">CAR012688_1(AJ012688|pid:g3860323) Cicer arietinum mRNA for   hypothetical protein, clone Can40-1; ORF1. "	DPlate 073	A07			AU071252				19	A13
4818	g_4818	SA0305		DPlate 075	A07			AU056118	AU056119			19	B13
4819	g_4819	RB0973	">ATAC005824_15(AC005824|pid:g3860258) Arabidopsis thaliana   chromosome II BAC F15K20 genomic sequence, complete   sequence; unknown protein. "	DPlate 073	B07			AU162638	AU071258			19	C13
4820	g_4820	SA0321		DPlate 075	B07			AU162653	AU056134			19	D13
4821	g_4821	RB0942		DPlate 073	C07			AU071233				19	E13
4822	g_4822	SA0329	">AC004260_1(AC004260|pid:g3540195) Arabidopsis thaliana chromosome I   BAC T14N5 genomic sequence, complete sequence; Unknown   protein; Location of EST gb|T13944. "	DPlate 075	C07			AU056146	AU056147			19	F13
4823	g_4823	RB0975	">AF060173_1(AF060173|pid:g3901268) Rattus norvegicus SV2 related   protein (SVOP) mRNA, complete cds; synaptic vesicle   protein; similar to transport proteins. "	DPlate 073	D07			AU071259	AU101711			19	G13
4824	g_4824	SA0353	>(P14655) GLUTAMINE SYNTHETASE SHOOT ISOZYME PRECURSOR (EC 6.3.1.2)   (GLUTAMATE-- AMMONIA LIGASE) (CLONE LAMBDA-GS31).   &AJRZQD(S07471) &OSSIGS31_1(X14246|pid:g20370) 	DPlate 075	D07			AU070255	AU173880			19	H13
4825	g_4825	RB0983	">ATAC003672_22(AC003672|pid:g3341693) Arabidopsis thaliana   chromosome II BAC F16B22 genomic sequence, complete   sequence; unknown protein. "	DPlate 073	E07			AU071266				19	I13
4826	g_4826	SA0385		DPlate 075	E07			AU075848	AU075849			19	J13
4827	g_4827	RB0968	">AF102173_1(AF102173|pid:g3851707) Arabidopsis thaliana actin   depolymerizing factor 1 (ADF1) gene, complete cds.   &ATU48938_1(U48938|pid:g1408471) "	DPlate 073	F07			AU071255	AU162637			19	K13
4828	g_4828	SA0330	">D88122_1(D88122|pid:g1853970) Vigna unguiculata mRNA for CPRD46   protein, complete cds. "	DPlate 075	F07			AU056148	AU162656			19	L13
4829	g_4829	RB0929	">AF023472_1(AF023472|pid:g2655098) Hordeum vulgare peptide   transporter (ptr1) mRNA, complete cds; PTR1; integral   membrane protein. "	DPlate 073	G07			AU071222				19	M13
4830	g_4830	SA0338	>(P55061) TEGT PROTEIN (TESTIS ENHANCED GENE TRANSCRIPT).   &HSTEGT_1(X75861|pid:g458545) &I38334(I38334) 	DPlate 075	G07			AU056159	AU056160			19	N13
4831	g_4831	RB0937		DPlate 073	H07			AU071230				19	O13
4832	g_4832	SA0354	>B70885(B70885) hypothetical protein Rv2795c - Mycobacterium   tuberculosis (strain H37RV)   &MTV002_60(AL008967|pid:g2624317) 	DPlate 075	H07			AU056178	AU056179			19	P13
4833	g_4833	SA0454	">ATAC006260_8(AC006260|pid:g4371285) Arabidopsis thaliana chromosome   II BAC T2N18 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 076	A01			AU056297	AU056298			20	A01
4834	g_4834	SA1263	>LLAJ3363_1(AJ223363|pid:g2791948) Lupinus luteus mRNA for ribosomal   protein L13a. 	DPlate 079	A01			AU057232	AU057233			20	B01
4835	g_4835	SA0462	">ATF20B18_2(AL049483|pid:g4538920) Arabidopsis thaliana DNA   chromosome 4, BAC clone F20B18 (ESSA project);   similarity to nitrogen fixation protein nifU - Anabaena   sp., Pir2:D34443. "	DPlate 076	B01			AU162670	AU056311			20	C01
4836	g_4836	SA1295		DPlate 079	B01			AU057277				20	D01
4837	g_4837	SA0486	>NPAJ4683_1(AJ224683|pid:g2924363) Narcissus pseudonarcissus mRNA   for zeta-carotene desaturase. 	DPlate 076	C01			AU173887	AU056341			20	E01
4838	g_4838	SA1224	">AF033194_1(AF033194|pid:g3169883) Lycopersicon esculentum   dehydroquinate dehydratase/shikimate:NADP oxidoreductase   mRNA, complete cds; similar to GenBank Accession Number   L32794. &AF034411_2(AF034411|pid:g3169888) "	DPlate 079	C01			AU057180	AU057181			20	F01
4839	g_4839	SA0407	">AF081922_1(AF081922|pid:g3421413) Oryza sativa protein phosphatase   2A 55 kDa B regulatory subunit gene, complete cds.   &AF081923_1(AF081923|pid:g3421415) "	DPlate 076	D01			AU173883	AU056232			20	G01
4840	g_4840	SA1232	">ATM3E9_13(AL022223|pid:g2982462) Arabidopsis thaliana DNA   chromosome 4, BAC clone M3E9 (ESSA project); similarity   to SPF1 protein, Ipomoea batatas, PIR2:S51529. "	DPlate 079	D01			AU162739	AU057193			20	H01
4841	g_4841	SA0423		DPlate 076	E01			AU082424	AU056250			20	I01
4842	g_4842	SA1240		DPlate 079	E01			AU077782	AU077783			20	J01
4843	g_4843	SA0431		DPlate 076	F01			AU056261	AU056262			20	K01
4844	g_4844	SA1256		DPlate 079	F01			AU057222				20	L01
4845	g_4845	SA0487		DPlate 076	G01			AU056342	AU056343			20	M01
4846	g_4846	SA1264		DPlate 079	G01			AU057234	AU057235			20	N01
4847	g_4847	SA0495	">ATAF000657_3(AF000657|pid:g2462822) Arabidopsis thaliana BAC   F19G10, complete sequence; hypothetical protein. "	DPlate 076	H01			AU056349	AU056350			20	O01
4848	g_4848	SA1272	">ATAC004238_9(AC004238|pid:g3033382) Arabidopsis thaliana chromosome   II BAC F19I3 genomic sequence, complete sequence;   unknown protein. "	DPlate 079	H01			AU057244	AU057245			20	P01
4849	g_4849	SA0643	">AB014591_1(AB014591|pid:g3327196) Homo sapiens mRNA for KIAA0691   protein, complete cds. "	DPlate 076	A07			AU056504	AU056505			20	A13
4850	g_4850	SA1443		DPlate 079	A07			AU181024				20	B13
4851	g_4851	SA0659	">ATAC005936_1(AC005936|pid:g4038030) Arabidopsis thaliana chromosome   II BAC F5O4 genomic sequence, complete sequence. "	DPlate 076	B07			AU056526	AU056527			20	C13
4852	g_4852	SA1483	>ATRSZP22_1(AJ002378|pid:g2582645) Arabidopsis thaliana mRNA for   RSZp22 splicing factor; Zn-finger containing   Arg/Ser-rich 22kD splicing factor. 	DPlate 079	B07			AU057489	AU057490			20	D13
4853	g_4853	SA0667		DPlate 076	C07			AU056539	AU056540			20	E13
4854	g_4854	SA1412	">ATAC002335_3(AC002335|pid:g2288981) Arabidopsis thaliana chromosome   II BAC T01O24 genomic sequence, complete sequence;   &ATAC004450_23(AC004450|pid:g3763938) "	DPlate 079	C07			AU057399	AU057400			20	F13
4855	g_4855	SA0675	>STAROB_1(Y08642|pid:g1619336) S.typhimurium aroB gene. 	DPlate 076	D07			AU162699	AU056551			20	G13
4856	g_4856	SA1460	">D85381_1(D85381|pid:g1841355) Oryza sativa mitochondrial DNA for   cytochrome c oxidase subunit Vb precursor, complete cds.   "	DPlate 079	D07			AU057455	AU057456			20	H13
4857	g_4857	SA0604	>NTNTK1RN_1(X77763|pid:g456356) N.tabacum NtK-1 mRNA.   &S52095(S52095;S42085) 	DPlate 076	E07			AU173903	AU056453			20	I13
4858	g_4858	SA1484	">D90905_107(D90905|pid:g1652467) Synechocystis sp. PCC6803 complete   genome, 7/27, 781449-920915; ORF_ID:ssr2016.   &S77542(S77542) "	DPlate 079	E07			AU173958	AU173959			20	J13
4859	g_4859	SA0620		DPlate 076	F07			AU056475				20	K13
4860	g_4860	SA1413		DPlate 079	F07			AU057401	AU057402			20	L13
4861	g_4861	SA0628		DPlate 076	G07			AU056486	AU056487			20	M13
4862	g_4862	SA1477		DPlate 079	G07			AU057483	AU057484			20	N13
4863	g_4863	SA0636	">AF031243_1(AF031243|pid:g3329366) Lotus japonicus nodule-specific   protein Nlj70 mRNA, complete cds; similar to Oxalobacter   formigenes oxalate/formate exchange protein. "	DPlate 076	H07			AU056496	AU056497			20	O13
4864	g_4864	SA1478	>(P05424) CHLOROPLAST 30S RIBOSOMAL PROTEIN S7.   &CHOSXX_100(X15901|pid:g12065)   &CHOSXX_74(X15901|pid:g12037)   &R3RZ7(JQ0276;S05156;S01060) 	DPlate 079	H07			AU070286	AU173957			20	P13
4865	g_4865	SA1908	>S51590(S51590) mitochondrial processing peptidase (EC 3.4.99.41)   alpha-II chain precursor - potato   &STAIIMPP_1(X80236|pid:g587562) 	DPlate 081	A01			AU057920	AU057921			21	A01
4866	g_4866	SS3984	>CELZC13_4(U67953|pid:g1519683) Caenorhabditis elegans cosmid ZC13;   weak similarity to EGF-like domain cysteine pattern   signature (PS:PS00022); coded for by C. elegans cDNA   yk70d5.3; coded for by C. elegans cDNA yk70d5.5. 	DPlate 083	A01			D48054	AU162984			21	B01
4867	g_4867	SA1996		DPlate 081	B01			AU058016				21	C01
4868	g_4868	SS3921	">AF068299_1(AF068299|pid:g4262277) Arabidopsis thaliana   gamma-glutamylcysteine synthetase gene, complete cds.   &ATF7H19_29(AL031018|pid:g3292836) "	DPlate 083	B01			D48012	AU174029			21	D01
4869	g_4869	SS0009		DPlate 081	C01			AU162793	AU032432			21	E01
4870	g_4870	SS3937		DPlate 083	C01			D48023	AU174031			21	F01
4871	g_4871	SS0017	">(P22418) FRUCTOSE-1,6-BISPHOSPHATASE, CHLOROPLAST (EC 3.1.3.11)   (D-FRUCTOSE-1,6-BISPHOSPHATE 1-PHOSPHOHYDROLASE)   (FBPASE). &PASPC(S09587;B37295;A28046;A31315)   &PDBF(1SPI)A &PDBF(1SPI)B &PDBF(1SPI)C &PDBF(1SPI)D "	DPlate 081	D01			AU065758	AU173977			21	G01
4872	g_4872	SS3953	">ZMU23188_1(U23188|pid:g733454) Zea mays chlorophyll a/b-binding   apoprotein CP26 (Lhcb5-1) mRNA, complete cds. "	DPlate 083	D01			D48032				21	H01
4873	g_4873	SS0033	>GMCHLH_1(AJ001091|pid:g3059095) Glycine max mRNA for magnesium   chelatase subunit. 	DPlate 081	E01			AU032441	AU175142			21	I01
4874	g_4874	SS3977		DPlate 083	E01			D48049	AU174035			21	J01
4875	g_4875	SS0041	">CHOSRBCL_1(X04789|pid:g11955) Rice chloroplast DNA for   ribulose-1,5-biphosphate carboxylase (clone pCT-1);   ribulose-1,5-bisphosphate carboxylase (AA 1 - 477).   &S26070(S26070) "	DPlate 081	F01			AU101728	AU173980			21	K01
4876	g_4876	SS3993	>OSPIR7BR_1(Z34270|pid:g498747) O.sativa (cv. Nohrin) Pir7b mRNA.   &S47085(S47085) 	DPlate 083	F01			D48061				21	L01
4877	g_4877	SS0010	>S51468(S51468;S20171;S20169;S20166) probable membrane protein   YLR381w - yeast (Saccharomyces cerevisiae)   &YSCLL3502_4(U19104|pid:g609426) 	DPlate 081	G01			AU065755	AU032433			21	M01
4878	g_4878	SS3922	>CRO6065_1(AJ006065|pid:g4127688) Catharanthus roseus mRNA for   isochorismate synthase. 	DPlate 083	G01			D48013	AU096479			21	N01
4879	g_4879	SS0066		DPlate 081	H01			AU065770	AU032451			21	O01
4880	g_4880	SS3938	">CEF25B3_5(Z70752|pid:g3876239) Caenorhabditis elegans cosmid F25B3,   complete sequence; cDNA EST EMBL:T00216 comes from this   gene; cDNA EST EMBL:T02104 comes from this gene; cDNA   EST EMBL:D65104 comes from this gene; cDNA EST   EMBL:D68420 comes from this gene; cDNA EST EMBL:C13751   comes from this gene; cDNA EST EMBL:C11518 comes from   this gene; cDNA EST yk343c1.3 comes from this gene; cDNA   EST yk484g10.5 comes from this gene.   &CEK09G1_5(Z81101|pid:g3878500) "	DPlate 083	H01			D48024				21	P01
4881	g_4881	SS0792	>A58545_1(A58545|pid:g3714146) Sequence 1 from Patent WO9638566;   unnamed protein product.   &NPZEAXANT_1(X95732|pid:g1370274) &S69548(S69548) 	DPlate 081	A07			D46247	AU032582			21	A13
4882	g_4882	SS4239	>(P37528) HYPOTHETICAL 21.4 KD PROTEIN IN DACA-SERS INTERGENIC   REGION. &BAC180K_76(D26185|pid:g467402)   &BSUB0001_12(Z99104|pid:g2632279) &S66042(S66042;E69736)   	DPlate 083	A07			D48164	AU162999			21	B13
4883	g_4883	SS0785	">ATAC002332_40(AC002332|pid:g2459443) Arabidopsis thaliana   chromosome II BAC F4P9 genomic sequence, complete   sequence; "	DPlate 081	B07			D46243	AU162816			21	C13
4884	g_4884	SS4271	">ATF9D16_20(AL035394|pid:g4454042) Arabidopsis thaliana DNA   chromosome 4, BAC clone F9D16 (ESSAII project); strong   similarity to Pennisetum ciliare possible   apospory-associated mRNA clone pSUB C, PID:g549984. "	DPlate 083	B07			D48187	AU174050			21	D13
4885	g_4885	SS0794	">ATT24A18_1(AL035680|pid:g4490702) Arabidopsis thaliana DNA chromosome   4, BAC clone T24A18 (ESSA project); similarity to   Arabidopsis thaliana chromosome II BAC T25N22 genomic   sequence, PID:g3805764. "	DPlate 081	C07			D46248	AU032583			21	E13
4886	g_4886	SS4287		DPlate 083	C07			D48199	AU174052			21	F13
4887	g_4887	SS0715		DPlate 081	D07			AU162814	AU032544			21	G13
4888	g_4888	SS4208	">ATT5L19_16(AL049481|pid:g4539006) Arabidopsis thaliana DNA   chromosome 4, BAC clone T5L19 (ESSA project); weak   similarity to protoporphyrin IX magnesium chelatase (EC   4.99.1.-) bchO - Rhodobacter capsulatus, PIR2:S17820;   contains EST gb:T43635, Aa395175. "	DPlate 083	D07			D48142	AU174040			21	H13
4889	g_4889	SS0739	">ATF17I5_16(AL031032|pid:g3297821) Arabidopsis thaliana DNA   chromosome 4, BAC clone F17I5 (ESSAII project); strong   similarity to extensin-like protein, Zea mays,   PIR2:S49915. "	DPlate 081	E07			AU032558	AU032559			21	I13
4890	g_4890	SS4224	>ASATUBULP_1(X97446|pid:g1279206) A.sativa mRNA for alpha-tubulin. 	DPlate 083	E07			D48151	AU162997			21	J13
4891	g_4891	SS0787	">ATAC005170_15(AC005170|pid:g3738324) Arabidopsis thaliana   chromosome II BAC T29E15 genomic sequence, complete   sequence; "	DPlate 081	F07			D46245				21	K13
4892	g_4892	SS4248	>IG002N01_28(AF007269|pid:g2191136) Arabidopsis thaliana BAC   IG002N01; Similar to UTP-Glucose Glucosyltransferase;   coded for by A. thaliana cDNA T46230; coded for by A.   thaliana cDNA H76538; coded for by A. thaliana cDNA   H76290. 	DPlate 083	F07			D48173				21	L13
4893	g_4893	SS0764		DPlate 081	G07			AU032573				21	M13
4894	g_4894	SS4280	">ATAC005896_16(AC005896|pid:g4056490) Arabidopsis thaliana   chromosome II BAC F3G5 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 083	G07			D48192	AU101792			21	N13
4895	g_4895	SS1641	">D90906_99(D90906|pid:g1652591) Synechocystis sp. PCC6803 complete   genome, 8/27, 920916-1056466; ORF_ID:slr1227.   &S77409(S77409) "	DPlate 081	H07			D46764	AU173987			21	O13
4896	g_4896	SS4288	">AF081794_1(AF081794|pid:g4140398) Nicotiana tabacum   sterol-C5(6)-desaturase mRNA, complete cds. "	DPlate 083	H07			AU163003	AU163004			21	P13
4897	g_4897	SS5855	">AF094776_1(AF094776|pid:g3789954) Oryza sativa chlorophyll   a/b-binding protein precursor (Cab26) mRNA, nuclear gene   encoding chloroplast protein, complete cds; 26 KDa. "	DPlate 085	A01			AU070450				22	A01
4898	g_4898	ST0705		DPlate 087	A01			AU181035				22	B01
4899	g_4899	SS5871		DPlate 085	B01			D49168	AU162078			22	C01
4900	g_4900	ST0745		DPlate 087	B01			D39429				22	D01
4901	g_4901	SS5824		DPlate 085	C01			D49135	AU162070			22	E01
4902	g_4902	ST0753	">ATAC004482_4(AC004482|pid:g3152606) Arabidopsis thaliana chromosome   II BAC F27L4 genomic sequence, complete sequence; "	DPlate 087	C01			D39434	AU174152			22	F01
4903	g_4903	SS5872	">ATAC006218_10(AC006218|pid:g4263771) Arabidopsis thaliana   chromosome II BAC F17L24 genomic sequence, complete   sequence; "	DPlate 085	D01			D49169	AU174093			22	G01
4904	g_4904	ST0730	>OSA18623_1(Y18623|pid:g4158219) Oryza sativa mRNA for amylogenin. 	DPlate 087	D01			D39419	AU174151			22	H01
4905	g_4905	SS5901	>(P36160) HYPOTHETICAL 39.6 KD PROTEIN IN MTD1-NUP133 INTERGENIC   REGION. &S38159(S38159;S42010;S39122)   &SCUNORF1_2(Z27116|pid:g415901)   &SCYKR081C_1(Z28306|pid:g486561) 	DPlate 085	E01			AU065903	AU162087			22	I01
4906	g_4906	ST0723	>(P51646) ADP-RIBOSYLATION FACTOR-LIKE PROTEIN 5.   &RNARL5_1(X78604|pid:g1150556) &S72161(S72161) 	DPlate 087	E01			D39414	AU161567			22	J01
4907	g_4907	SS5909	">AF093636_1(AF093636|pid:g3885896) Oryza sativa plastocyanin   precursor, mRNA, complete cds. "	DPlate 085	F01			AU070453				22	K01
4908	g_4908	ST0779	>ATGELSOLI_1(Y12782|pid:g3093294) Arabidopsis thaliana mRNA for   putative villin. 	DPlate 087	F01			D39448	AU161572			22	L01
4909	g_4909	SS5925		DPlate 085	G01			AU174097	AU174098			22	M01
4910	g_4910	ST0748	">AB012228_1(AB012228|pid:g3132310) Zea mays mRNA for   phosphoenolpyruvate carboxylase, complete cds; synonymous   gene name: Pep2 in maize linkage map. "	DPlate 087	G01			AU066066				22	N01
4911	g_4911	SS5981	">ATU74669_1(U74669|pid:g2231303) Arabidopsis thaliana ras-related   small GTPase (AtRAB11c) mRNA, complete cds.   &F21M12_2(AC000132|pid:g2160157) "	DPlate 085	H01			AU065935				22	O01
4912	g_4912	ST0796	">AC003981_21(AC003981|pid:g3063459) Complete sequence of Arabidopsis   F22O13, complete sequence; similar to MAP3K delta-1   protein kinase (Y14199). "	DPlate 087	H01			AU174155	AU174156			22	P01
4913	g_4913	SS6201	">AF118129_1(AF118129|pid:g4337001) Nicotiana tabacum   Tsi1-interacting protein TSIP1 (TSIP1) mRNA, complete   cds. "	DPlate 085	A07			C24927	AU174114			22	A13
4914	g_4914	ST0906	">F21M12_26(AC000132|pid:g2160177) Sequence of BAC F21M12 from   Arabidopsis thaliana chromosome 1, complete sequence;   EST gb|R64758 comes from this gene.. "	DPlate 087	A07			D39513	AU033001			22	B13
4915	g_4915	SS6209	">ATU63815_5(U63815|pid:g1532167) Arabidopsis thaliana AT.I.24-1,   AT.I.24-2, AT.I.24-3, AT.I.24-4, AT.I.24-5, AT.I.24-6,   AT.I.24-9 and AT.I.24-14 genes, partial cds, AT.I.24-7,   ascorbate peroxidase (ATHAPX1), EF-1alpha-A1, -A2 and   -A3 (EF-1alpha) and AT.I.24-13 genes, complete cds;   localized according to blastn similarity to EST   sequences; therefore, the coding span corresponds only   to an area of similarity since the initation codon and   stop codon could not be precisely determined. "	DPlate 085	B07			C24931	AU174115			22	C13
4916	g_4916	ST0938	>(P28284) TRANS-ACTING TRANSCRIPTIONAL PROTEIN ICP0 (VMW118   PROTEIN). &EDBEXD(JQ1501)   &HS2ULIR_5(D10471|pid:g2626942)   &HSV2HG52_2(Z86099|pid:g1869822) 	DPlate 087	B07			AU174176	AU174177			22	D13
4917	g_4917	SS6225	">ATF17M5_26(AL035678|pid:g4490317) Arabidopsis thaliana DNA chromosome   4, BAC clone F17M5 (ESSA project); similarity to YHR077c   (NMD2, IFS1) protein -Saccharomyces cerevisiae,   PID:g555939. "	DPlate 085	C07			C24934	AU174118			22	E13
4918	g_4918	ST0954		DPlate 087	C07			D39539	AU174178			22	F13
4919	g_4919	SS6202	">ATF24G24_7(AL049488|pid:g4538956) Arabidopsis thaliana DNA   chromosome 4, BAC clone F24G24 (ESSA project);   similarity to wound-induced protein, Lycopersicon   esculentum, PIR2:S19773. &T9A4_3(AF096373|pid:g3695408)   "	DPlate 085	D07			C24928				22	G13
4920	g_4920	ST0939		DPlate 087	D07			D39531	AU101926			22	H13
4921	g_4921	SS6210	>(P26302) PHOSPHORIBULOKINASE PRECURSOR (EC 2.7.1.19)   (PHOSPHOPENTOKINASE) (PRKASE) (PRK). &S15743(S15743) 	DPlate 085	E07			AU162121	AU162122			22	I13
4922	g_4922	ST0947	">(P80313) T-COMPLEX PROTEIN 1, ETA SUBUNIT (TCP-1-ETA) (CCT-ETA).   &MMCCTHE_1(Z31399|pid:g468504) &S43058(S43058) "	DPlate 087	E07			D39537	AU033006			22	J13
4923	g_4923	SS6234		DPlate 085	F07			AU032915	AU101855			22	K13
4924	g_4924	ST0955		DPlate 087	F07			D39540	AU033007			22	L13
4925	g_4925	SS6258	">ATFCA8_52(Z97343|pid:g2245125) Arabidopsis thaliana DNA chromosome   4, ESSA I contig fragment No. 8; similarity to   globulin-1O, GLB1O - maize. &F71446(F71446) "	DPlate 085	G07			AU032918	AU101857			22	M13
4926	g_4926	ST0971	>(P46265) TUBULIN BETA CHAIN. &RICBTB_1(D30717|pid:g493710) 	DPlate 087	G07			AU163201	AU174181			22	N13
4927	g_4927	SS6274		DPlate 085	H07			AU065980				22	O13
4928	g_4928	ST0924	>(P36413) DIHYDROLIPOAMIDE ACETYLTRANSFERASE COMPONENT (E2) OF   PYRUVATE DEHYDROGENASE COMPLEX PRECURSOR (EC 2.3.1.12)   (PDC-E2) (FRAGMENT). &DDU06634_1(U06634|pid:g458426) 	DPlate 087	H07			D39521	AU033004			22	P13
4929	g_4929	ST2181	>C71224(C71224)probable 1-aminocyclopropane-1-carboxylate deaminase   - Pyrococcus horikoshii 	DPlate 089	A01			D40302	AU097103			23	A01
4930	g_4930	ST4050	>ATU95973_26(U95973|pid:g1931655) Arabidopsis thaliana BAC T19D16   genomic sequence; 5' partial. 	DPlate 091	A01			D41511	AU161666			23	B01
4931	g_4931	ST2110		DPlate 089	B01			AU070532	AU097099			23	C01
4932	g_4932	ST4003	">AB013098_1(AB013098|pid:g3107919) Nannochloris bacillaris nbact   gene for actin, complete cds. "	DPlate 091	B01			D41480	AU161657			23	D01
4933	g_4933	ST2142	">SLU49330_1(U49330|pid:g1222552) Solanum lycopersicum pectin   methylesterase (PMEU1) mRNA, complete cds;   pectinesterase. "	DPlate 089	C01			D40279	AU101942			23	E01
4934	g_4934	ST4035	">ATAC005396_7(AC005396|pid:g3650033) Arabidopsis thaliana chromosome   II BAC T26I20 genomic sequence, complete sequence;   unknown protein. "	DPlate 091	C01			D41501	AU101990			23	F01
4935	g_4935	ST2182	">AC002330_16(AC002330|pid:g2281115) Arabidopsis thaliana BAC T10P11   from chromosome IV, near 15 cM, complete sequence;   member of cullin family involved in ubiquitinization;   similar to O. sativa cullin-like proteins; functional   catalog ID=06.13. "	DPlate 089	D01			D40303	AU108298			23	G01
4936	g_4936	ST4043	">GMU36430_1(U36430|pid:g1218004) Glycine max dynamin-like protein   SDL5A mRNA, complete cds; dynamin-like protein.   &S63668(S63668) "	DPlate 091	D01			D41506	AU033143			23	H01
4937	g_4937	ST2103	>(P48488) SERINE/THREONINE PROTEIN PHOSPHATASE PP1 (EC 3.1.3.16).   &MVPP1MS_1(X80788|pid:g575672) &S46282(S46282) 	DPlate 089	E01			D40255	AU161643			23	I01
4938	g_4938	ST4091	">AC004122_7(AC004122|pid:g3540184) Arabidopsis thaliana chromosome I   BAC T27I1 genomic sequence, complete sequence; Similar to   endoxylanases; Similar to endoxylanases gi|1255238   (Thermoanaerobacterium thermosulfurigenes), gi|1813595   (Hordeum vulgare) and others. "	DPlate 091	E01			D41543	AU101994			23	J01
4939	g_4939	ST2135	">ATF1C12_22(AL022224|pid:g3046695) Arabidopsis thaliana DNA   chromosome 4, BAC clone F1C12 (ESSAII project);   similarity to hypothetical protein Arabidopsis thaliana;   contains EST gb:R84134, Z47643, F20139, AA394732. "	DPlate 089	F01			AU174248	AU174249			23	K01
4940	g_4940	ST4036	">ATAC002505_23(AC002505|pid:g2739381) Arabidopsis thaliana   chromosome II BAC T9J22 genomic sequence, complete   sequence; "	DPlate 091	F01			D41502	AU033142			23	L01
4941	g_4941	ST2143	">F9K20_25(AC005679|pid:g3834323) Arabidopsis thaliana chromosome 1   BAC F9K20 sequence, complete sequence; "	DPlate 089	G01			AU108199	AU033061			23	M01
4942	g_4942	ST4060	">ATF16G20_20(AL031326|pid:g3451075) Arabidopsis thaliana DNA   chromosome 4, BAC clone F16G20 (ESSAII project);   similarity to picA protein, Agrobacterium tumefaciens,   PIR2:A40364. "	DPlate 091	G01			AU082184				23	N01
4943	g_4943	ST2151	>RICRGP2_1(D13152|pid:g218204) Rice mRNA for GTP binding protein.   &S30273(S30273;JS0761) 	DPlate 089	H01			D40285	AU101943			23	O01
4944	g_4944	ST4084	">AF081802_1(AF081802|pid:g3789911) Dictyostelium discoideum   developmental protein DG1118 (DG1118) gene, complete   cds; disruption of this gene results in morphological   defect; similar to Schizosaccharomyces pombe   hypothetical protein encoded by sequence in GenBank   Accession Number AL022600. "	DPlate 091	H01			D41537	AU101992			23	P01
4945	g_4945	ST2556	">ATAC005662_8(AC005662|pid:g3894187) Arabidopsis thaliana chromosome   II BAC F13H10 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 089	A07			D40521	AU033076			23	A13
4946	g_4946	ST4395	">ATAC002409_10(AC002409|pid:g2623304) Arabidopsis thaliana   chromosome II BAC T20B5 genomic sequence, complete   sequence; "	DPlate 091	A07			D41717	AU174335			23	B13
4947	g_4947	ST2564		DPlate 089	B07			AU108307				23	C13
4948	g_4948	ST4340	">ATF20D10_32(AL035538|pid:g4467126) Arabidopsis thaliana DNA   chromosome 4, BAC clone F20D10 (ESSA project); strong   similarity to guanine nucleotide-exchange protein -Bos   taurus, PID:g2674107. "	DPlate 091	B07			D41682	AU174321			23	D13
4949	g_4949	ST2572		DPlate 089	C07			D40529	AU108309			23	E13
4950	g_4950	ST4348		DPlate 091	C07			D41688	AU174324			23	F13
4951	g_4951	ST2596		DPlate 089	D07			AU066082	C23635			23	G13
4952	g_4952	ST4801	">OSU82833_1(U82833|pid:g1778821) Oryza sativa   S-adenosyl-L-methionine synthetase (pOS-SAMS2) mRNA,   complete cds. "	DPlate 091	D07			AU174336				23	H13
4953	g_4953	ST2610		DPlate 089	E07			AU181045				23	I13
4954	g_4954	ST4809	">ATF7J7_10(AL021960|pid:g2911073) Arabidopsis thaliana DNA   chromosome 4, BAC clone F7J7 (ESSAII project);   similarity to Human mRNA for KIAA0050 gene,   PATCHX:D1006988; contains EST gb:T13796, T04032,   AA712583, T04033, H36207. "	DPlate 091	E07			D41861	AU102000			23	J13
4955	g_4955	ST2627	">AF003105_1(AF003105|pid:g2281649) Arabidopsis thaliana AP2 domain   containing protein RAP2.12 mRNA, partial cds; putative   DNA binding protein; similar to A. thaliana APETALA2   encoded by GenBank Accession Number U12546. "	DPlate 089	F07			D40562	AU101955			23	K13
4956	g_4956	ST4833	">ATAC004165_14(AC004165|pid:g3150410) Arabidopsis thaliana chromosome   II BAC T27E13 genomic sequence, complete sequence;   unknown protein. "	DPlate 091	F07			AU163246	AU033191			23	L13
4957	g_4957	ST2643	">B48013(B48013) proline-rich proteoglycan 2 precursor, parotid - rat   &RATPRPGB_1(L17318|pid:g310200) "	DPlate 089	G07			AU070542				23	M13
4958	g_4958	ST4818	">ATAC006232_4(AC006232|pid:g4314378) Arabidopsis thaliana chromosome   II BAC F10A12 genomic sequence, complete sequence; "	DPlate 091	G07			D41866	AU075911			23	N13
4959	g_4959	ST2659		DPlate 089	H07			AU070543				23	O13
4960	g_4960	ST4835		DPlate 091	H07			D41875	AU102003			23	P13
4961	g_4961	ST5838	">AF061508_1(AF061508|pid:g3264605) Zea mays ribosomal protein L25   mRNA, partial cds. "	DPlate 093	A01			AU161824				24	A01
4962	g_4962	EE0134	>CELK11H12_2(U88168|pid:g1825597) Caenorhabditis elegans cosmid   K11H12; similar to E. coli bola protein (SP:P15298);   coded for by C. elegans cDNA CEESR81F. 	DPlate 042	A06			C74003	AU029307			24	B01
4963	g_4963	ST5862	">AF062894_1(AF062894|pid:g3941480) Arabidopsis thaliana putative   transcription factor (MYB59) mRNA, complete cds; MYB59;   R2R3-MYB factor family member. "	DPlate 093	B01			AU161828				24	C01
4964	g_4964	EE0182		DPlate 042	B06			AU029341				24	D01
4965	g_4965	ST5886		DPlate 093	C01			AU175171	AU176552			24	E01
4966	g_4966	EE0135		DPlate 042	C06			AU029308				24	F01
4967	g_4967	ST5815	">ATF24G24_7(AL049488|pid:g4538956) Arabidopsis thaliana DNA   chromosome 4, BAC clone F24G24 (ESSA project);   similarity to wound-induced protein, Lycopersicon   esculentum, PIR2:S19773. &T9A4_3(AF096373|pid:g3695408)   "	DPlate 093	D01			AU176549	AU176550			24	G01
4968	g_4968	EE0143	">PSU34743_1(U34743|pid:g1173622) Phalaenopsis sp. 'hybrid SM9108'   homeobox protein mRNA, complete cds. &S71477(S71477) "	DPlate 042	D06			C74009	AU029314			24	H01
4969	g_4969	ST5839		DPlate 093	E01			AU181055				24	I01
4970	g_4970	EE0151		DPlate 042	E06			AU029317				24	J01
4971	g_4971	ST5855		DPlate 093	F01			AU181057				24	K01
4972	g_4972	EE0175	>(P41098) 60S RIBOSOMAL PROTEIN L34. &S48027(S48027;S48028)   &TOB6RPLA_1(L27107|pid:g436032)   &TOB6RPL_1(L27089|pid:g436030) 	DPlate 042	F06			C74023	AU029336			24	L01
4973	g_4973	ST5895		DPlate 093	G01			AU066248	AU174377			24	M01
4974	g_4974	EE0120	">ATU63815_9(U63815|pid:g1532171) Arabidopsis thaliana AT.I.24-1,   AT.I.24-2, AT.I.24-3, AT.I.24-4, AT.I.24-5, AT.I.24-6,   AT.I.24-9 and AT.I.24-14 genes, partial cds, AT.I.24-7,   ascorbate peroxidase (ATHAPX1), EF-1alpha-A1, -A2 and -A3   (EF-1alpha) and AT.I.24-13 genes, complete cds; CDS   localized after complete sequencing of a cognate cDNA. "	DPlate 042	G06			C73998	AU029300			24	N01
4975	g_4975	ST5872	">ATAC006931_15(AC006931|pid:g4512671) Arabidopsis thaliana   chromosome II BAC F7D19 genomic sequence, complete   sequence; unknown protein. "	DPlate 093	H01			C25305	AU174375			24	O01
4976	g_4976	EE0136	">ATF13M23_3(AL035523|pid:g4455232) Arabidopsis thaliana DNA   chromosome 4, BAC clone F13M23 (ESSAII project);   similarity to acid phosphatase (EC 3.1.3.2) PAP,   Phaseolus vulgaris, PIR1:S51031. "	DPlate 042	H06			C74004	AU029309			24	P01
4977	g_4977	ST6177	>A44803(A44803)pG1 protein - human (fragment) 	DPlate 093	A07			AU175172				24	A13
4978	g_4978	posi01										24	B13
4979	g_4979	ST6106		DPlate 093	B07			AU102037	AU102038			24	C13
4980	g_4980	posi02										24	D13
4981	g_4981	ST6114	>ATU95973_2(U95973|pid:g2252628) Arabidopsis thaliana BAC T19D16   genomic sequence; hypothetical protein. 	DPlate 093	C07			AU102043	AU102044			24	E13
4982	g_4982	posi03										24	F13
4983	g_4983	ST6122		DPlate 093	D07			AU176553				24	G13
4984	g_4984	posi04										24	H13
4985	g_4985	ST6154		DPlate 093	E07			AU161876				24	I13
4986	g_4986	posi05										24	J13
4987	g_4987	ST6194	">AF049917_1(AF049917|pid:g4105772) Petunia x hybrida PGP9B (PGP9B)   mRNA, complete cds. "	DPlate 093	F07			AU102059	AU102060			24	K13
4988	g_4988	posi06										24	L13
4989	g_4989	ST6107		DPlate 093	G07			AU078772	AU078773			24	M13
4990	g_4990	posi07										24	N13
4991	g_4991	ST6187		DPlate 093	H07			AU077920	AU077921			24	O13
4992	g_4992	posi08										24	P13
4993	g_4993	EG0485	>(P34661) HYPOTHETICAL 9.8 KD PROTEIN ZK652.3 IN CHROMOSOME III.   &CELZK652_6(L14429|pid:g289769) &S44903(S44903) 	DPlate 050	A01			AU166189	AU030009			13	A02
4994	g_4994	EG1150	">MMU42471_1(U42471|pid:g1150834) Mus musculus Wiscott-Aldrich   Syndrome protein homolog (N-3AP1) mRNA, complete cds;   Nck-SH3-associating protein 1. "	DPlate 052	A01			AU095079	AU030499			13	B02
4995	g_4995	EG0430	>(P46297) 40S RIBOSOMAL PROTEIN S23 (S12).   &FXU19940_1(U19940|pid:g643074) &S56673(S56673) 	DPlate 050	B01			AU029980	AU091400			13	C02
4996	g_4996	EG1159	">ATAC005170_17(AC005170|pid:g3738326) Arabidopsis thaliana   chromosome II BAC T29E15 genomic sequence, complete   sequence; "	DPlate 052	B01			AU172979	AU058427			13	D02
4997	g_4997	EG0446	">SPAC19G12_16(Z97209|pid:g2879765) S.pombe chromosome I cosmid   c19G12; SPAC19G12.17c, partial; unknown, len:223aa,   similar eg. to YJR151C, YJ9P_YEAST, P47179, similarity   to mucin proteins, (1161aa), fasta scores, opt:347,   E():4.8e-13, (37.4% identity in 206 aa overlap). "	DPlate 050	C01			AU172956	AU029995			13	E02
4998	g_4998	EG1183		DPlate 052	C01			AU095088	AU058434			13	F02
4999	g_4999	EG0454		DPlate 050	D01			AU058320				13	G02
5000	g_5000	EG1105		DPlate 052	D01			AU030465	AU095065			13	H02
5001	g_5001	EG0455	">AF088912_1(AF088912|pid:g3608479) Petunia x hybrida ribosomal   protein L15 mRNA, complete cds. "	DPlate 050	E01			AU091403	AU029998			13	I02
5002	g_5002	EG1137	">T1J1_1(AF128393|pid:g4325343) Arabidopsis thaliana BAC T1J1;   contains similarity to homeobox domains (Pfam: PF00046,   Score,36.5, E=6.9e-08, N=1). "	DPlate 052	E01			AU065719	AU030487			13	J02
5003	g_5003	EG0463	">AB015760_1(AB015760|pid:g3273350) Nicotiana tabacum mRNA for   histone H3, complete cds.   &AF024716_1(AF024716|pid:g2558944)   &AF093633_1(AF093633|pid:g3885890)   &AF109910_1(AF109910|pid:g4038469)   &ATH3G_1(X60429|pid:g16324) &ATH3G_2(X60429|pid:g404825)   &ATT5J17_20(AL035708|pid:g4490754)   &ATT5J17_21(AL035708|pid:g4490755)   &LEH33_1(X83422|pid:g1435157)   &LTMRHIS3_1(X79714|pid:g510911)   &MSU09458_1(U09458|pid:g488563)   &MSU09460_1(U09460|pid:g488567)   &MSU09461_1(U09461|pid:g488569)   &MSU09464_1(U09464|pid:g488575)   &MSU09465_1(U09465|pid:g488577) &S24346(S24346) "	DPlate 050	F01			AU030004	AU078139			13	K02
5004	g_5004	EG1138		DPlate 052	F01			AU030488	AU095073			13	L02
5005	g_5005	EG0408	">AC002330_4(AC002330|pid:g3892058) Arabidopsis thaliana BAC T10P11   from chromosome IV, near 15 cM, complete sequence;   similar to rat N-methyl-D-aspartate receptor   glutamate-binding chain, GenBank accession number   S19586; similar to D. melanogaster N-methyl-D-aspartate   receptor-associated protein, GenBank accession number   L37377; functional catalog ID=10.01.05; contains Pfam   signature for uncharacterized protein family UPF0005,   score=107.1. "	DPlate 050	G01			AU172952	AU029973			13	M02
5006	g_5006	EG1186		DPlate 052	G01			AU172980	AU030525			13	N02
5007	g_5007	EG0456	">ATT4L20_34(AL023094|pid:g3096945) Arabidopsis thaliana DNA   chromosome 4, BAC clone T4L20 (ESSAII project);   similarity to auxin-induced protein X15, Glycine max,   PIR2:JQ1097; contains EST gb:T44528, AA395457. "	DPlate 050	H01			AU172957	AU029999			13	O02
5008	g_5008	EG1187		DPlate 052	H01			AU065733	AU030526			13	P02
5009	g_5009	EG0625		DPlate 050	A07			AU030099	AU030100			13	A14
5010	g_5010	EH0032		DPlate 052	A07			AU162305	AU030631			13	B14
5011	g_5011	EG0649	>OSSRP14_1(Y10118|pid:g2208962) O.sativa mRNA for signal recognition   particle subunit 14. 	DPlate 050	B07			AU172963	AU058358			13	C14
5012	g_5012	EH0048		DPlate 052	B07			AU030643	AU030644			13	D14
5013	g_5013	EG0673	">ATF19F18_15(AL035605|pid:g4468991) Arabidopsis thaliana DNA   chromosome 4, BAC clone F19F18 (ESSA project); strong   similarity to ribosomal protein L12, Liberobacter   africanum, U09675. "	DPlate 050	C07			AU172964	AU058363			13	E14
5014	g_5014	EH0056		DPlate 052	C07			AU082545	AU030651			13	F14
5015	g_5015	EG0626		DPlate 050	D07			AU075768	AU075769			13	G14
5016	g_5016	EH0080	>(P55238) GLUCOSE-1-PHOSPHATE ADENYLYLTRANSFERASE SMALL SUBUNIT   PRECURSOR (EC 2.7.7.27) (ADP-GLUCOSE SYNTHASE)   (ADP-GLUCOSE PYROPHOSPHORYLASE) (AGPASE B)   (ALPHA-D-GLUCOSE-1-PHOSPHATE ADENYL TRANSFERASE).   &HVADPGPM2_1(Z48563|pid:g1143502) &S61479(S61479;S61481)   	DPlate 052	D07			AU075787	AU172987			13	H14
5017	g_5017	EG0650		DPlate 050	E07			AU075774	AU075775			13	I14
5018	g_5018	EH0125		DPlate 052	E07			AU165866	AU030697			13	J14
5019	g_5019	EG0667	>CLH2A232_2(X80330|pid:g516304) C.longicaudatus genes for histones   H2a.2 and H3.2. &I48092(I48092) 	DPlate 050	F07			AU030133	AU030134			13	K14
5020	g_5020	EH0141	">TAU76745_1(U76745|pid:g4098321) Triticum aestivum beta-tubulin 2   (tubb2) mRNA, complete cds; Tubb2. "	DPlate 052	F07			AU030716	AU030717			13	L14
5021	g_5021	EG0604		DPlate 050	G07			AU030078	AU030079			13	M14
5022	g_5022	EH0181		DPlate 052	G07			AU030747	AU030748			13	N14
5023	g_5023	EG0605		DPlate 050	H07			AU162291	AU030080			13	O14
5024	g_5024	EH0142	">ATAC006284_3(AC006284|pid:g4335747) Arabidopsis thaliana chromosome   II BAC T4M8 genomic sequence, complete sequence; "	DPlate 052	H07			AU162314	AU030718			13	P14
5025	g_5025	EH0790	">ATAP21_41(Z99707|pid:g4006878) Arabidopsis thaliana DNA chromosome   4, ESSA I AP2 contig fragment No. 1; similarity to MAP3K   gamma protein kinase, Arabidopsis thaliana,   PATX:E332409; Contains FGGY family of carbohydrate   kinases signatures [GLPFNKYSWLTTH], Protein kinases   signatures and profile [IGHGSFSTVSLATTSGSSSKAFPSLMAVK]. "	DPlate 054	A01			AU075499	AU075498			14	A02
5026	g_5026	EH1458	>OSHSC70A_1(X67711|pid:g763160) O.sativa hsp70 gene for heat shock   protein 70. &S53126(S53126) 	DPlate 056	A01			AU173046				14	B02
5027	g_5027	EH0711	">ATAC006260_13(AC006260|pid:g4371290) Arabidopsis thaliana   chromosome II BAC T2N18 genomic sequence, complete   sequence; unknown protein. "	DPlate 054	B01			AU075439	AU031065			14	C02
5028	g_5028	EH1427		DPlate 056	B01			AU065305	AU101548			14	D02
5029	g_5029	EH0759	">RICE1_1(D38221|pid:g1549232) Rice gene for soluble starch synthase   (SSS1), complete cds (exon1-15). "	DPlate 054	C01			AU075475	AU075476			14	E02
5030	g_5030	EH1435		DPlate 056	C01			AU065307	AU095341			14	F02
5031	g_5031	EH0791	">AF016327_1(AF016327|pid:g2454602) Hordeum vulgare Barperm1 (perm1)   mRNA, partial cds; putative barley seed antifungal   protein. "	DPlate 054	D01			AU173023	AU173024			14	G02
5032	g_5032	EH1467	">RICARF_1(D17760|pid:g1132483) Rice mRNA for ADP-ribosylation   factor, complete cds. "	DPlate 056	D01			AU173047	AU031391			14	H02
5033	g_5033	EH0720	">AF024651_1(AF024651|pid:g2739044) Glycine max polyphosphoinositide   binding protein Ssh1p (SSH1) mRNA, complete cds; similar   to yeast Sec14p. "	DPlate 054	E01			AU075444	AU031068			14	I02
5034	g_5034	EH1428		DPlate 056	E01			AU164828				14	J02
5035	g_5035	EH0728	>(Q40784) POSSIBLE APOSPORY-ASSOCIATED PROTEIN C.   &PCU13148_1(U13148|pid:g549984) 	DPlate 054	F01			C74898	AU173015			14	K02
5036	g_5036	EH1452		DPlate 056	F01			AU031378	AU031379			14	L02
5037	g_5037	EH0784		DPlate 054	G01			AU173022				14	M02
5038	g_5038	EH1413	">ATF13D4_11(AL031369|pid:g3482975) Arabidopsis thaliana DNA   chromosome 2, BAC clone F13D4 (ESSAII project);   similarity to HSR201 protein, Nicotiana tabacum,   gb:X95343; contains EST gb:R65039. "	DPlate 056	G01			AU173045	AU101547			14	N02
5039	g_5039	EH0705	">AF036618_1(AF036618|pid:g2708624) Arabidopsis thaliana acetyl-CoA   synthetase mRNA, complete cds; identity based on   similarity to known acetyl-CoA synthetases. "	DPlate 054	H01			AU075434	AU031062			14	O02
5040	g_5040	EH1437	>AT81KBGEN_18(X98130|pid:g1402891) A.thaliana 81kb genomic sequence;   	DPlate 056	H01			AU164829	AU031373			14	P02
5041	g_5041	EH0831		DPlate 054	A07			AU065227	AU101504			14	A14
5042	g_5042	EH1613	">RICARF_1(D17760|pid:g1132483) Rice mRNA for ADP-ribosylation   factor, complete cds. "	DPlate 056	A07			AU031460	AU081573			14	B14
5043	g_5043	EH0839	">T1G11_13(AC002376|pid:g2494116) Sequence of BAC T1G11 from   Arabidopsis thaliana chromosome 1, complete sequence;   Similar to Synechocystis hypothetical protein   (gb|D90915).. "	DPlate 054	B07			AU065230	AU101507			14	C14
5044	g_5044	EH1629	>AE001637_8(AE001637|pid:g4376815) Chlamydia pneumoniae section 53   of 103 of the complete genome. 	DPlate 056	B07			AU162360	AU162361			14	D14
5045	g_5045	EH0855	">ATAC005896_4(AC005896|pid:g4056480) Arabidopsis thaliana chromosome   II BAC F3G5 genomic sequence, complete sequence; "	DPlate 054	C07			AU065232	AU078241			14	E14
5046	g_5046	EH1645	">AP000005_67(AP000005|pid:g3257577) Pyrococcus horikoshii OT3   genomic DNA, 994001-1166000 nt. position (5/7); similar   to owl:HPAE0006332 percent identity:27.451 in 212aa;   Swiss_Prot:P44659 percent identity:19.403 in 208aa.   &B71058(B71058) "	DPlate 056	C07			AU164858	AU164859			14	F14
5047	g_5047	EH0863		DPlate 054	D07			AU031120	AU101513			14	G14
5048	g_5048	EH1653	>(P38385) PROTEIN TRANSPORT PROTEIN SEC61 GAMMA SUBUNIT. 	DPlate 056	D07			AU162364				14	H14
5049	g_5049	EH0871	">AB017693_1(AB017693|pid:g4519671) Nicotiana tabacum WERBP-1 mRNA,   complete cds; transfactor. "	DPlate 054	E07			AU065238	AU101519			14	I14
5050	g_5050	EH1622	>ATH2AV_1(Y12575|pid:g2407800) Arabidopsis thaliana mRNA for histone   H2A.F/Z; highly expressed in proliferating cells. 	DPlate 056	E07			AU031462	AU101555			14	J14
5051	g_5051	EH0887		DPlate 054	F07			AU065248	AU101523			14	K14
5052	g_5052	EH1662	>BTCIB8_1(X63219|pid:g246) B.taurus CI-B8 mRNA for ubiquinone   oxidoreductase complex. &S28249(S28249) 	DPlate 056	F07			AU101561	AU101562			14	L14
5053	g_5053	EH0808	">ATAC004450_17(AC004450|pid:g3763932) Arabidopsis thaliana   chromosome II BAC F14B2 genomic sequence, complete   sequence; "	DPlate 054	G07			AU065222	AU101499			14	M14
5054	g_5054	EH1678	">ATF10M23_34(AL035440|pid:g4455223) Arabidopsis thaliana DNA   chromosome 4, BAC clone F10M23 (ESSAII project); strong   similarity to DNA binding protein ACBF - Nicotiana   tabacum, PID:g1899188; Contains Eukaryotic putative   RNA-binding region RNP-1 signature [KGYGFVRF]; contains   EST gb:R90593, N37296, T45906, H37555, T76417, T42140. "	DPlate 056	G07			AU101566	AU101567			14	N14
5055	g_5055	EH0840	">ATAC006532_10(AC006532|pid:g4406785) Arabidopsis thaliana   chromosome II BAC F14H20 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 054	H07			AU031112	AU031113			14	O14
5056	g_5056	EH1686		DPlate 056	H07			AU101570	AU101571			14	P14
5057	g_5057	FE0135		DPlate 058	A01			AU174626				15	A02
5058	g_5058	FL0079		DPlate 060	A01			AU174947	AU174948			15	B02
5059	g_5059	FE0167	">AF055356_1(AF055356|pid:g3242787) Arabidopsis thaliana respiratory   burst oxidase protein E (RbohE) gene, complete cds;   similar to gp91phox. "	DPlate 058	B01			AU174645	AU174644			15	C02
5060	g_5060	FL0087	>(P35845) OSH1 PROTEIN. &YSCCHR1RAA_11(L28920|pid:g456143) 	DPlate 060	B01			AU174957	AU174958			15	D02
5061	g_5061	FE0175	>(P46611) S-ADENOSYLMETHIONINE SYNTHETASE (EC 2.5.1.6) (METHIONINE   ADENOSYLTRANSFERASE) (ADOMET SYNTHETASE).   &OSSAMS1_1(Z26867|pid:g450549) 	DPlate 058	C01			AU174654				15	E02
5062	g_5062	FL0008		DPlate 060	C01			AU174882	AU174883			15	F02
5063	g_5063	FE0183		DPlate 058	D01			AU174661				15	G02
5064	g_5064	FL0016	">TOBNTCYCC_1(D50737|pid:g849074) Tobacco mRNA for B-type cyclin,   complete cds; putative. "	DPlate 060	D01			AU174890	AU174891			15	H02
5065	g_5065	FE0191	">ATFCA1_18(Z97336|pid:g2244806) Arabidopsis thaliana DNA chromosome   4, ESSA I contig fragment No. 1; similarity to   phosphatidylcholine transfer protein - bovine.   &C71407(C71407) "	DPlate 058	E01			AU174670	AU174671			15	I02
5066	g_5066	FL0024		DPlate 060	E01			AU174897	AU174896			15	J02
5067	g_5067	FE0104	">AF088281_1(AF088281|pid:g4093155) Arabidopsis thaliana   phytochrome-associated protein 1 (PAP1) mRNA, complete   cds; IAA/AXR family member. "	DPlate 058	F01			AU174607	AU174606			15	K02
5068	g_5068	FL0032	">ATAC006569_12(AC006569|pid:g4512702) Arabidopsis thaliana   chromosome II BAC F11A3 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 060	F01			AU174902	AU174903			15	L02
5069	g_5069	FE0120		DPlate 058	G01			AU174614				15	M02
5070	g_5070	FL0040	">AF005370_67(AF005370|pid:g2338034) Alcelaphine herpesvirus 1 L-DNA,   complete sequence; ORF73; similar to H. saimiri and KSHV   ORF73. "	DPlate 060	G01			AU174911				15	N02
5071	g_5071	FE0136	">ATAC005397_24(AC005397|pid:g3702337) Arabidopsis thaliana   chromosome II BAC T3F17 genomic sequence, complete   sequence; unknown protein. "	DPlate 058	H01			AU174627				15	O02
5072	g_5072	FL0064	">F12F1_27(AC002131|pid:g3157951) Arabidopsis thaliana chromosome 1   BAC F12F1 sequence, complete sequence; Contains   similarity to vesicle trafficking protein gb|U91538 from   Mus musculus. ESTs gb|F15494 and gb|F14097 come from   this gene.. "	DPlate 060	H01			AU174928	AU174927			15	P02
5073	g_5073	FE0275	">ATF1N20_20(AL022140|pid:g2961355) Arabidopsis thaliana DNA   chromosome 4, BAC clone F1N20 (ESSAII project); strong   similarity to furostanol glycoside 26-O-beta-glucosidase   F26G, Costus speciosus, PATCHX:S78099. "	DPlate 058	A07			AU174728	AU174727			15	A14
5074	g_5074	FL0171	">ATT5J17_22(AL035708|pid:g4490756) Arabidopsis thaliana DNA   chromosome 4, BAC clone (ESSA project); "	DPlate 060	A07			AU175023	AU175022			15	B14
5075	g_5075	FE0291		DPlate 058	B07			AU181006				15	C14
5076	g_5076	FL0108		DPlate 060	B07			AU174969	AU174968			15	D14
5077	g_5077	FE0204	">AB001887_1(AB001887|pid:g3618318) Oryza sativa cDNA for zinc finger   protein, complete cds, clone:S12569. &JE0115(JE0115) "	DPlate 058	C07			AU174681	AU174680			15	E14
5078	g_5078	FL0124	>(P03730) TAIL ASSEMBLY PROTEIN I. &LAMCG_20(J02459|pid:g215124)   &TJBPIL(A43008;H43013;A04356) 	DPlate 060	C07			AU174984	AU174983			15	F14
5079	g_5079	FE0212	">S71749(S71749;S71748) DCL protein precursor, chloroplast - tomato   &SLU55219_1(U55219|pid:g1305531)   &SLU55278_1(U55278|pid:g1323698) "	DPlate 058	D07			AU174689	AU174688			15	G14
5080	g_5080	FL0148		DPlate 060	D07			AU175004	AU175003			15	H14
5081	g_5081	FE0260	">D82039_1(D82039|pid:g4107009) Oryza sativa mRNA for OSK1, complete   cds. "	DPlate 058	E07			AU174720	AU174721			15	I14
5082	g_5082	FL0156	">ATAC002335_7(AC002335|pid:g2289002) Arabidopsis thaliana chromosome   II BAC T01O24 genomic sequence, complete sequence;   unknown protein. "	DPlate 060	E07			AU175007				15	J14
5083	g_5083	FE0284	">ATT29A15_9(AL035602|pid:g4469011) Arabidopsis thaliana DNA   chromosome 4, BAC clone T29A15 (ESSA project);   similarity to phosphofructokinase, Babesia canis,   AJ223322; Contains pfkB family of carbohydrate kinases   signatures, Pfkb_Kinases_2 [DTCGAGDAYASGIL]; contains   EST gb:AA713017. "	DPlate 058	F07			AU174732	AU174731			15	K14
5084	g_5084	FL0164	">ATAC005311_8(AC005311|pid:g3746073) Arabidopsis thaliana chromosome   II BAC T16B12 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 060	F07			AU175010				15	L14
5085	g_5085	FE0229	>(P30756) HISTONE H2B.2. &S28049(S28049)   &ZMH2B221_1(X57313|pid:g22325) 	DPlate 058	G07			AU174702	AU174701			15	M14
5086	g_5086	FL0172	">ATAC004005_34(AC004005|pid:g3212874) Arabidopsis thaliana   chromosome II BAC F6E13 genomic sequence, complete   sequence; hypothetical protein.   &ATAC004521_1(AC004521|pid:g3128167) "	DPlate 060	G07			AU175025	AU175024			15	N14
5087	g_5087	FE0245		DPlate 058	H07			AU174707	AU174706			15	O14
5088	g_5088	FL0180	">AF120334_1(AF120334|pid:g4191616) Homo sapiens GTP-binding protein   NGB mRNA, complete cds. "	DPlate 060	H07			AU175033	AU175034			15	P14
5089	g_5089	RA0602		DPlate 062	A01			AU162384				16	A02
5090	g_5090	RA1536	">AC003970_12(AC003970|pid:g3482921) Arabidopsis thaliana chromosome   I BAC F14J9 genomic sequence contains phyA marker,   complete sequence; Unknown protein; Location of EST   192N12T7, gb|R90355. "	DPlate 064	A01			D24216	AU173169			16	B02
5091	g_5091	RA0610	">CELC16A3_4(U41534|pid:g1109826) Caenorhabditis elegans cosmid   C16A3; coded for by C. elegans cDNA yk104h12.5; coded   for by C. elegans cDNA yk97f10.5; coded for by C.   elegans cDNA yk62a1.5; coded for by C. elegans cDNA   yk114c12.5; coded for by C. elegans cDNA yk97f10.3;   coded for by C. elegans cDNA yk114c12.3; coded for by C.   elegans cDNA yk104h12.3; coded for by C. elegans cDNA   yk114c12.3; coded for by C. elegans cDNA yk62a1.3;   similar to yeast MAK16 protein (SP:MK16_YEAST,P10962). "	DPlate 062	B01			D23935	AU031698			16	C02
5092	g_5092	RA1552	">AB000113_1(AB000113|pid:g2116552) Rattus norvegicus mRNA for   cationic amino acid transporter 3, complete cds. "	DPlate 064	B01			AU031761	AU031760			16	D02
5093	g_5093	RA0618	">ATF28J12_25(AL021710|pid:g2832664) Arabidopsis thaliana DNA   chromosome 4, BAC clone F28J12 (ESSAII project);   similarity to 18.3K protein precursor, pollen, Zea mays,   PIR2:JQ1107. "	DPlate 062	C01			D23939	AU031699			16	E02
5094	g_5094	RA1513	">ATAC006593_3(AC006593|pid:g4432814) Arabidopsis thaliana chromosome   II BAC F16D14 genomic sequence, complete sequence;   unknown protein. "	DPlate 064	C01			D24195	AU173164			16	F02
5095	g_5095	RA0634	>(P25776) ORYZAIN ALPHA CHAIN PRECURSOR (EC 3.4.22.-).   &KHRZOA(JU0388;A40053) &RICOZA_1(D90406|pid:g218181) 	DPlate 062	D01			D23944	AU101626			16	G02
5096	g_5096	RA1521	">ATAC005312_3(AC005312|pid:g3894159) Arabidopsis thaliana chromosome   II BAC T16F16 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 064	D01			D24202	AU031758			16	H02
5097	g_5097	RA0642	">AB017357_1(AB017357|pid:g3986289) Ipomoea batatas mRNA for   L-Galactono-1,4-lactone dehydrogenase, complete cds. "	DPlate 062	E01			D23947	AU031700			16	I02
5098	g_5098	RA1529	">JC1481(JC1481)pyruvate kinase (EC 2.7.1.40), cytosolic - potato "	DPlate 064	E01			D24210	AU081358			16	J02
5099	g_5099	RA0650	">AF017074_1(AF017074|pid:g3372230) Arabidopsis thaliana RNA   polymerase I, II and III 16.5 kDa subunit (AtRPABC16.5)   mRNA, complete cds. "	DPlate 062	F01			D23953	AU101627			16	K02
5100	g_5100	RA1553		DPlate 064	F01			D24227	AU162417			16	L02
5101	g_5101	RA0666	>(P46466) 26S PROTEASE REGULATORY SUBUNIT 4 HOMOLOG (TAT-BINDING   PROTEIN HOMOLOG 2). &RICHTBP2_1(D17789|pid:g556558) 	DPlate 062	G01			AU176504				16	M02
5102	g_5102	RA1506	">AB010259_1(AB010259|pid:g3149952) Arabidopsis thaliana mRNA for   DRH1, complete cds. "	DPlate 064	G01			D39061	AU031755			16	N02
5103	g_5103	RA0674	>CELF09F7_4(U00050|pid:g485111) Caenorhabditis elegans cosmid F09F7;   similar to enoyl-CoA hydratases; highest similarity to   YKRS_YEAST. 	DPlate 062	H01			D28288				16	O02
5104	g_5104	RA1522	>HVEXTGENE_1(X91659|pid:g1885310) H.vulgare mRNA for endoxyloglucan   transferase; Xyloglucan endotransglycosylase (XET). 	DPlate 064	H01			D24203	AU173166			16	P02
5105	g_5105	RA0737	>IG005I10_15(AF013293|pid:g2252838) Arabidopsis thaliana BAC   IG005I10; 	DPlate 062	A07			AU173103	AU173104			16	A14
5106	g_5106	RA1688	>ATATP19A_1(X98805|pid:g1546692) A.thaliana mRNA for peroxidase   ATP19a; peroxidase ATP19a. 	DPlate 064	A07			D24300	C20488			16	B14
5107	g_5107	RA0769		DPlate 062	B07			D28290	AU162389			16	C14
5108	g_5108	RA1709	">CEF28C6_8(Z68315|pid:g3876355) Caenorhabditis elegans cosmid F28C6,   complete sequence; Similarity to Human polyadenylation   factor chain 77K (PIR Acc. No. S50852); cDNA EST   EMBL:M89205 comes from this gene; cDNA EST EMBL:D27598   comes from this gene; cDNA EST EMBL:D34932 comes from   this gene; cDNA EST EMBL:D32704 comes from this gene;   cDNA EST EMBL:D36733 comes from this gene; cDNA EST   EMBL:D64391 comes from this gene; cDNA EST EMBL:D64740   comes from this gene; cDNA EST EMBL:D67382 comes from   this gene; cDNA EST EMBL:D67864 comes from this gene;   cDNA EST EMBL:C13806 comes from this gene; cDNA EST   yk208e6.5 comes from this gene; cDNA EST yk208h1.5 comes   from this gene; cDNA EST yk218g2.3 comes from this gene;   cDNA EST yk218g2.5 comes from this gene; cDNA EST   yk220f8.5 comes from this gene; cDNA EST yk239b3.5 comes   from this gene; cDNA EST yk265c10.5 comes from this   gene; cDNA EST yk420h8.5 comes from this gene. "	DPlate 064	B07			D24307	AU031783			16	D14
5109	g_5109	RA0793	">AF051204_1(AF051204|pid:g2982243) Picea mariana hypothetical   protein (Sb07) mRNA, complete cds. "	DPlate 062	C07			AU173109	AU173110			16	E14
5110	g_5110	RA1733	>S28185(S28185)phenylalanine ammonia-lyase (EC 4.3.1.5) - rice 	DPlate 064	C07			D24323	AU173212			16	F14
5111	g_5111	RA0738	">ATAC005315_13(AC005315|pid:g3461847) Arabidopsis thaliana   chromosome II BAC T9I4 genomic sequence, complete   sequence; "	DPlate 062	D07			D23991	AU031714			16	G14
5112	g_5112	RA1765	>(Q40635) VACUOLAR ATP SYNTHASE 16 KD PROTEOLIPID SUBUNIT (EC   3.6.1.34). &OSU27098_1(U27098|pid:g857574) 	DPlate 064	D07			D24346	AU173218			16	H14
5113	g_5113	RA0746		DPlate 062	E07			D39020	AU101636			16	I14
5114	g_5114	RA1773	>RSPRXK1_1(X91172|pid:g1518388) R.sativus prxK1 gene. 	DPlate 064	E07			AU173223	AU173224			16	J14
5115	g_5115	RA0786	>CAA005346_1(AJ005346|pid:g3043428) Cicer arietinum mRNA for 40S   ribosomal protein S5. 	DPlate 062	F07			D39026	AU164624			16	K14
5116	g_5116	RA1789	>(Q11102) HYPOTHETICAL 131.5 KD PROTEIN C02F12.7 IN CHROMOSOME X.   &CELC02F12_5(U41545|pid:g1109896) 	DPlate 064	F07			D24363	AU031797			16	L14
5117	g_5117	RA0716	>S55971(S55971) hypothetical protein YLR449w - yeast (Saccharomyces   cerevisiae) &YSCL9324_7(U22382|pid:g717062) 	DPlate 062	G07			AU101633	AU101634			16	M14
5118	g_5118	RA1734		DPlate 064	G07			D24324	AU173213			16	N14
5119	g_5119	RA0732	">RICT151_1(D26060|pid:g483431) Rice mRNA for cyc07, complete cds.   &S42540(S42540) "	DPlate 062	H07			D23988	AU164611			16	O14
5120	g_5120	RA1742	">ATAC004665_12(AC004665|pid:g3386619) Arabidopsis thaliana chromosome   II BAC F4I18 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 064	H07			D24330	AU173214			16	P14
5121	g_5121	RA2008	">ATAC002561_3(AC002561|pid:g2673906) Arabidopsis thaliana chromosome   II BAC T24P15 genomic sequence, complete sequence; "	DPlate 066	A01			D24468	AU173285			17	A02
5122	g_5122	RA2955	">ATT28I19_16(AL035709|pid:g4490733) Arabidopsis thaliana DNA   chromosome 4, BAC clone (ESSA project); similarity to   various predicted proteins; Contains ATP synthase alpha   and beta subunits signature [PALNWAVSNS]; contains EST   gb:T45837. "	DPlate 068	A01			D25028				17	B02
5123	g_5123	RA2024		DPlate 066	B01			D24481	AU173290			17	C02
5124	g_5124	RA2971		DPlate 068	B01			D25042	AU173412			17	D02
5125	g_5125	RA2064	">ATAC004238_6(AC004238|pid:g3033379) Arabidopsis thaliana chromosome   II BAC F19I3 genomic sequence, complete sequence; "	DPlate 066	C01			D24499	AU173299			17	E02
5126	g_5126	RA2979		DPlate 068	C01			D25049				17	F02
5127	g_5127	RA2173		DPlate 066	D01			D24563	AU173324			17	G02
5128	g_5128	RA2995	">MCU79770_1(U79770|pid:g1724110) Mesembryanthemum crystallinum   cinnamyl-alcohol dehydrogenase Eli3 mRNA, complete cds. "	DPlate 068	D01			AU173418	AU173419			17	H02
5129	g_5129	RA2110	>S65181(S65181;S69429) hypothetical protein YPL170w - yeast   (Saccharomyces cerevisiae)   &SCLACHXVI_2(X96770|pid:g1403539)   &SCYPL170W_2(Z73526|pid:g1370359) 	DPlate 066	E01			AU173307	AU173308			17	I02
5130	g_5130	RA2932		DPlate 068	E01			D25008	C20500			17	J02
5131	g_5131	RA2118	">ATF8F16_14(AL021633|pid:g2827528) Arabidopsis thaliana DNA   chromosome 4, BAC clone F8F16 (ESSAII project); "	DPlate 066	F01			D24533	AU031845			17	K02
5132	g_5132	RA2940		DPlate 068	F01			D25015	AU167008			17	L02
5133	g_5133	RA2126	">SBU74319_1(U74319|pid:g1658193) Sorghum bicolor obtusifoliol   14-alpha demethylase CYP51 (CYP51) mRNA, complete cds;   cytochrome P450 catalyzing the 14-alpha demethylation of   obtusifoliol in plants. "	DPlate 066	G01			AU173311	AU173312			17	M02
5134	g_5134	RA3001	">AF111168_3(AF111168|pid:g4186184) Homo sapiens serine palmitoyl   transferase, subunit II gene, complete cds; and unknown   genes; Intron-exon boundaries defined by an EST contig   including AI091300, AA156924, AA413875, AA992304. The   closest similarity in BLASTX is to a C. elegans   hypothetical protein.. "	DPlate 068	G01			D25057	AU070189			17	N02
5135	g_5135	RA2174	">AC004557_24(AC004557|pid:g3935181) Genomic sequence for Arabidopsis   thaliana BAC F17L21, complete sequence; similar to   multiple exostoses type II protein EXT2.I (U72263);   similar to ESTs dbj|D39982, gb|L37635, and dbj|C28418. "	DPlate 066	H01			D24564	AU031854			17	O02
5136	g_5136	RA3009	">D83390_1(D83390|pid:g1513030) Gallus gallus mRNA for   connectin/titin, partial cds. "	DPlate 068	H01			D39194	AU031978			17	P02
5137	g_5137	RA2260		DPlate 066	A07			AU173338	AU173339			17	A14
5138	g_5138	RA3151		DPlate 068	A07			D25099	AU173442			17	B14
5139	g_5139	RA2268	">U89959_6(U89959|pid:g3258569) Arabidopsis thaliana BAC T7I23,   complete sequence; Similar to yeast general negative   regulator of transcription subunit 1; Location of ESTs   gb|T44328 and gb|AA395265~. "	DPlate 066	B07			D24623	AU162428			17	C14
5140	g_5140	RA3167		DPlate 068	B07			AU173448				17	D14
5141	g_5141	RA2213	">TOMTPX2A_1(L13653|pid:g295355) Lycopersicon esculentum peroxidase   (TPX2) mRNA, complete cds. "	DPlate 066	C07			D24583	AU031857			17	E14
5142	g_5142	RA3175		DPlate 068	C07			D25104	AU173451			17	F14
5143	g_5143	RA2253		DPlate 066	D07			D24613	AU090505			17	G14
5144	g_5144	RA3191	>AC002397_16(AC002397|pid:g2289907) Mouse chromosome 6 BAC-284H12   (Research Genetics mouse BAC library) complete sequence;   	DPlate 068	D07			D25109	AU032016			17	H14
5145	g_5145	RA2269	>LELRPGENE_1(X95269|pid:g1619300) L.esculentum LRP gene. 	DPlate 066	E07			D24624	AU081359			17	I14
5146	g_5146	RA3104	>IG005I10_14(AF013293|pid:g2252830) Arabidopsis thaliana BAC   IG005I10; weak similarity to receptor protein kinase;   coded for by A. thaliana cDNA R30513. 	DPlate 068	E07			AU032002	C22606			17	J14
5147	g_5147	RA2277	">AF010283_2(AF010283|pid:g2735841) Sorghum bicolor ADP-glucose   pyrophosphorylase subunit SH2, transcriptional   regulator, NADPH-dependent reductase A1-a and   NADPH-dependent reductase A1-b genes, complete cds;   similar to rice gene X. "	DPlate 066	F07			D24626				17	K14
5148	g_5148	RA3120	">AF014470_1(AF014470|pid:g2429292) Oryza sativa peroxidase (POXgX9)   gene, complete cds; expressed in roots. "	DPlate 068	F07			D25078	C20501			17	L14
5149	g_5149	RA2293	">(Q05913) TRANSCRIPTION INITIATION FACTOR IIF, ALPHA SUBUNIT   (TFIIF-ALPHA) (TRANSCRIPTION FACTOR 5, LARGE CHAIN)   (TF5A). "	DPlate 066	G07			D24639	AU101662			17	M14
5150	g_5150	RA3128	">OSU09450_1(U09450|pid:g780372) Oryza sativa enolase mRNA, complete   cds; 2-phospho-D-glycerate hydrolase. "	DPlate 068	G07			D25085	AU162454			17	N14
5151	g_5151	RA2246		DPlate 066	H07			D24608				17	O14
5152	g_5152	RA3144		DPlate 068	H07			D25096				17	P14
5153	g_5153	RA3650	">T22J18_6(AC003979|pid:g3287679) Arabidopsis thaliana chromosome 1   BAC T22J18 sequence, complete sequence; "	DPlate 070	A01			AU032167	AU032168			18	A02
5154	g_5154	RB0334		DPlate 072	A01			AU070837				18	B02
5155	g_5155	RA3659	>S70029(S70029)probable transmembrane protein TMC - human 	DPlate 070	B01			AU032173	AU032174			18	C02
5156	g_5156	RB0342		DPlate 072	B01			AU173848				18	D02
5157	g_5157	RA3683	">LEU28007_1(U28007|pid:g3668069) Lycopersicon esculentum Pto kinase   interactor 1 (Pti1) mRNA, complete cds; Pti1 kinase. "	DPlate 070	C01			AU162513	AU032199			18	E02
5158	g_5158	RB0358	">AF000940_1(AF000940|pid:g2150002) Hordeum vulgare ribonuclease   gene, complete cds. "	DPlate 072	C01			AU173849				18	F02
5159	g_5159	RA3604	">ATU83178_1(U83178|pid:g4099090) Arabidopsis thaliana unknown gene,   complete cds. "	DPlate 070	D01			AU065408	AU173522			18	G02
5160	g_5160	RB0311	">ATAC002387_11(AC002387|pid:g2583117) Arabidopsis thaliana   chromosome II BAC F4L23 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 072	D01			AU070823	AU162585			18	H02
5161	g_5161	RA3612	">ATPO1_1(X99096|pid:g1429223) A.thaliana mRNA for peroxidase ATP17a,   clone EST 119F5T7; ATP17a.   &ATPRXR4GE_1(X98316|pid:g1402910) "	DPlate 070	E01			AU032130	AU032131			18	I02
5162	g_5162	RB0319		DPlate 072	E01			AU070828				18	J02
5163	g_5163	RA3620		DPlate 070	F01			AU173524	AU173525			18	K02
5164	g_5164	RB0327	">ATAC004697_15(AC004697|pid:g3402684) Arabidopsis thaliana   chromosome II BAC T16B24 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 072	F01			AU070833				18	L02
5165	g_5165	RA3636	>YSCL8543_8(U20618|pid:g2258167) Saccharomyces cerevisiae chromosome   XII cosmid 8543; 	DPlate 070	G01			AU032153	AU032152			18	M02
5166	g_5166	RB0328		DPlate 072	G01			AU070834				18	N02
5167	g_5167	RA3652	">ATAP21_47(Z99707|pid:g4006882) Arabidopsis thaliana DNA chromosome   4, ESSA I AP2 contig fragment No. 1; similarity to   glycoprotein specific UDP-glucuronyltransferase - Rattus   norvegicus, PATchX:D1021387; contains EST gb:AA042349. "	DPlate 070	H01			AU032169	AU032170			18	O02
5168	g_5168	RB0392	>(P46032) PEPTIDE TRANSPORTER PTR2-B (HISTIDINE TRANSPORTING   PROTEIN). &ATAC006532_11(AC006532|pid:g4406786)   &ATHATPT_1(L39082|pid:g633940) 	DPlate 072	H01			AU070869	AU108195			18	P02
5169	g_5169	RA3780		DPlate 070	A07			AU070217	AU173800			18	A14
5170	g_5170	RB0555		DPlate 072	A07			AU081366	AU070974			18	B14
5171	g_5171	RA3796	">AF029351_1(AF029351|pid:g2708532) Nicotiana tabacum putative RNA   binding protein (QRRBP-1) mRNA, partial cds; similar to   S. cerevisiae negative growth regulatory protein encoded   by GenBank Accession Number Z14097. "	DPlate 070	B07			AU173804	AU173805			18	C14
5172	g_5172	RB0595		DPlate 072	B07			AU176527				18	D14
5173	g_5173	RA3833		DPlate 070	C07			AU032273	AU032274			18	E14
5174	g_5174	RB0508		DPlate 072	C07			AU162601				18	F14
5175	g_5175	RA3881	">AC002330_4(AC002330|pid:g3892058) Arabidopsis thaliana BAC T10P11   from chromosome IV, near 15 cM, complete sequence;   similar to rat N-methyl-D-aspartate receptor   glutamate-binding chain, GenBank accession number   S19586; similar to D. melanogaster N-methyl-D-aspartate   receptor-associated protein, GenBank accession number   L37377; functional catalog ID=10.01.05; contains Pfam   signature for uncharacterized protein family UPF0005,   score=107.1. "	DPlate 070	D07			AU070225	AU173812			18	G14
5176	g_5176	RB0540		DPlate 072	D07			AU083503	AU083504			18	H14
5177	g_5177	RA3889	">ATF20M13_26(AL035540|pid:g4467157) Arabidopsis thaliana DNA   chromosome 4, BAC clone F20M13 (ESSA project);   similarity to disease resistance response protein 206-d   - Pisum sativum, PID:g508844. "	DPlate 070	E07			AU032324	AU032325			18	I14
5178	g_5178	RB0588	">ATAC005499_6(AC005499|pid:g3785998) Arabidopsis thaliana chromosome   II BAC T6A23 genomic sequence, complete sequence;   unknown protein. "	DPlate 072	E07			AU070998				18	J14
5179	g_5179	RA3802	">ATM4I22_8(AL030978|pid:g3269288) Arabidopsis thaliana DNA   chromosome 4, P1 clone M4I22 (ESSAII project); strong   similarity to LEDI-3 protein, Lithospermum   erythrorhizon. "	DPlate 070	F07			AU162525	AU032243			18	K14
5180	g_5180	RB0596		DPlate 072	F07			AU071005				18	L14
5181	g_5181	RA3818	">HSA131389_1(AJ131389|pid:g4092648) Homo sapiens mRNA for PEX3   protein, partial. &HSA9866_1(AJ009866|pid:g4218426)   &HSPEX3P_1(AJ001625|pid:g3336882) "	DPlate 070	G07			AU032257				18	M14
5182	g_5182	RB0625	">D84656_2(D84656|pid:g1507666) Yeast DNA for bfr2+ protein/pad1+   protein/sks1+ protein, ORF N313, ORF N150, complete cds,   and for ORF N118, partial cds. "	DPlate 072	G07			AU071027	AU162610			18	N14
5183	g_5183	RA3826	>ATU95973_24(U95973|pid:g2252634) Arabidopsis thaliana BAC T19D16   genomic sequence; hypothetical protein. 	DPlate 070	H07			AU032266	AU032267			18	O14
5184	g_5184	RB0641		DPlate 072	H07			AU173855				18	P14
5185	g_5185	SA0093	">ATAC002388_11(AC002388|pid:g2344896) Arabidopsis thaliana   chromosome II BAC T13E15 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 074	A01			AU055847	AU055848			19	A02
5186	g_5186	SA0955		DPlate 078	A01			AU056887	AU173931			19	B02
5187	g_5187	SA0014	">ATAC003105_6(AC003105|pid:g2760834) Arabidopsis thaliana chromosome   II BAC F18A8 genomic sequence, complete sequence; "	DPlate 074	B01			AU173859	AU075839			19	C02
5188	g_5188	SA0963	>HSRB18A_1(Y13467|pid:g2765322) Homo sapiens mRNA for RB18A protein. 	DPlate 078	B01			AU056897	AU056898			19	D02
5189	g_5189	SA0030	>BJGSHII_1(Y10984|pid:g2243118) B.juncea mRNA for glutathione   synthetase. 	DPlate 074	C01			AU173860	AU055743			19	E02
5190	g_5190	SA0971	">AF021351_1(AF021351|pid:g2460208) Homo sapiens RNA polymerase III   largest subunit (hRPC155) mRNA, complete cds;   DNA-dependent RNA polymerase; similar to beta-prime (b')   subunit of E.coli RNA polymerase. "	DPlate 078	C01			AU173932				19	F02
5191	g_5191	SA0070		DPlate 074	D01			AU173862	AU055811			19	G02
5192	g_5192	SA0979	">ATAC004484_8(AC004484|pid:g3075391) Arabidopsis thaliana chromosome   II BAC T1D16 genomic sequence, complete sequence;   unknown protein. "	DPlate 078	D01			AU056917	AU056918			19	H02
5193	g_5193	SA0078	">AB021747_1(AB021747|pid:g4063829) Oryza sativa FPPS1 gene for   farnesyl diphosphate synthase, complete cds.   &D85317_1(D85317|pid:g2073375) "	DPlate 074	E01			AU078720	AU055821			19	I02
5194	g_5194	SA0908	">AF049236_9(AF049236|pid:g3068711) Arabidopsis thaliana putative   transmembrane protein G1p (AtG1), putative nuclear   DNA-binding protein G2p (AtG2), Em1 protein (ATEM1),   putative chlorophyll synthetase (AtG4), putative   transmembrane protein G5p (AtG5), putative acyl-coA   dehydrogenase (AtG6), and calcium dependent protein   kinase genes, complete cds; and unknown genes; Gp6;   similar to Mus musculus glutaryl-CoA dehydrogenase   precursor encoded by GenBank Accession Number U18992.   &ATU72505_1(U72505|pid:g1657621) "	DPlate 078	E01			AU173929	AU056822			19	J02
5195	g_5195	SA0007		DPlate 074	F01			AU055704	AU055705			19	K02
5196	g_5196	SA0916	>S76126(S76126) hypothetical protein - Synechocystis sp. (strain PCC   6803) &SYCSLRA_87(D63999|pid:g1001478) 	DPlate 078	F01			AU056833	AU056834			19	L02
5197	g_5197	SA0015	>AFABF2_1(Z48431|pid:g1159879) A.fatua mRNA for DNA-binding protein   (clone ABF2). &S61414(S61414) 	DPlate 074	G01			AU055717	AU055718			19	M02
5198	g_5198	SA0932	">D86611_1(D86611|pid:g3868756) Oryza sativa CatC gene for catalase,   complete cds. "	DPlate 078	G01			AU056859	AU173930			19	N02
5199	g_5199	SA0023	">ATAC004218_17(AC004218|pid:g3355480) Arabidopsis thaliana   chromosome II BAC F12L6 genomic sequence, complete   sequence; "	DPlate 074	H01			AU055729	AU055730			19	O02
5200	g_5200	SA0948	>EDBEIF(S04713)immediate-early protein IE180 - suid herpesvirus 1   (strain Indiana-Funkhauser) 	DPlate 078	H01			AU056878	AU056879			19	P02
5201	g_5201	SA0145		DPlate 074	A07			AU055912	AU055913			19	A14
5202	g_5202	SA1110	">SCIV23_7(X97751|pid:g1321952) S.cerevisiae chrIV genes STE7, CLB3,   MSH5, RPC53, RET1; D1545. "	DPlate 078	A07			AU057064	AU057065			19	B14
5203	g_5203	SA0153		DPlate 074	B07			AU055920				19	C14
5204	g_5204	SA1118		DPlate 078	B07			AU057069				19	D14
5205	g_5205	SA0169	>(P49572) INDOLE-3-GLYCEROL PHOSPHATE SYNTHASE PRECURSOR (EC   4.1.1.48) (IGPS). &ATU18770_1(U18770|pid:g619732) 	DPlate 074	C07			AU055942	AU055943			19	E14
5206	g_5206	SA1126		DPlate 078	C07			AU057075				19	F14
5207	g_5207	SA0177	">AC003981_11(AC003981|pid:g3063449) Complete sequence of Arabidopsis   F22O13, complete sequence; similar to L-allo-threonine   aldolase (D87890); similar to ESTs gb|R30517, gb|T42772,   gb|R90493, and gb|R90493. "	DPlate 074	D07			AU055954	AU055955			19	G14
5208	g_5208	SA1142	">AF039709_1(AF039709|pid:g2822483) Maackia amurensis 14-3-3 protein   homolog mRNA, complete cds; similar to brain 14-3-3   protein. "	DPlate 078	D07			AU057093	AU057094			19	H14
5209	g_5209	SA0185	>OSHSC70A_1(X67711|pid:g763160) O.sativa hsp70 gene for heat shock   protein 70. &S53126(S53126) 	DPlate 074	E07			AU055968	AU055969			19	I14
5210	g_5210	SA1150		DPlate 078	E07			AU078264	AU057105			19	J14
5211	g_5211	SA0193	">ATF6H11_15(AL021684|pid:g2827713) Arabidopsis thaliana DNA   chromosome 5, BAC clone F6H11 (ESSAII project);   similarity to nifS protein homolog SPL1, Saccharomyces   cerevisiae, PIR2:S19343; contains EST gb:R65089. "	DPlate 074	F07			AU091715	AU055979			19	K14
5212	g_5212	SA1182	">ATF16A16_16(AL035353|pid:g4218125) Arabidopsis thaliana DNA   chromosome 4, BAC clone F16A16 (ESSAII project);   similarity to glutaredoxin, Oryza sativa, PIR2:JC5445. "	DPlate 078	F07			AU057134				19	L14
5213	g_5213	SA0114	">ATT4L20_19(AL023094|pid:g3096930) Arabidopsis thaliana DNA   chromosome 4, BAC clone T4L20 (ESSAII project);   similaritry to homeotic protein BEL1, Arabidopsis   thaliana, PIR2:A57632; Contains 'Homeobox' domain   signature and profile, Homeobox_1   [LARQTGLSRGQVSNWFINARVRLW]. "	DPlate 074	G07			AU055870	AU055871			19	M14
5214	g_5214	SA1175	">AF071527_7(AF071527|pid:g4206204) Arabidopsis thaliana BAC F9H3,   from chromosome IV near 18.8 cM, complete sequence;   hypothetical protein with some similarity to ankyrin;   functional catalog ID=99. "	DPlate 078	G07			AU057127	AU173942			19	N14
5215	g_5215	SA0138		DPlate 074	H07			AU055902	AU055903			19	O14
5216	g_5216	SA1183		DPlate 078	H07			AU057135				19	P14
5217	g_5217	SA0736	>MTY15292_1(Y15292|pid:g2598573) Medicago truncatula mRNA for MtN26   gene. 	DPlate 077	A01			AU056619	AU056620			20	A02
5218	g_5218	SA1666	">PSU50201_1(U50201|pid:g1236961) Prunus serotina prunasin hydrolase   precursor mRNA, complete cds; located in protein bodies   of Prunus seeds; encode. "	DPlate 080	A01			AU078764				20	B02
5219	g_5219	SA0744		DPlate 077	B01			AU056631	AU056632			20	C02
5220	g_5220	SA1674		DPlate 080	B01			AU082123	AU057677			20	D02
5221	g_5221	SA0760		DPlate 077	C01			AU056651				20	E02
5222	g_5222	SA1643		DPlate 080	C01			AU162764				20	F02
5223	g_5223	SA0768	>(P23799) PUTATIVE ADENYLATE CYCLASE REGULATORY PROTEIN (LEUCINE   REPEAT PROTEIN) (VSG EXPRESSION SITE-ASSOCIATED PROTEIN   F14.9). &A36359(A36359)   &TRBKPLEUM_1(M58701|pid:g343548) 	DPlate 077	D01			AU056662	AU056663			20	G02
5224	g_5224	SA1691		DPlate 080	D01			AU057694	AU057695			20	H02
5225	g_5225	SA0729		DPlate 077	E01			AU075857	AU075858			20	I02
5226	g_5226	SA1604	">ATAC004669_8(AC004669|pid:g3201615) Arabidopsis thaliana chromosome   II BAC F7F1 genomic sequence, complete sequence; unknown   protein. "	DPlate 080	E01			AU057594	AU057595			20	J02
5227	g_5227	SA0761		DPlate 077	F01			AU056652	AU095636			20	K02
5228	g_5228	SA1636		DPlate 080	F01			AU057636	AU057637			20	L02
5229	g_5229	SA0769		DPlate 077	G01			AU056664	AU056665			20	M02
5230	g_5230	SA1684		DPlate 080	G01			AU057688				20	N02
5231	g_5231	SA0706		DPlate 077	H01			AU056580				20	O02
5232	g_5232	SA1613	">ATFCA8_45(Z97343|pid:g2245118) Arabidopsis thaliana DNA chromosome   4, ESSA I contig fragment No. 8; similarity to heat   shock transcription factor HSF21 - soybean (fragment).   &G71445(G71445) "	DPlate 080	H01			AU057609	AU057610			20	P02
5233	g_5233	SA0862	">ATF22I13_13(AL035539|pid:g4539344) Arabidopsis thaliana DNA   chromosome 4, BAC clone F22I13 (ESSA project);   similarity to other predicted proteins Arabidopsis   thaliana; contains EST gb:Z18402. "	DPlate 077	A07			AU056771	AU056772			20	A14
5234	g_5234	SA1780		DPlate 080	A07			AU173970				20	B14
5235	g_5235	SA0870	">ATAC007048_6(AC007048|pid:g4512651) Arabidopsis thaliana chromosome   II BAC F23N11 genomic sequence, complete sequence; "	DPlate 077	B07			AU056779	AU056780			20	C14
5236	g_5236	SA1817		DPlate 080	B07			AU057816				20	D14
5237	g_5237	SA0878	">ATF4B14_21(AL031986|pid:g3805860) Arabidopsis thaliana DNA   chromosome 4, BAC clone F4B14 (ESSAII project);   similarity to glutamic acid-rich protein precursor,   Plasmodium falciparum (GARP), PIR2:A54514.   &ATT19K4_7(AL022373|pid:g3036798) "	DPlate 077	C07			AU056791	AU056792			20	E14
5238	g_5238	SA1825	">AF015310_1(AF015310|pid:g2746079) Brassica napus BTH1 mRNA,   complete cds. "	DPlate 080	C07			AU057828				20	F14
5239	g_5239	SA0823	">ATAC003105_3(AC003105|pid:g2760832) Arabidopsis thaliana chromosome   II BAC F18A8 genomic sequence, complete sequence. "	DPlate 077	D07			AU056719	AU056720			20	G14
5240	g_5240	SA1833		DPlate 080	D07			AU057837				20	H14
5241	g_5241	SA0847	">ATT9A21_8(AL021713|pid:g2832698) Arabidopsis thaliana DNA chromosome   4, BAC clone T9A21 (ESSAII project); similarity to   bacterial and plant glycogen (starch) synthases; for   example B.subtilis, PATCHX:D1020368. "	DPlate 077	E07			AU056752	AU056753			20	I14
5242	g_5242	SA1841	>CAY15781_1(Y15781|pid:g3559814) Capsicum annuum mRNA for plastid   transketolase 1. 	DPlate 080	E07			AU057848				20	J14
5243	g_5243	SA0871		DPlate 077	F07			AU056781				20	K14
5244	g_5244	SA1849		DPlate 080	F07			AU057859				20	L14
5245	g_5245	SA0895		DPlate 077	G07			AU173927				20	M14
5246	g_5246	SA1857		DPlate 080	G07			AU057866				20	N14
5247	g_5247	SA0808	>F17O7_1(AC003671|pid:g3176673) Arabidopsis thaliana chromosome 1   BAC F17O7 complete sequence; Similar to serine/threonine   kinase gb|Y12531 from Brassica oleracea.. 	DPlate 077	H07			AU056701	AU056702			20	O14
5248	g_5248	SA1802	">ATF10N7_21(AL021636|pid:g2827637) Arabidopsis thaliana DNA   chromosome 4, BAC clone (ESSA project); similarity to   EREBP-4 homolog, Arabidopsis thaliana. "	DPlate 080	H07			AU057799	AU101722			20	P14
5249	g_5249	SS2631	">MCU80071_1(U80071|pid:g1773330) Mesembryanthemum crystallinum   glycolate oxidase (GOX) mRNA, complete cds. "	DPlate 082	A01			D47326	AU173994			21	A02
5250	g_5250	SS5007	">AB005149_1(AB005149|pid:g2641973) Exiguobacterium acetylicum gene   for guanosine kinase, complete cds. "	DPlate 084	A01			D48665	AU163049			21	B02
5251	g_5251	SS2655	>HVPSII10K_1(X97771|pid:g1321868) H.vulgare mRNA for PSII 10kD   protein. 	DPlate 082	B01			AU065821	AU174004			21	C02
5252	g_5252	SS5047	">ATT5L19_2(AL049481|pid:g4538992) Arabidopsis thaliana DNA   chromosome 4, BAC clone T5L19 (ESSA project);   similarity to Arabidopsis thaliana chromosome II BAC   T30B22 genomic sequence, gene T30B22.22, PID:g2529679;   contains EST gb:Z33922. "	DPlate 084	B01			D48677	AU090615			21	D02
5253	g_5253	SS2608	>S40268(S40268) peroxidase (EC 1.11.1.7) precursor - Spirodela   polyrrhiza &SPPEROXDS_1(Z22920|pid:g438245) 	DPlate 082	C01			D47312	C20531			21	E02
5254	g_5254	SS5055	">D90902_57(D90902|pid:g1652084) Synechocystis sp. PCC6803 complete   genome, 4/27, 402290-524345; ORF_ID:slr1603.   &S74969(S74969) "	DPlate 084	C01			D48684	AU101809			21	F02
5255	g_5255	SS2632		DPlate 082	D01			D47327	AU173995			21	G02
5256	g_5256	SS5079		DPlate 084	D01			D48700				21	H02
5257	g_5257	SS2640	>AE000735_10(AE000735|pid:g2983755) Aquifex aeolicus section 67 of   109 of the complete genome. &B70416(B70416) 	DPlate 082	E01			AU174001	AU174002			21	I02
5258	g_5258	SS5032	">SNELIPTRC_1(L33793|pid:g498040) Senecio odorus mRNA, complete ORF;   ORF. "	DPlate 084	E01			AU101806	AU101807			21	J02
5259	g_5259	SS2664		DPlate 082	F01			D47347	AU174005			21	K02
5260	g_5260	SS5040	">F12F1_8(AC002131|pid:g3157928) Arabidopsis thaliana chromosome 1   BAC F12F1 sequence, complete sequence; Similar to   fumarylacetoacetate hydrolase, gb|L41670 from Emericella   nidulans.. "	DPlate 084	F01			D48676	AU032830			21	L02
5261	g_5261	SS2672		DPlate 082	G01			D47354	AU032636			21	M02
5262	g_5262	SS5048	>ART223804_1(AJ223804|pid:g4210334) Arabidopsis thaliana mRNA for   2-oxoglutarate dehydrogenase E3 subunit. 	DPlate 084	G01			D48678	AU174068			21	N02
5263	g_5263	SS2680	>(P29375) RETINOBLASTOMA BINDING PROTEIN 2 (RBBP-2). &I78879(I78879)   &S66431_1(S66431|pid:g435778) 	DPlate 082	H01			AU162894	AU162893			21	O02
5264	g_5264	SS5080	">ATAC002388_7(AC002388|pid:g2344892) Arabidopsis thaliana chromosome   II BAC T13E15 genomic sequence, complete sequence;   unknown protein. "	DPlate 084	H01			D48701	AU078156			21	P02
5265	g_5265	SS3255	">AB015724_1(AB015724|pid:g3970880) Rattus norvegicus mRNA for   nuclear receptor binding factor-1, complete cds. "	DPlate 082	A07			D47639	AU174015			21	A14
5266	g_5266	SS5546		DPlate 084	A07			D48953				21	B14
5267	g_5267	SS3208	">AF051894_1(AF051894|pid:g3095111) Homo sapiens 15 kDa selenoprotein   mRNA, complete cds; selenocysteine. "	DPlate 082	B07			D47612	AU162931			21	C14
5268	g_5268	SS5579	>CELF42A6_5(AF038613|pid:g2702429) Caenorhabditis elegans cosmid   F42A6; contains similarity to RNA recognition motifs;   coded for by C. elegans cDNA yk79b4.5; coded for by C.   elegans cDNA cm11f8; coded for by C. elegans cDNA   CEESG59R; coded for by C. elegans cDNA yk75c10.5; coded   for by C. elegans cDNA yk75c10.3; coded for by C.   elegans cDNA CEESU04F; coded for by C. elegans cDNA   CESAA24F; coded for by C. elegans cDNA CEESG59F.   &CELRBP1_1(D10877|pid:g217300) &S35500(S35500) 	DPlate 084	B07			D48978	AU162042			21	D14
5269	g_5269	SS3216		DPlate 082	C07			D47617	AU101767			21	E14
5270	g_5270	SS5595	>AE001130_3(AE001130|pid:g2688094) Borrelia burgdorferi (section 16   of 70) of the complete genome; similar to GB:L10328   SP:P17580 GB:M24503 PID:290500 PID:551840 percent   identity: 38.99; identified by sequence similarity;   putative. &F70124(F70124) 	DPlate 084	C07			D48993	AU101824			21	F14
5271	g_5271	SS3240	">AF053996_1(AF053996|pid:g3894389) Lycopersicon pimpinellifolium   Hcr2-2A (Hcr2-2A) gene, complete cds; similar to   Lycopersicon pimpinellifolium disease resistance protein   Cf-2.2 encoded by the sequence presented in GenBank   Accession Number U42445. "	DPlate 082	D07			AU101769	AU101768			21	G14
5272	g_5272	SS5548		DPlate 084	D07			D48955	AU163111			21	H14
5273	g_5273	SS3288	>(Q40635) VACUOLAR ATP SYNTHASE 16 KD PROTEOLIPID SUBUNIT (EC   3.6.1.34). &OSU27098_1(U27098|pid:g857574) 	DPlate 082	E07			AU174019				21	I14
5274	g_5274	SS5601	">ATAC005170_16(AC005170|pid:g3738325) Arabidopsis thaliana   chromosome II BAC T29E15 genomic sequence, complete   sequence; "	DPlate 084	E07			D48995	AU101825			21	J14
5275	g_5275	SS3809	>(P48417) ALLENE OXIDE SYNTHASE PRECURSOR (EC 4.2.1.92)   (HYDROPEROXIDE DEHYDRASE).   &U00428_1(U00428|pid:g404866) 	DPlate 082	F07			D47977	AU101779			21	K14
5276	g_5276	SS5617		DPlate 084	F07			D49010	AU101826			21	L14
5277	g_5277	SS3833	>(P12145) CHLOROPLAST 30S RIBOSOMAL PROTEIN S2.   &CHOSXX_17(X15901|pid:g11974) &R3RZ2(JQ0216;S05096) 	DPlate 082	G07			AU174024	AU174025			21	M14
5278	g_5278	SS5641		DPlate 084	G07			AU162061				21	N14
5279	g_5279	SS3841		DPlate 082	H07			AU162969	AU032728			21	O14
5280	g_5280	SS5649		DPlate 084	H07			D49031	AU096789			21	P14
5281	g_5281	SS6528	">AF010290_1(AF010290|pid:g2388662) Lolium perenne cinnamyl alcohol   dehydrogenase mRNA, complete cds; CAD. "	DPlate 086	A01			AU163144	AU032926			22	A02
5282	g_5282	ST1105		DPlate 088	A01			D39597	AU161593			22	B02
5283	g_5283	SS6568	">T7A14_14(AC005322|pid:g4056425) Arabidopsis thaliana chromosome 1   BAC T7A14 sequence, complete sequence; ESTs gb|H36249,   gb|AA59732 and gb|AA651219 come from this gene.. "	DPlate 086	B01			D49335	AU101883			22	C02
5284	g_5284	ST1153	">ATU87833_1(U87833|pid:g1872521) Arabidopsis thaliana zinc-finger   protein Lsd1 (LSD1) mRNA, complete cds.   &ATU87834_1(U87834|pid:g1872523) "	DPlate 088	B01			D39629	AU033018			22	D02
5285	g_5285	SS6576	">ATF24G24_7(AL049488|pid:g4538956) Arabidopsis thaliana DNA   chromosome 4, BAC clone F24G24 (ESSA project);   similarity to wound-induced protein, Lycopersicon   esculentum, PIR2:S19773. &T9A4_3(AF096373|pid:g3695408)   "	DPlate 086	C01			D49340	AU161493			22	E02
5286	g_5286	ST1161	">ATAC002387_22(AC002387|pid:g2583128) Arabidopsis thaliana   chromosome II BAC F4L23 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 088	C01			AU076292				22	F02
5287	g_5287	SS6584	">ZEAOE17_1(M87435|pid:g517500) Zea mays precursor of the oxygen   evolving complex 17 kDa protein mRNA, complete cds. "	DPlate 086	D01			AU161496				22	G02
5288	g_5288	ST1169		DPlate 088	D01			AU176546	AU174206			22	H02
5289	g_5289	SS6513	>(P00055) CYTOCHROME C. 	DPlate 086	E01			AU174130				22	I02
5290	g_5290	ST1185	">ATT18B16_12(AL021687|pid:g2828290) Arabidopsis thaliana DNA   chromosome 4, BAC clone T18B16 (ESSAII project);   similarity to ankyrin 3, Mus musculus, PATX:G710550. "	DPlate 088	E01			AU174209	AU174210			22	J02
5291	g_5291	SS6545		DPlate 086	F01			D49322	AU174133			22	K02
5292	g_5292	ST1122		DPlate 088	F01			AU174198				22	L02
5293	g_5293	SS6569		DPlate 086	G01			D49336	AU101884			22	M02
5294	g_5294	ST1138	">BNASTKR_1(M97667|pid:g167181) Brassica napus ssp. oleifera   serine/threonine kinase receptor mRNA, complete cds.   &JQ1677(JQ1677) "	DPlate 088	G01			D39619	AU174202			22	N02
5295	g_5295	SS6515	">ATHPKAME2B_1(D45354|pid:g642132) Arabidopsis thaliana AME2 mRNA for   protein kinase, complete cds. &S71169(S71169) "	DPlate 086	H01			D49304	C22653			22	O02
5296	g_5296	ST1186		DPlate 088	H01			AU077868				22	P02
5297	g_5297	ST0055		DPlate 086	A07			AU032960	AU101891			22	A14
5298	g_5298	ST1744		DPlate 088	A07			D40025	AU174220			22	B14
5299	g_5299	ST0063		DPlate 086	B07			AU032962	AU032963			22	C14
5300	g_5300	ST1752	">ZMU64436_1(U64436|pid:g1498053) Zea mays ribosomal protein S8 mRNA,   complete cds. "	DPlate 088	B07			D40030	AU174222			22	D14
5301	g_5301	ST0071	">ATAC006300_12(AC006300|pid:g4432858) Arabidopsis thaliana   chromosome II BAC F13B15 genomic sequence, complete   sequence; "	DPlate 086	C07			AU181034				22	E14
5302	g_5302	ST1776	">F17O7_18(AC003671|pid:g3176687) Arabidopsis thaliana chromosome 1   BAC F17O7 complete sequence; Strong similarity to   trehalose-6-phosphate synthase homolog from A. thaliana   chromosome 4 contig gb|Z97344. ESTs gb|H37594,   gb|R65023, gb|H37578 and gb|R64855 come from this gene..   "	DPlate 088	C07			D40048	AU101936			22	F14
5303	g_5303	ST0024		DPlate 086	D07			AU174138	AU174137			22	G14
5304	g_5304	ST1792	>NPY09106_1(Y09106|pid:g1666173) N.plumbaginifolia mRNA for   BTF3-like transcription factor; by homology to human   BTF3 transcription factor. 	DPlate 088	D07			D40060	AU033055			22	H14
5305	g_5305	ST0048	">PAU97530_1(U97530|pid:g2688828) Prunus armeniaca   ethylene-forming-enzyme-like dioxygenase mRNA, complete   cds. "	DPlate 086	E07			AU082578	D39366			22	I14
5306	g_5306	ST1713		DPlate 088	E07			D40001				22	J14
5307	g_5307	ST0072	>AE000198_5(AE000198|pid:g1787194) Escherichia coli K-12 MG1655   section 88 of 400 of the complete genome; f720; This 720   aa ORF is 38 pct identical (20 gaps) to 692 residues of   an approx. 720 aa protein YHFK_HAEIN SW: P44289.   &D90733_14(D90733|pid:g4062524)   &D90734_5(D90734|pid:g4062528) &G64836(G64836) 	DPlate 086	F07							22	K14
5308	g_5308	ST1737	">ATT6K22_5(AL031187|pid:g3402751) Arabidopsis thaliana DNA   chromosome 4, BAC clone T6K22 (ESSAII project);   similarity to antifreeze-like protein (af70) - Picea   abies, gb:D86598; Contains Serine proteases, subtilase   family, active sites, Subtilase_His   [HGTQVSSTAAG][HGTMVSSIAAS], Subtilase_Ser   [GTSMATPVIAG][GTSYATPVVAG]. "	DPlate 088	F07			D40019	AU174219			22	L14
5309	g_5309	ST0080	">ATAC004411_21(AC004411|pid:g3522946) Arabidopsis thaliana   chromosome II BAC F14M4 genomic sequence, complete   sequence; "	DPlate 086	G07			AU066048	AU032967			22	M14
5310	g_5310	ST1745	">AC002329_4(AC002329|pid:g2262159) DNA sequence of Arabidopsis   thaliana BAC F5J6 from chromosome IV, complete sequence;   F5J6.4 is similar to S. pombe hypothetical 24.7 kD   protein C5H10.03 (Q09676) and S. cerevisiae hypothetical   33.8 kD protein YKL128c (P36069). "	DPlate 088	G07			D40026	AU161621			22	N14
5311	g_5311	ST0509	">NTRRR12_1(Y10862|pid:g4151068) N.tabacum mRNA for ribonucleotide   reductase, clone R1-2. "	DPlate 086	H07			AU058088	AU161522			22	O14
5312	g_5312	ST1753		DPlate 088	H07			D40031	AU161622			22	P14
5313	g_5313	ST3125		DPlate 090	A01			D40933				23	A02
5314	g_5314	ST5195		DPlate 092	A01			AU175166	AU175167			23	B02
5315	g_5315	ST3149	">ATF28A21_8(AL035526|pid:g4539386) Arabidopsis thaliana DNA   chromosome 4, BAC clone F28A21 (ESSA project); strong   similarity to extensin-like protein - maize,   PIR2:S49915. "	DPlate 090	B01			D40952	AU174289			23	C02
5316	g_5316	ST5148		DPlate 092	B01			C25069	AU102014			23	D02
5317	g_5317	ST3118	">CEM01F1_5(Z46381|pid:g3878571) Caenorhabditis elegans cosmid M01F1,   complete sequence; Weak similarity with the Ysy6 protein   (Yeast) (PIR accession number JQ0912); cDNA EST   EMBL:D32318 comes from this gene; cDNA EST EMBL:D33688   comes from this gene; cDNA EST EMBL:D34664 comes from   this gene; cDNA EST EMBL:D36574 comes from this gene;   cDNA EST EMBL:D67370 comes from this gene; cDNA EST   yk370e8.3 comes from this gene; cDNA EST yk359f4.3 comes   from this gene; cDNA EST yk359f4.5 comes from this gene;   cDNA EST yk321c11.3 comes from this gene; cDNA EST   yk321c11.5 comes from this gene; cDNA EST yk432c2.3 comes   from this gene; cDNA EST yk432c2.5 comes from this gene. "	DPlate 090	C01			D40927	AU101963			23	E02
5318	g_5318	ST5156		DPlate 092	C01			AU066136				23	F02
5319	g_5319	ST3126	">ATAC004683_18(AC004683|pid:g3395439) Arabidopsis thaliana   chromosome II BAC T19C21 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 090	D01			D40934	AU174288			23	G02
5320	g_5320	ST5164	">AF033496_1(AF033496|pid:g2921304) Zea mays herbicide safener   binding protein (SBP1) mRNA, complete cds. "	DPlate 092	D01			C25075				23	H02
5321	g_5321	ST3174	>CELW03D2_10(AF000298|pid:g1947160) Caenorhabditis elegans cosmid   W03D2; weak similarity to collagens; glycine- and   proline-rich. 	DPlate 090	E01			AU174291				23	I02
5322	g_5322	ST5180	">RICGA3_1(D83527|pid:g2058273) Rice (YK426) mRNA, complete cds. "	DPlate 092	E01			AU161725	AU033203			23	J02
5323	g_5323	ST3169		DPlate 090	F01			AU174290				23	K02
5324	g_5324	ST5188	">ATAC004218_27(AC004218|pid:g3355490) Arabidopsis thaliana   chromosome II BAC F12L6 genomic sequence, complete   sequence; "	DPlate 092	F01			C25081	AU174353			23	L02
5325	g_5325	ST3106		DPlate 090	G01			D40915	AU097236			23	M02
5326	g_5326	ST5217		DPlate 092	G01			AU058124				23	N02
5327	g_5327	ST3170		DPlate 090	H01			D40964	AU108361			23	O02
5328	g_5328	ST5225		DPlate 092	H01			C25087	AU102019			23	P02
5329	g_5329	ST3672		DPlate 090	A07			AU181047				23	A14
5330	g_5330	ST5475	>HVEXTGENE_1(X91659|pid:g1885310) H.vulgare mRNA for endoxyloglucan   transferase; Xyloglucan endotransglycosylase (XET). 	DPlate 092	A07			AU066184	AU161784			23	B14
5331	g_5331	ST3680	">ATAC005397_3(AC005397|pid:g3702352) Arabidopsis thaliana chromosome   II BAC T3F17 genomic sequence, complete sequence; "	DPlate 090	B07			AU083577	AU033125			23	C14
5332	g_5332	ST5404	">PEAGTPBP02_1(D12541|pid:g303736) Pea mRNA for GTP-binding protein,   partial cds. "	DPlate 092	B07			AU161770				23	D14
5333	g_5333	ST3801	">BLYBTH7T_1(L36883|pid:g1209251) Hordeum vulgare thionin (BTH7)   gene, complete cds. "	DPlate 090	C07			D41338	AU101981			23	E14
5334	g_5334	ST5452		DPlate 092	C07			C25157				23	F14
5335	g_5335	ST3849	">ATAC004667_9(AC004667|pid:g3668082) Arabidopsis thaliana chromosome   II BAC T4C15 genomic sequence, complete sequence; "	DPlate 090	D07			D41372	AU174299			23	G14
5336	g_5336	ST5460		DPlate 092	D07			AU166257				23	H14
5337	g_5337	ST3881	">ZMU67422_1(U67422|pid:g1597723) Zea mays CRINKLY4 precursor (cr4)   mRNA, complete cds; receptor kinase homolog. "	DPlate 090	E07			D41401	AU174302			23	I14
5338	g_5338	ST5468		DPlate 092	E07			AU033228				23	J14
5339	g_5339	ST3802	>(P41153) HEAT SHOCK FACTOR PROTEIN HSF8 (HEAT SHOCK TRANSCRIPTION   FACTOR 8) (HSTF 8) (HEAT STRESS TRANSCRIPTION FACTOR).   &LPHSF8_1(X67600|pid:g19492) &S25481(S25481) 	DPlate 090	F07			D41339	AU101982			23	K14
5340	g_5340	ST5437		DPlate 092	F07			AU066176				23	L14
5341	g_5341	ST3818		DPlate 090	G07			D41348	AU101983			23	M14
5342	g_5342	ST5469		DPlate 092	G07			AU058133				23	N14
5343	g_5343	ST3826	">ATF10M6_2(AL021811|pid:g2864609) Arabidopsis thaliana DNA   chromosome 4, BAC clone F10M6 (ESSAII project);   similarity to trichohyalin, Homo sapiens, PIR1:A45973.   &ATF8B4_5(AL034567|pid:g4049337) "	DPlate 090	H07			D41354	AU101985			23	O14
5344	g_5344	ST5477		DPlate 092	H07			AU033229				23	P14
5345	g_5345	ST6338	">ATAC006234_24(AC006234|pid:g4454470) Arabidopsis thaliana   chromosome II BAC F5H14 genomic sequence, complete   sequence; "	DPlate 094	A01			AU033288	AU174407			24	A02
5346	g_5346	EE0207	">ATAC006067_6(AC006067|pid:g4263818) Arabidopsis thaliana chromosome   II BAC T13P21 genomic sequence, complete sequence;   unknown protein. "	DPlate 042	A12			AU075695				24	B02
5347	g_5347	ST6386	">ATF20B18_17(AL049483|pid:g4538935) Arabidopsis thaliana DNA   chromosome 4, BAC clone F20B18 (ESSA project); EST   t76182 spans intron in 5' untranslated region; EST   t76182 marks 5' end; contains EST gb:T76182, AA404921. "	DPlate 094	B01			C25432	AU093473			24	C02
5348	g_5348	EE0239	">ATAC002333_21(AC002333|pid:g2281102) Arabidopsis thaliana   chromosome II BAC F18O19 genomic sequence, complete   sequence; "	DPlate 042	B12			AU165842				24	D02
5349	g_5349	ST6307		DPlate 094	C01			C25409				24	E02
5350	g_5350	EE0287		DPlate 042	C12			C74057	AU029388			24	F02
5351	g_5351	ST6371		DPlate 094	D01			AU033290				24	G02
5352	g_5352	EE0240		DPlate 042	D12			C74044	AU029366			24	H02
5353	g_5353	ST6379	>(P49216) 40S RIBOSOMAL PROTEIN S26 (S31).   &RICRPS31_1(D38011|pid:g971284) 	DPlate 094	E01			C25428				24	I02
5354	g_5354	EE0264	">CEC27H6_1(Z81042|pid:g3874561) Caenorhabditis elegans cosmid C27H6,   complete sequence; Weak similarity to C.elegans clathrin   coat assembly protein AP47 (SW:AP47_CAEEL); cDNA EST   EMBL:Z14859 comes from this gene; cDNA EST EMBL:D64772   comes from this gene; cDNA EST EMBL:D34082 comes from   this gene; cDNA EST EMBL:D37105 comes from this gene;   cDNA EST EMBL:D67907 comes from this gene; cDNA EST   EMBL:D67938 comes from this gene; cDNA EST EMBL:C11905   comes from this gene; cDNA EST EMBL:C10286 comes from   this gene. "	DPlate 042	E12			AU173562				24	J02
5355	g_5355	ST6380		DPlate 094	F01			C25429	AU174410			24	K02
5356	g_5356	EE0342	">ATT13J8_21(AL035524|pid:g4455369) Arabidopsis thaliana DNA   chromosome 4, BAC clone T13J8 (ESSAII project); "	DPlate 042	F12			C74077	AU075424			24	L02
5357	g_5357	ST6388	>(P33278) PROTEIN TRANSLATION FACTOR SUI1 HOMOLOG (GOS2 PROTEIN).   &AF094774_1(AF094774|pid:g3789950)   &OSGOS2G_1(X51910|pid:g20238) &S21636(S21636) 	DPlate 094	G01			AU161922	AU161923			24	M02
5358	g_5358	EE0390	>(P50699) THAUMATIN-LIKE PROTEIN PRECURSOR.   &ATHTLP_1(L34693|pid:g536825) &S71175(S71175) 	DPlate 042	G12			AU173565	AU029445			24	N02
5359	g_5359	ST6401		DPlate 094	H01			AU033294	AU174414			24	O02
5360	g_5360	EE0319		DPlate 042	H12			C74070	AU029407			24	P02
5361	g_5361	ST6553	">HVU22450_1(U22450|pid:g944901) Hordeum vulgare alpha-glucosidase   mRNA, complete cds; gibberellin inducible.   &S65057(S65057;S65058) "	DPlate 094	A07			AU066342				24	A14
5362	g_5362	posi09										24	B14
5363	g_5363	ST6593		DPlate 094	B07			AU066348				24	C14
5364	g_5364	posi10										24	D14
5365	g_5365	ST6530	>TM018A10_3(AF013294|pid:g2252864) Arabidopsis thaliana BAC   TM018A10; Similar to receptor kinase. 	DPlate 094	C07			AU033307	C22698			24	E14
5366	g_5366	posi11										24	F14
5367	g_5367	ST6546		DPlate 094	D07			C25484	AU174420			24	G14
5368	g_5368	posi12										24	H14
5369	g_5369	ST6554	">AF077976_1(AF077976|pid:g3341859) Schizophyllum commune putative   ubiquitin carboxyl-terminal hydrolase (uch1) mRNA,   partial cds. "	DPlate 094	E07			AU161975				24	I14
5370	g_5370	posi13										24	J14
5371	g_5371	ST6562	>(P46279) DNA-DIRECTED RNA POLYMERASE II 19 KD POLYPEPTIDE (EC   2.7.7.6) (RNA POLYMERASE II SUBUNIT 5). &B44457(B44457)   &SOYRNAPOLA_1(M90504|pid:g170052) 	DPlate 094	F07			AU066343	AU174424			24	K14
5372	g_5372	posi14										24	L14
5373	g_5373	ST6507	">AF026389_1(AF026389|pid:g2653879) Nicotiana tabacum adenyl cyclase   (Axi 141) mRNA, complete cds. "	DPlate 094	G07			AU066333				24	M14
5374	g_5374	posi15										24	N14
5375	g_5375	ST6547	">AF036382_1(AF036382|pid:g3309543) Fugu rubripes MLL (MLL) gene,   complete cds; similar to human leukemia protein, MLL;   similar to Drosophila trithorax. "	DPlate 094	H07			AU058151				24	O14
5376	g_5376	posi16										24	P14
5377	g_5377	EG0072	>(P34788) 40S RIBOSOMAL PROTEIN S18.   &ATF17A8_15(AL049482|pid:g4538910)   &ATRBPS18A_1(Z23165|pid:g405613)   &ATS18RP1_1(Z28701|pid:g434343)   &ATS18RP2_1(Z28702|pid:g434345)   &ATS18RP3_1(Z28962|pid:g434906)   &ATY12227_7(Y12227|pid:g2505871)   &S37496(S46223;S39263;S39265;S39264;S37496)   &T22J18_5(AC003979|pid:g3287678) 	DPlate 049	A02			AU166156				13	A03
5378	g_5378	EG0833		DPlate 051	A02			AU030267	AU030268			13	B03
5379	g_5379	EG0117	">AF055354_1(AF055354|pid:g3242783) Arabidopsis thaliana respiratory   burst oxidase protein B (RbohB) gene, complete cds;   similar to gp91phox. "	DPlate 049	B02			AU029883	AU166159			13	C03
5380	g_5380	EG0841		DPlate 051	B02			AU030274	AU101480			13	D03
5381	g_5381	EG0149	>(P49020) COP-COATED VESICLE MEMBRANE PROTEIN P24 PRECURSOR   (FRAGMENT). &CGU26264_1(U26264|pid:g924850) 	DPlate 049	C02			AU058205	AU091954			13	E03
5382	g_5382	EG0849		DPlate 051	C02			AU030280	AU030281			13	F03
5383	g_5383	EG0118	">ATU91995_1(U91995|pid:g2149640) Arabidopsis thaliana Argonaute   protein (AGO1) mRNA, complete cds. "	DPlate 049	D02			AU029884	AU101467			13	G03
5384	g_5384	EG0873	>S46210(S46210;S77973) precursor - common tobacco (fragment)   &TOBDDSD_1(L32794|pid:g535771) 	DPlate 051	D02			AU065664	AU030298			13	H03
5385	g_5385	EG0142	">AF088912_1(AF088912|pid:g3608479) Petunia x hybrida ribosomal   protein L15 mRNA, complete cds. "	DPlate 049	E02			AU029893				13	I03
5386	g_5386	EG0810		DPlate 051	E02			AU030243				13	J03
5387	g_5387	EG0150	">AC006389_1(AC006389|pid:g4309884) Homo sapiens BAC clone RG437B22   from 7q31.1-q31.3, complete sequence; similar to   Schizosaccharomyces pombe splicing factor; similar to   PID:3395591; H_RG437B22.1. "	DPlate 049	F02			AU058206	AU101468			13	K03
5388	g_5388	EG0818		DPlate 051	F02			AU095038	AU030253			13	L03
5389	g_5389	EG0158		DPlate 049	G02			AU070141	AU070142			13	M03
5390	g_5390	EG0826		DPlate 051	G02			AU162295	AU030260			13	N03
5391	g_5391	EG0166	">ATFCA6_14(Z97341|pid:g2245005) Arabidopsis thaliana DNA chromosome   4, ESSA I contig fragment No. 6; similarity to   hypothetical protein YEL013w - yeast. &G71431(G71431) "	DPlate 049	H02			AU029899	AU095012			13	O03
5392	g_5392	EG0850		DPlate 051	H02			AU030282	AU030283			13	P03
5393	g_5393	EG0341		DPlate 049	A08			AU091385	AU029959			13	A15
5394	g_5394	EG0952	>ATATN1_1(X92728|pid:g1054633) A.thaliana mRNA for ATN1 protein   kinase. &S61766(S61766) 	DPlate 051	A08			AU172975	AU030363			13	B15
5395	g_5395	EG0334		DPlate 049	B08			AU091384	AU029954			13	C15
5396	g_5396	EG0984		DPlate 051	B08			C74767				13	D15
5397	g_5397	EG0366	">ATU78721_8(U78721|pid:g1707018) Arabidopsis thaliana chromosome II   BAC T1B8 genomic sequence, complete sequence; "	DPlate 049	C08			AU172948	AU172949			13	E15
5398	g_5398	EG0945	">D87547_1(D87547|pid:g1778686) Oryza sativa mRNA for precursor   ferredoxin-NADP+ oxidoreductase, complete cds. "	DPlate 051	C08			AU030358	AU030359			13	F15
5399	g_5399	EG0327	">ATT5J17_3(AL035708|pid:g4490737) Arabidopsis thaliana DNA   chromosome 4, BAC clone (ESSA project); contains EST   gb:R65531, Z35751, Z37494. "	DPlate 049	D08			AU029951	AU091382			13	G15
5400	g_5400	EG0961		DPlate 051	D08			AU065679	AU030366			13	H15
5401	g_5401	EG0367		DPlate 049	E08			AU065593	AU029966			13	I15
5402	g_5402	EG0969	>(P49972) SIGNAL RECOGNITION PARTICLE 54 KD PROTEIN 2 (SRP54).   &LESSRPSPR_1(Z34527|pid:g556902) &S51598(S51598) 	DPlate 051	E08			AU030371	AU101482			13	J15
5403	g_5403	EG0344	>(P34788) 40S RIBOSOMAL PROTEIN S18.   &ATF17A8_15(AL049482|pid:g4538910)   &ATRBPS18A_1(Z23165|pid:g405613)   &ATS18RP1_1(Z28701|pid:g434343)   &ATS18RP2_1(Z28702|pid:g434345)   &ATS18RP3_1(Z28962|pid:g434906)   &ATY12227_7(Y12227|pid:g2505871)   &S37496(S46223;S39263;S39265;S39264;S37496)   &T22J18_5(AC003979|pid:g3287678) 	DPlate 049	F08			AU091387				13	K15
5404	g_5404	EG0922	">HUMORFKG1D_1(D31765|pid:g498156) Human mRNA for KIAA0061 gene,   partial cds. "	DPlate 051	F08			AU172971				13	L15
5405	g_5405	EG0392		DPlate 049	G08			AU058302	AU082543			13	M15
5406	g_5406	EG0938	>HVUDPGPP_1(X91347|pid:g1212996) H.vulgare mRNA for UDP-glucose   pyrophosphorylase. &JC4785(JC4785) 	DPlate 051	G08			AU065678	AU030356			13	N15
5407	g_5407	EG0329	>TM021B04_2(AF007271|pid:g2191191) Arabidopsis thaliana BAC   TM021B04; coded for by A. thaliana cDNA T22079. 	DPlate 049	H08			AU162287	AU029952			13	O15
5408	g_5408	EG0946	">ATAC006234_15(AC006234|pid:g4454461) Arabidopsis thaliana   chromosome II BAC F5H14 genomic sequence, complete   sequence; "	DPlate 051	H08			AU058400	AU101481			13	P15
5409	g_5409	EH0373		DPlate 053	A02			AU173003				14	A03
5410	g_5410	EH1077	">SPCC1281_3(AL035218|pid:g4160579) S.pombe chromosome III cosmid   c1281; SPCC1281.03c, len:193, SIMILARITY:Saccharomyces   cerevisiae, YGY1_YEAST, hypothetical 21.5 kd protein in   sec15-sap4 intergenic region., (190 aa), fasta scores:   opt: 405, E():3.1e-20, (41.1% identity in 180 aa). "	DPlate 055	A02			AU164746	AU031165			14	B03
5411	g_5411	EH0381		DPlate 053	B02			AU030880				14	C03
5412	g_5412	EH1093	>S49915(S49915) extensin-like protein - maize   &ZMEXTENS_1(Z34465|pid:g600118) 	DPlate 055	B02			AU065284	AU101538			14	D03
5413	g_5413	EH0310	">ATAC006300_14(AC006300|pid:g4432860) Arabidopsis thaliana   chromosome II BAC F13B15 genomic sequence, complete   sequence; "	DPlate 053	C02			AU030828	AU165880			14	E03
5414	g_5414	EH1038	">ATAC004077_5(AC004077|pid:g3128213) Arabidopsis thaliana chromosome   II BAC T31E10 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 055	C02			AU077728	AU077729			14	F03
5415	g_5415	EH0318		DPlate 053	D02			AU030834				14	G03
5416	g_5416	EH1046	">ATF24G24_16(AL049488|pid:g4538965) Arabidopsis thaliana DNA   chromosome 4, BAC clone F24G24 (ESSA project); contains   EST gb:AA597424, AA597522, T04526, AA585961. "	DPlate 055	D02			AU077739	AU077740			14	H03
5417	g_5417	EH0326	">MLCB2548_8(AL023093|pid:g3097224) Mycobacterium leprae cosmid   B2548; MLCB2548.08c, folE, probable gtp cyclohydrolase   I, len: 205 aa; similar to many e.g. GCH1_ECOLI P27511   escherichia coli. gtp cyclohydrolase I (221 aa), fasta   scores; opt: 409 z-score: 487.1 E(): 5.2e-20, 38.2%   identity in 207 aaoverlap. Contains PS00860 GTP   cyclohydrolase I signature 2. "	DPlate 053	E02			AU172996	AU030838			14	I03
5418	g_5418	EH1062		DPlate 055	E02			AU101533	AU101534			14	J03
5419	g_5419	EH0334	">ATAC004218_17(AC004218|pid:g3355480) Arabidopsis thaliana   chromosome II BAC F12L6 genomic sequence, complete   sequence; "	DPlate 053	F02			AU098334	AU030842			14	K03
5420	g_5420	EH1078		DPlate 055	F02			AU164747	AU164748			14	L03
5421	g_5421	EH0342		DPlate 053	G02			AU108290	AU030848			14	M03
5422	g_5422	EH1047		DPlate 055	G02			AU173038	AU083007			14	N03
5423	g_5423	EH0358	">AF102823_1(AF102823|pid:g4185513) Arabidopsis thaliana actin   depolymerizing factor 5 (ADF5) mRNA, complete cds.   &AF102825_1(AF102825|pid:g4185517) "	DPlate 053	H02			AU091446	AU030863			14	O03
5424	g_5424	EH1055	>PCMUTSIGN_1(X92351|pid:g1103489) P.coerulescens complete mutant   self-incompatibilty gene; leads to loss of   self-incompatibility phenotype.   &PCS1_1(X81991|pid:g556831) &S49352(S49352) 	DPlate 055	H02			AU101531	AU101532			14	P03
5425	g_5425	EH0486	>ZMY13905_1(Y13905|pid:g2224846) Zea mays mRNA for anionic   peroxidase. 	DPlate 053	A08			AU075805	AU030963			14	A15
5426	g_5426	EH1286	>T3H13_6(AF128396|pid:g4325367) Arabidopsis thaliana BAC T3H13;   contains similarity to Nicotiana tabacum B-type cyclin   (GB:D50737). 	DPlate 055	A08			AU031288	AU031287			14	B15
5427	g_5427	EH0407	">AF029351_1(AF029351|pid:g2708532) Nicotiana tabacum putative RNA   binding protein (QRRBP-1) mRNA, partial cds; similar to   S. cerevisiae negative growth regulatory protein encoded   by GenBank Accession Number Z14097. "	DPlate 053	B08			AU065187				14	C15
5428	g_5428	EH1294		DPlate 055	B08			AU095319	AU095318			14	D15
5429	g_5429	EH0415		DPlate 053	C08			AU165896	AU030901			14	E15
5430	g_5430	EH1207		DPlate 055	C08			AU031247				14	F15
5431	g_5431	EH0463	>OSHSC70A_1(X67711|pid:g763160) O.sativa hsp70 gene for heat shock   protein 70. &S53126(S53126) 	DPlate 053	D08			AU162323	AU030938			14	G15
5432	g_5432	EH1263	">NTU66269_1(U66269|pid:g1762945) Nicotiana tabacum ORF mRNA,   complete cds; ORF; able to induce HR-like lesions. "	DPlate 055	D08			AU162337	AU031272			14	H15
5433	g_5433	EH0471	">(P30792) 2,3-BISPHOSPHOGLYCERATE-INDEPENDENT PHOSPHOGLYCERATE   MUTASE (EC 5.4.2.1) (PHOSPHOGLYCEROMUTASE)   (BPG-INDEPENDENT PGAM). &A42807(A42807;JC2540)   &MZEPPGM_1(M80912|pid:g168588) "	DPlate 053	E08			AU162325	AU030945			14	I15
5434	g_5434	EH1216	>(P31674) 40S RIBOSOMAL PROTEIN S15.   &RIC488S15_1(D10962|pid:g218131) 	DPlate 055	E08			AU031252				14	J15
5435	g_5435	EH0525	">ATAC003673_8(AC003673|pid:g3004551) Arabidopsis thaliana chromosome   II BAC F19F24 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 053	F08			AU173010	AU101496			14	K15
5436	g_5436	EH1240		DPlate 055	F08			AU162335				14	L15
5437	g_5437	EH0533	>JQ0405(JQ0405)hypothetical 119.5K protein (uvrA region) -   Micrococcus luteus 	DPlate 053	G08			AU173011	AU030989			14	M15
5438	g_5438	EH1248		DPlate 055	G08			AU164782				14	N15
5439	g_5439	EH0502		DPlate 053	H08			AU030970	AU095179			14	O15
5440	g_5440	EH1280	">ATAC006439_15(AC006439|pid:g4309734) Arabidopsis thaliana   chromosome II BAC T30D6 genomic sequence, complete   sequence; "	DPlate 055	H08			AU164791	AU031284			14	P15
5441	g_5441	EH1845	">AF056316_1(AF056316|pid:g4128206) Avicennia marina 40S ribosome   protein S7 mRNA, complete cds.   &AF098519_1(AF098519|pid:g3851636) "	DPlate 057	A02			AU173056	AU031557			15	A03
5442	g_5442	FE0379	">AF029856_1(AF029856|pid:g2766448) Sorghum bicolor cytochrome P450   CYP98A1 (CYP98A1) mRNA, complete cds; function unknown;   conserved between monocots and dicots; EST#s identified:   A. thaliana T43253, H36469, and Rice D47937. "	DPlate 059	A02			AU174799	AU174798			15	B03
5443	g_5443	EH1861	>A48892(A48892) abscisic acid-induced protein HVA22 - barley   &BLYA22S_1(L19119|pid:g404589) 	DPlate 057	B02			AU031566	AU031567			15	C03
5444	g_5444	FE0395	>ATDNARPL4_1(Y14566|pid:g2791998) Arabidopsis thaliana rpL4 gene.   &ATRNARPL4_1(Y14565|pid:g2792000) 	DPlate 059	B02			AU174806				15	D03
5445	g_5445	EH1877	>VFPTF1_1(X97907|pid:g2104681) V.faba mRNA for putative transciption   factor (1556bp); putative. 	DPlate 057	C02			AU031574	AU031575			15	E03
5446	g_5446	FE0324	>(P23514) COATOMER BETA SUBUNIT (BETA-COAT PROTEIN) (BETA-COP).   &RNBCOP_1(X57228|pid:g55819) &S13520(S13520) 	DPlate 059	C02			AU174758	AU174757			15	F03
5447	g_5447	EH1814	>S24194(S24194)dopamine receptor D4 - human (fragment) 	DPlate 057	D02			AU031539	AU031540			15	G03
5448	g_5448	FE0340	">ATF4B14_25(AL031986|pid:g3805864) Arabidopsis thaliana DNA   chromosome 4, BAC clone F4B14 (ESSAII project);   similarity to physical impedance induced protein, Zea   mays, gb:AF001635; contains EST gb:AA042347.   &ATT19K4_11(AL022373|pid:g3036802) "	DPlate 059	D02			AU174771				15	H03
5449	g_5449	EH1846		DPlate 057	E02			AU162370				15	I03
5450	g_5450	FE0356		DPlate 059	E02			AU174779				15	J03
5451	g_5451	EH1862		DPlate 057	F02			AU164948				15	K03
5452	g_5452	FE0364		DPlate 059	F02			AU174787	AU174786			15	L03
5453	g_5453	EH1878		DPlate 057	G02			AU031576				15	M03
5454	g_5454	FE0372		DPlate 059	G02			AU174792				15	N03
5455	g_5455	EH1823		DPlate 057	H02			AU031544	AU101581			15	O03
5456	g_5456	FE0388	">CAR6770_1(AJ006770|pid:g3204132) Cicer arietinum mRNA for extensin,   partial. "	DPlate 059	H02			AU174802				15	P03
5457	g_5457	FE0082	>(P08823) RUBISCO SUBUNIT BINDING-PROTEIN ALPHA SUBUNIT PRECURSOR   (60 KD CHAPERONIN ALPHA SUBUNIT) (CPN-60 ALPHA)   (FRAGMENT). &HHWTBA(S02198;A34973)   &TARSBA_1(X07851|pid:g1345582) 	DPlate 057	A08			AU174592	AU174593			15	A15
5458	g_5458	FE0480	">MCU80071_1(U80071|pid:g1773330) Mesembryanthemum crystallinum   glycolate oxidase (GOX) mRNA, complete cds. "	DPlate 059	A08			AU174866	AU174867			15	B15
5459	g_5459	FE0003		DPlate 057	B08			AU174543	AU174542			15	C15
5460	g_5460	FE0496	">ATU38916_1(U38916|pid:g1145627) Arabidopsis thaliana lipase mRNA,   complete cds. &S68410(S68410) "	DPlate 059	B08			AU174877	AU174876			15	D15
5461	g_5461	FE0019		DPlate 057	C08			AU174557				15	E15
5462	g_5462	FL0001	">AF030385_1(AF030385|pid:g2642213) Zea mays nitrate-induced NOI   protein gene, complete cds.   &AF045033_1(AF045033|pid:g2895781) "	DPlate 059	C08			AU174879	AU174878			15	F15
5463	g_5463	FE0051	>ATAAP6_1(X95736|pid:g1769887) A.thaliana mRNA for amino acid   permease 6. 	DPlate 057	D08			AU174570	AU174569			15	G15
5464	g_5464	FL0049	>(Q03251) GLYCINE-RICH RNA-BINDING PROTEIN 8 (CCR1 PROTEIN).   &ATGRP8_1(Z14988|pid:g16305)   &ATHCCRB_1(L04171|pid:g166658)   &ATHRBPB_1(L00649|pid:g166839) &S30148(S30148;S28636) 	DPlate 059	D08			AU174917	AU174916			15	H15
5465	g_5465	FE0067	>DMC171E4_1(AL021726|pid:g2832850) Drosophila melanogaster cosmid   171E4. 	DPlate 057	E08			AU174581	AU174582			15	I15
5466	g_5466	FL0057	">CEF21D5_3(Z54271|pid:g3876104) Caenorhabditis elegans cosmid F21D5,   complete sequence; Homology with the putative 36.1 yeast   protein YHB3_YEAST; cDNA EST CEMSG62F comes from this   gene. "	DPlate 059	E08			AU174923	AU174924			15	J15
5467	g_5467	FE0091	">AB015601_1(AB015601|pid:g4008159) Salix gilgiana SGJ3 mRNA for DnaJ   homolog, complete cds. "	DPlate 057	F08			AU174600	AU174599			15	K15
5468	g_5468	FL0065		DPlate 059	F08			AU174930	AU174929			15	L15
5469	g_5469	FE0004	">ATF22I13_2(AL035539|pid:g4539333) Arabidopsis thaliana DNA   chromosome 4, BAC clone F22I13 (ESSA project);   similarity to amino acid transport protein - Arabidopsis   thaliana, PID:g2576363; contains EST gb:T43079, T20761,   T41914, Aa586275, T43892. "	DPlate 057	G08			AU174545	AU174544			15	M15
5470	g_5470	FL0073	">ATAC004684_10(AC004684|pid:g3236242) Arabidopsis thaliana   chromosome II BAC F13M22 genomic sequence, complete   sequence; "	DPlate 059	G08			AU174941	AU174940			15	N15
5471	g_5471	FE0012		DPlate 057	H08			AU174551	AU174550			15	O15
5472	g_5472	FL0081	">ATH010462_1(AJ010462|pid:g3775997) Arabidopsis thaliana mRNA for   DEAD box RNA helicase, RH10. "	DPlate 059	H08			AU174950	AU174949			15	P15
5473	g_5473	RA0268		DPlate 061	A02			AU176501				16	A03
5474	g_5474	RA1044	>RSLAACT_1(X78116|pid:g1542941) R.sativus L. (Saxa knacker) AACT   mRNA. 	DPlate 063	A02			D24066	AU162398			16	B03
5475	g_5475	RA0213		DPlate 061	B02			AU164519				16	C03
5476	g_5476	RA1076	>BVRNAEF2_1(Z97178|pid:g2369714) Beta vulgaris cDNA for elongation   factor 2. 	DPlate 063	B02			AU181009				16	D03
5477	g_5477	RA0229	">AC002330_14(AC002330|pid:g3892050) Arabidopsis thaliana BAC T10P11   from chromosome IV, near 15 cM, complete sequence;   similar to A. thaliana putative protein F6I18.110,   GenBank accession number 2980768; functional catalog   ID=99. "	DPlate 061	C02			D23811	AU095418			16	E03
5478	g_5478	RA1092	">ATFCA8_35(Z97343|pid:g2245108) Arabidopsis thaliana DNA chromosome   4, ESSA I contig fragment No. 8; similarity to EREBP-4   (Ethylene-inducible DNA binding proteins that interact   with anethylene-responsive element) - Nicotiana tabacum.   &E71444(E71444) "	DPlate 063	C02			AU173129				16	F03
5479	g_5479	RA0269	>ATGTRNAS_1(AJ002062|pid:g2564215) Arabidopsis thaliana mRNA for   glycyl-tRNA synthetase. 	DPlate 061	D02			AU173071				16	G03
5480	g_5480	RA1013		DPlate 063	D02			D24050	AU162392			16	H03
5481	g_5481	RA0277	>(P50888) 60S RIBOSOMAL PROTEIN L24.   &HVRL24E_1(X94296|pid:g1154859) 	DPlate 061	E02			AU031656	AU031657			16	I03
5482	g_5482	RA1029	">D38170_1(D38170|pid:g1215812) Rice mRNA for probenazole-inducible   protein PBZ1, complete cds; Induced by the treatment of   probenazole or the inoculation of rice blast fungus..   &D82066_1(D82066|pid:g2780343) "	DPlate 063	E02			AU162395				16	J03
5483	g_5483	RA0293	">ATU88711_1(U88711|pid:g3168840) Arabidopsis thaliana copper   homeostasis factor (CCH) mRNA, complete cds; similar to   yeast ATX1; copper chaperone. "	DPlate 061	F02			D38996	AU164533			16	K03
5484	g_5484	RA1054		DPlate 063	F02			AU173122				16	L03
5485	g_5485	RA0278	">CEC17E4_5(Z81037|pid:g3874370) Caenorhabditis elegans cosmid C17E4,   complete sequence; Similarity to Bovine Poly-A binding   protein II (TR:G1051125); cDNA EST EMBL:T01617 comes   from this gene; cDNA EST EMBL:T02048 comes from this   gene; cDNA EST EMBL:D73029 comes from this gene; cDNA   EST EMBL:D73224 comes from this gene; cDNA EST   EMBL:D76003 comes from this gene; cDNA EST EMBL:D76232   comes from this gene; cDNA EST EMBL:C13138 comes from   this gene; cDNA EST EMBL:C13886 comes from this gene;   cDNA EST EMBL:C11623 comes from this gene; cDNA EST   yk504d8.3 comes from this gene; cDNA EST yk470h4.3 comes   from this gene; cDNA EST yk470h4.5 comes from this gene;   cDNA EST yk425e10.3 comes from this gene; cDNA EST   yk425e10.5 comes from this gene; cDNA EST yk425d11.3   comes from this gene; cDNA EST yk425d11.5 comes from   this gene; cDNA EST yk394f2.3 comes from this gene; cDNA   EST yk394f2.5 comes from this gene; cDNA EST yk339b4.3   comes from this gene; cDNA EST yk339b4.5 comes from this   gene; cDNA EST yk327c1.3 comes from this gene; cDNA EST   yk327c1.5 comes from this gene; cDNA EST yk228d8.3 comes   from this gene; cDNA EST yk228d8.5 comes from this gene;   cDNA EST yk197b9.5 comes from this gene; cDNA EST   yk312h6.5 comes from this gene; cDNA EST yk339g9.5 comes   from this gene; cDNA EST yk400a9.5 comes from this gene;   cDNA EST yk418h3.5 comes from this gene; cDNA EST   yk447e7.5 comes from this gene; cDNA EST yk492d4.5 comes   from this gene. "	DPlate 061	G02			D23829	AU031658			16	M03
5486	g_5486	RA1039		DPlate 063	G02			AU173121				16	N03
5487	g_5487	RA0286	">AC002329_18(AC002329|pid:g2262173) DNA sequence of Arabidopsis   thaliana BAC F5J6 from chromosome IV, complete sequence;   signature for active site of class II pyridine   nucleotide-disulphide oxidoreductases located from   residues 197 to 219 [CAVCD...IGGGD]. "	DPlate 061	H02			D23831	AU164531			16	O03
5488	g_5488	RA1055	>OSRAPB_1(Y10905|pid:g2826786) Oryza sativa mRNA RAPB protein. 	DPlate 063	H02			D24071	AU173123			16	P03
5489	g_5489	RA0438	>(P02350) 40S RIBOSOMAL PROTEIN S3A (S1A). &R3XL3A(S15665)   &XLRPS1A_1(X57322|pid:g65091) 	DPlate 061	A08			AU164546	AU164547			16	A15
5490	g_5490	RA1356	>(P23902) 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE I PRECURSOR (EC   2.3.1.41) (BETA-KETOACYL-ACP SYNTHASE I) (KAS I).   &A39356(A39356;A45129) &BLYKASI_1(M60410|pid:g167065) 	DPlate 063	A08			D39052	AU101651			16	B15
5491	g_5491	RA0446	>(P20026) MYB-RELATED PROTEIN HV1. &HVMYB1G_1(X70879|pid:g19053)   &HVMYB1_1(X70877|pid:g19051)   &S61506(S61506;S04896;S31817) 	DPlate 061	B08			AU173093				16	C15
5492	g_5492	RA1449		DPlate 063	B08			D24162				16	D15
5493	g_5493	RA0462	>(P04825) AMINOPEPTIDASE N (EC 3.4.11.2) (ALPHA-AMINOACYLPEPTIDE   HYDROLASE). 	DPlate 061	C08			AU173095	AU173096			16	E15
5494	g_5494	RA1473		DPlate 063	C08			AU181011				16	F15
5495	g_5495	RA0470	">AF041456_1(AF041456|pid:g2981015) Physarum polycephalum tectonin II   (tecB) mRNA, complete cds; similar to Limulus lectin   L-6. "	DPlate 061	D08			D28285	AU031676			16	G15
5496	g_5496	RA1481		DPlate 063	D08			AU173157	AU173158			16	H15
5497	g_5497	RA0478	">AB004568_1(AB004568|pid:g2285792) Arabidopsis thaliana mRNA for   cyanase, complete cds; cyanate lyase.   &AB015748_1(AB015748|pid:g3287503) "	DPlate 061	E08			D23873	AU162382			16	I15
5498	g_5498	RA1418		DPlate 063	E08			D24139				16	J15
5499	g_5499	RA0494	">AF077372_1(AF077372|pid:g4336205) Zea mays cytochrome b5 reductase   (NFR) mRNA, complete cds. "	DPlate 061	F08			D23879	AU031680			16	K15
5500	g_5500	RA1458	">AC004044_13(AC004044|pid:g4263519) Arabidopsis thaliana BAC T5J8   from chromosome IV, top arm, complete sequence;   functional catalog ID=04.05.03. "	DPlate 063	F08			AU173150	AU173151			16	L15
5501	g_5501	RA0415		DPlate 061	G08			AU102206				16	M15
5502	g_5502	RA1466	>IG005I10_12(AF013293|pid:g2252840) Arabidopsis thaliana BAC   IG005I10; contains regions of similarity to Haemophilus   influenzae permease (SP:P38767); coded for by A.   thaliana cDNA H76622. 	DPlate 063	G08			D24172	AU031750			16	N15
5503	g_5503	RA0487		DPlate 061	H08			AU173097	AU101612			16	O15
5504	g_5504	RA1490		DPlate 063	H08			AU173160	AU173161			16	P15
5505	g_5505	RA1844	">CAC49C10_7(AL033497|pid:g3859696) C.albicans cosmid Ca49C10;   Ca49C10.07c, unknown, len: 421 aa, low similarity to eg   Q48742 isopenicillin n epimerase (419 aa), fasta scores,   opt: 305, E(): 5.2e-06, (22.3% identity in 417 aa   overlap). "	DPlate 065	A02			AU173240	AU173241			17	A03
5506	g_5506	RA2413	">F5F19_21(AC006216|pid:g4220462) Arabidopsis thaliana chromosome 1 BAC   F5F19 sequence, complete sequence; Strong similarity to   gb|Z50851 HD-zip (athb-8) gene from Arabidopsis thaliana   containing Homeobox PF|00046 and bZIP PF|00170 domains.. "	DPlate 067	A02			D24708	AU173356			17	B03
5507	g_5507	RA1860	">AC000348_3(AC000348|pid:g2213583) Genomic sequence for Arabidopsis   thaliana BAC T7N9, complete sequence; unknown; similar   to ESTs gb|R87028, gb|W43320, gb|AA395193, and   gb|T75928. "	DPlate 065	B02			D24416	AU173245			17	C03
5508	g_5508	RA2461		DPlate 067	B02			AU181015				17	D03
5509	g_5509	RA1868	">ATT29A15_12(AL035602|pid:g4469014) Arabidopsis thaliana DNA   chromosome 4, BAC clone T29A15 (ESSA project);   similarity to predicted protein, Caenorhabditis elegans,   AL033514; Contains Protein kinases signatures and   profile, Protein_Kinase_Atp   [VGSGSSSNVVLFLSEIMGMYFLSSILLIRK]. "	DPlate 065	C02			D24420	AU031810			17	E03
5510	g_5510	RA2469	">AF061582_1(AF061582|pid:g3660678) Oryctolagus cuniculus   heterogeneous nuclear ribonucleoprotein C (hnRNPC) mRNA,   complete cds. "	DPlate 067	C02			AU173374	AU173375			17	F03
5511	g_5511	RA1877	>PSIEP110_1(Z68506|pid:g1495768) P.sativum mRNA for 110 kD chloroplast   inner envelope protein IEP110; precursor.   &S71750(S71750;S78406;JC6116;PC6035) 	DPlate 065	D02			D24428	AU101656			17	G03
5512	g_5512	RA2477	>RCUNKN_1(Z81012|pid:g1621268) R.communis mRNA for unknown protein. 	DPlate 067	D02			D24743	AU173379			17	H03
5513	g_5513	RA1806	>(Q40078) VACUOLAR ATP SYNTHASE SUBUNIT B ISOFORM 1 (EC 3.6.1.34)   (V-ATPASE B SUBUNIT). &BLYVATP57A_1(L11862|pid:g167108)   	DPlate 065	E02			D24374	AU173232			17	I03
5514	g_5514	RA2406	>CPA005373_1(AJ005373|pid:g3046731) Craterostigma plantagineum mRNA   for protein kinase. 	DPlate 067	E02			D24703	AU162434			17	J03
5515	g_5515	RA1830	">PTU09556_1(U09556|pid:g607774) Pinus taeda clone p14A9   arabinogalactan-like protein mRNA, complete cds.   &S52995(S52995) "	DPlate 065	F02			D24393	AU173238			17	K03
5516	g_5516	RA2414	>(Q09221) HYPOTHETICAL 200.6 KD PROTEIN B0228.2 IN CHROMOSOME II.   &CELB0228_3(U23168|pid:g726363) 	DPlate 067	F02			D24709	AU101665			17	L03
5517	g_5517	RA1838	>(Q10005) HYPOTHETICAL 39.9 KD PROTEIN T15H9.1 IN CHROMOSOME II   PRECURSOR. &CET15H9_6(Z47356|pid:g3879803) 	DPlate 065	G02			D24399	AU031803			17	M03
5518	g_5518	RA2422	">ATFCA9_5(Z97344|pid:g2245131) Arabidopsis thaliana DNA chromosome   4, ESSA I contig fragment No. 9; similarity to coatomer   zeta chain - bovine. &C71447(C71447) "	DPlate 067	G02			AU173358	AU173359			17	N03
5519	g_5519	RA1846	">ATU38916_1(U38916|pid:g1145627) Arabidopsis thaliana lipase mRNA,   complete cds. &S68410(S68410) "	DPlate 065	H02			D39078	AU173242			17	O03
5520	g_5520	RA2430	>(P36011) CELL PATTERN FORMATION-ASSOCIATED PROTEIN.   &A44068(A44068;S27413) &EMESTUA_1(M83569|pid:g168096) 	DPlate 067	H02			D24717	AU173363			17	P03
5521	g_5521	RA1978		DPlate 065	A08			D39108	AU173274			17	A15
5522	g_5522	RA2715	>(P49637) 60S RIBOSOMAL PROTEIN L27A.   &AT60SRL27_1(X91959|pid:g1107487) &S71256(S71256) 	DPlate 067	A08			AU173389				17	B15
5523	g_5523	RA1986	>S44027(S44027;S50882)thioredoxin reductase (NADPH) (EC 1.6.4.5) B -   Arabidopsis thaliana 	DPlate 065	B08			D39112	AU031830			17	C15
5524	g_5524	RA2739	>(Q00445) CHLOROPLAST SMALL HEAT SHOCK PROTEIN PRECURSOR (HEAT SHOCK   PROTEIN 26.6). &S16578(S16578)   &TAHSP26_1(X58280|pid:g21809) 	DPlate 067	B08			AU173390	AU162444			17	D15
5525	g_5525	RA1994	">AF024648_1(AF024648|pid:g2465923) Arabidopsis thaliana   receptor-like serine/threonine kinase (RKF1) mRNA,   complete cds. "	DPlate 065	C08			AU173281				17	E15
5526	g_5526	RA2747	>CMPMEL2_1(Z70521|pid:g1843440) C.melo mRNA (clone pMel2). 	DPlate 067	C08			D24906	AU097584			17	F15
5527	g_5527	RA1955		DPlate 065	D08			D24460	AU173266			17	G15
5528	g_5528	RA2779		DPlate 067	D08			D24916				17	H15
5529	g_5529	RA1995		DPlate 065	E08			AU173282	AU173283			17	I15
5530	g_5530	RA2795	">ATAC005396_7(AC005396|pid:g3650033) Arabidopsis thaliana chromosome   II BAC T26I20 genomic sequence, complete sequence;   unknown protein. "	DPlate 067	E08			D24926	AU173400			17	J15
5531	g_5531	RA1924	">AB009307_1(AB009307|pid:g2662310) Hordeum vulgare mRNA for bpw1,   complete cds. "	DPlate 065	F08			D39094	AU173259			17	K15
5532	g_5532	RA2724		DPlate 067	F08			D24893	AU031938			17	L15
5533	g_5533	RA1940	">ATAC006232_4(AC006232|pid:g4314378) Arabidopsis thaliana chromosome   II BAC F10A12 genomic sequence, complete sequence; "	DPlate 065	G08			D24448	AU173265			17	M15
5534	g_5534	RA2925	">HUMAUANTIG_1(L05425|pid:g179285) Homo sapiens autoantigen mRNA,   complete cds. "	DPlate 067	G08			AU173404				17	N15
5535	g_5535	RA1956	">ATAC004561_22(AC004561|pid:g3980396) Arabidopsis thaliana   chromosome II BAC F16P2 genomic sequence, complete   sequence; "	DPlate 065	H08			D39098	AU173267			17	O15
5536	g_5536	RA2933		DPlate 067	H08			D25009	AU173406			17	P15
5537	g_5537	RA3302	">(P46225) TRIOSEPHOSPHATE ISOMERASE, CHLOROPLAST PRECURSOR (EC   5.3.1.1) (TIM). &S53761(S53761;S53762;S52238)   &SCTRIISO_1(Z32521|pid:g609262) "	DPlate 069	A02			D25139	AU173478			18	A03
5538	g_5538	RA3946	>OSGT2_1(X68261|pid:g20249) O.sativa gt-2 gene. &S28030(S28030) 	DPlate 071	A02			AU173821				18	B03
5539	g_5539	RA3310	">ATF7L13_8(AL049524|pid:g4539410) Arabidopsis thaliana DNA   chromosome 4, BAC clone F7L13 (ESSA project); strong   similarity to SRG1 protein - Arabidopsis thaliana,   PIR2:S44261. &F3H7_14(AF118222|pid:g4115914) "	DPlate 069	B02			AU173483				18	C03
5540	g_5540	RA3954	">ATAC004697_17(AC004697|pid:g3402685) Arabidopsis thaliana   chromosome II BAC T16B24 genomic sequence, complete   sequence; unknown protein. "	DPlate 071	B02			AU032367	AU173824			18	D03
5541	g_5541	RA3342	">D88193_1(D88193|pid:g2251114) Brassica rapa DNA for S-receptor   kinase, complete cds. "	DPlate 069	C02			D39328	C22611			18	E03
5542	g_5542	RA3970	">ATF25I24_16(AL049525|pid:g4539369) Arabidopsis thaliana DNA   chromosome 4, BAC clone F25I24 (ESSA project);   similarity to proline-rich protein, Brassica napus,   PIR2:S16748. "	DPlate 071	C02			AU032381	AU032382			18	F03
5543	g_5543	RA3358		DPlate 069	D02			AU175136				18	G03
5544	g_5544	RA3978	">AB008845_1(AB008845|pid:g4008156) Oryza sativa mRNA for NADH   dependent Glutamate Synthase, complete cds. "	DPlate 071	D02			AU032384	AU032385			18	H03
5545	g_5545	RA3366	">(P20360) ACTIN, CYTOPLASMIC. &A30309(A30309)   &EUPACT_1(J04533|pid:g290683) "	DPlate 069	E02			D39338				18	I03
5546	g_5546	RA3986		DPlate 071	E02			AU032395				18	J03
5547	g_5547	RA3374	">CREWP6A_1(L29028|pid:g530878) Chlamydomonas eugametos WP6 mRNA,   complete cds; amino acid feature: N-glycosylation sites,   aa 41 .. 43, 46 .. 48, 51 .. 53, 72 .. 74, 107 .. 109,   128 .. 130, 132 .. 134, 158 .. 160, 163 .. 165; amino   acid feature: Rod protein domain, aa 169 .. 340; amino   acid feature: globular protein domain, aa 32 .. 168.   &S50754(S50754) "	DPlate 069	F02			D39342	AU173500			18	K03
5548	g_5548	RA3931		DPlate 071	F02			AU032355	AU032356			18	L03
5549	g_5549	RA3303	">ATAC002334_4(AC002334|pid:g2924772) Arabidopsis thaliana chromosome   II BAC F25I18 genomic sequence, complete sequence;   unknown protein. "	DPlate 069	G02			D39305	AU173479			18	M03
5550	g_5550	RA3947	">ATAC006592_11(AC006592|pid:g4544445) Arabidopsis thaliana   chromosome II BAC F14M13 genomic sequence, complete   sequence; "	DPlate 071	G02			AU173822	AU173823			18	N03
5551	g_5551	RA3327	">ATU62742_1(U62742|pid:g1732511) Arabidopsis thaliana Ran binding   protein 1 homolog (RanBP1) mRNA, complete cds; similar   to human Ran binding protein 1. "	DPlate 069	H02			D39320	AU173488			18	O03
5552	g_5552	RA3955	">ATFCA0_24(Z97335|pid:g2244771) Arabidopsis thaliana DNA chromosome 4,   ESSA I contig fragment No. 0; similarity to X.laevis mRNA   for KLP2 (kinesin-like protein required for centrosome   separation during mitosis). &H71402(H71402) "	DPlate 071	H02			AU032368	AU032369			18	P03
5553	g_5553	RA3404	>AT81KBGEN_3(X98130|pid:g1402877) A.thaliana 81kb genomic sequence.    &ATORF03_1(X97485|pid:g1495257) 	DPlate 069	A08			AU176525				18	A15
5554	g_5554	RB0103	">ATAC005700_18(AC005700|pid:g3831466) Arabidopsis thaliana   chromosome II BAC T32F6 genomic sequence, complete   sequence; &ATU76298_1(U76298|pid:g3399767) "	DPlate 071	A08			AU173836				18	B15
5555	g_5555	RA3420	>(Q10190) HYPOTHETICAL GTP-BINDING PROTEIN C3F10.16C IN CHROMOSOME   I. &SPAC3F10_16(Z69369|pid:g1182063) 	DPlate 069	B08			AU032063	AU095509			18	C15
5556	g_5556	RB0127	">ATAC005936_1(AC005936|pid:g4038030) Arabidopsis thaliana chromosome   II BAC F5O4 genomic sequence, complete sequence. "	DPlate 071	B08			AU070705	AU101689			18	D15
5557	g_5557	RA3436	>(P29314) 40S RIBOSOMAL PROTEIN S9. 	DPlate 069	C08			AU065352	AU162471			18	E15
5558	g_5558	RB0135	">RICRCC3_1(L27208|pid:g786132) Oryza sativa root-specific RCc3 mRNA,   complete cds. &S53012(S53012) "	DPlate 071	C08			AU081582	AU081583			18	F15
5559	g_5559	RA3452	">DOG01_1(D43756|pid:g1304047) Dog gene for fibrinogen A-alpha-chain,   partial cds (C-terminal region); carboxy-terminal   region. "	DPlate 069	D08			AU065355	AU173508			18	G15
5560	g_5560	RB0143	">FXU63534_1(U63534|pid:g4097522) Fragaria x ananassa cinnamyl   alcohol dehydrogenase (CAD) mRNA, complete cds; involved   with lignin biosynthesis. "	DPlate 071	D08			AU077741	AU077742			18	H15
5561	g_5561	RA3468	">OSU65957_1(U65957|pid:g1519251) Oryza sativa GF14-c protein mRNA,   complete cds; rice 14-3-3 protein homolog; osGF14c. "	DPlate 069	E08			AU065362	AU167011			18	I15
5562	g_5562	RB0120		DPlate 071	E08			AU070701	AU173842			18	J15
5563	g_5563	RA3413		DPlate 069	F08			AU065345	AU075832			18	K15
5564	g_5564	RB0184	">GMU64916_1(U64916|pid:g4097571) Glycine max farnesylated protein   GMFP5 mRNA, partial cds; geranylgeranylated protein. "	DPlate 071	F08			AU162574				18	L15
5565	g_5565	RA3421	">OSU28047_1(U28047|pid:g1143864) Oryza sativa beta-glucosidase mRNA,   nuclear gene encoding chloroplast protein, complete cds;   beta-D-glucoside glucohydrolase; dimer of 60 kDa   monomers; localized in the plastid. "	DPlate 069	G08			AU032064	AU095510			18	M15
5566	g_5566	RB0113		DPlate 071	G08			AU078360				18	N15
5567	g_5567	RA3429	">ATAC002388_13(AC002388|pid:g2344898) Arabidopsis thaliana   chromosome II BAC T13E15 genomic sequence, complete   sequence; "	DPlate 069	H08			AU065349	AU101677			18	O15
5568	g_5568	RB0145		DPlate 071	H08			AU070718	AU082163			18	P15
5569	g_5569	RB0746	">ATAC002510_16(AC002510|pid:g2618699) Arabidopsis thaliana   chromosome II BAC T32G6 genomic sequence, complete   sequence; unknown protein. "	DPlate 073	A02			AU071106	AU108936			19	A03
5570	g_5570	SA0206	">AE000801_9(AE000801|pid:g2621154) Methanobacterium   thermoautotrophicum from bases 68653 to 79584 (section 7   of 148) of the complete genome; Function Code:14.00 -   Unknown, ; similar to, gp:GI:g1835286 LN:XCU70889,   p()=0.99995, pid=09%. &B69020(B69020) "	DPlate 075	A02			AU055988	AU055989			19	B03
5571	g_5571	RB0754	>(Q41001) BLUE COPPER PROTEIN PRECURSOR.   &PSBLUCUPA_1(Z25471|pid:g562779) 	DPlate 073	B02			AU071112				19	C03
5572	g_5572	SA0230		DPlate 075	B02			AU173870				19	D03
5573	g_5573	RB0715		DPlate 073	C02			AU071082				19	E03
5574	g_5574	SA0246	">ATF7H19_10(AL031018|pid:g3292817) Arabidopsis thaliana DNA   chromosome 4, BAC clone F7H19 (ESSAII project); "	DPlate 075	C02			AU162646	AU056047			19	F03
5575	g_5575	RB0723		DPlate 073	D02			AU162621				19	G03
5576	g_5576	SA0270		DPlate 075	D02			AU056077	AU056078			19	H03
5577	g_5577	RB0771		DPlate 073	E02			AU071119	AU101707			19	I03
5578	g_5578	SA0294		DPlate 075	E02			AU173875	AU056110			19	J03
5579	g_5579	RB0708		DPlate 073	F02			AU071077	AU162620			19	K03
5580	g_5580	SA0207		DPlate 075	F02			AU055990	AU055991			19	L03
5581	g_5581	RB0716	>(P30188) CALMODULIN-LIKE PROTEIN. &ATCALLP_1(X68054|pid:g16213)   &S29595(S29595) 	DPlate 073	G02			AU071083				19	M03
5582	g_5582	SA0215		DPlate 075	G02			AU056001	AU056002			19	N03
5583	g_5583	RB0732		DPlate 073	H02			AU071096				19	O03
5584	g_5584	SA0223	">AC002328_16(AC002328|pid:g3953471) Genomic sequence for Arabidopsis   thaliana BAC F20N2, complete sequence; similar to beta   transducin isolog (AC002333); similar to ESTs gb|H37054   and gb|W43523. "	DPlate 075	H02			AU056013	AU056014			19	P03
5585	g_5585	RB0945	">ATF7J7_12(AL021960|pid:g2911075) Arabidopsis thaliana DNA   chromosome 4, BAC clone F7J7 (ESSAII project);   similarity to heat shock protein dnaJ homolog, yeast,   PIR2:A33618; contains EST gb:Aa586245, R83957. "	DPlate 073	A08			AU071236				19	A15
5586	g_5586	SA0370	">ATF10M23_1(AL035440|pid:g4455190) Arabidopsis thaliana DNA   chromosome 4, BAC clone F10M23 (ESSAII project); weak   similarity to probable membrane protein YDL217c - yeast,   EMBL:Z74265; contains EST gb:T46407, AA404844. "	DPlate 075	A08			AU056197	AU056198			19	B15
5587	g_5587	RB0953		DPlate 073	B08			AU176528				19	C15
5588	g_5588	SA0307	">AB012048_1(AB012048|pid:g2967456) Arabidopsis thaliana gene for   sulfate transporter, complete cds, clone:AST12. "	DPlate 075	B08			AU173876	AU056120			19	D15
5589	g_5589	RB0977		DPlate 073	C08			AU071260				19	E15
5590	g_5590	SA0387		DPlate 075	C08			AU056216				19	F15
5591	g_5591	RB0906		DPlate 073	D08			AU076237	AU076238			19	G15
5592	g_5592	SA0308		DPlate 075	D08			AU173877	AU056121			19	H15
5593	g_5593	RB0938	">AF045667_1(AF045667|pid:g3421138) Carica papaya isolate ADC   arginine decarboxylase (spe2) gene, partial cds. "	DPlate 073	E08			AU078261	AU078262			19	I15
5594	g_5594	SA0316	">ATAC006069_14(AC006069|pid:g4220479) Arabidopsis thaliana   chromosome II BAC T8O11 genomic sequence, complete   sequence; unknown protein. "	DPlate 075	E08			AU056127	AU056128			19	J15
5595	g_5595	RB0946	">AF031471_1(AF031471|pid:g3095075) Juniperus oxycedrus pollen   allergen mRNA, complete cds; four EF-hand   calcium-binding. "	DPlate 073	F08			AU071237				19	K15
5596	g_5596	SA0324	">AB003103_1(AB003103|pid:g1945611) Homo sapiens mRNA for 26S   proteasome subunit p55, complete cds.   &JC6523(PC6501;JC6523) "	DPlate 075	F08			AU056139	AU056140			19	L15
5597	g_5597	RB0978	">ATF28J12_19(AL021710|pid:g2832658) Arabidopsis thaliana DNA   chromosome 4, BAC clone F28J12 (ESSAII project);   contains EST gb:H36848. "	DPlate 073	G08			AU071261	AU173857			19	M15
5598	g_5598	SA0332		DPlate 075	G08			AU056150	AU056151			19	N15
5599	g_5599	RB0986	">ATAC006532_12(AC006532|pid:g4406787) Arabidopsis thaliana   chromosome II BAC F14H20 genomic sequence, complete   sequence; "	DPlate 073	H08			AU173858	AU071267			19	O15
5600	g_5600	SA0348	>CELF16H11_5(U55376|pid:g1280135) Caenorhabditis elegans cosmid   F16H11; coded for by C. elegans cDNA cm21e6; coded for   by C. elegans cDNA cm01e2; similar to melibiose carrier   protein (thiomethylgalactoside permease II). 	DPlate 075	H08			AU056170	AU056171			19	P15
5601	g_5601	SA0424	>(P34308) HYPOTHETICAL 70.9 KD PROTEIN C06G4.2 IN CHROMOSOME III.   &CELC06G4_3(L25598|pid:g409293) &S44749(S44749) 	DPlate 076	A02			AU056251	AU056252			20	A03
5602	g_5602	SA1317	">D38170_1(D38170|pid:g1215812) Rice mRNA for probenazole-inducible   protein PBZ1, complete cds; Induced by the treatment of   probenazole or the inoculation of rice blast fungus..   &D82066_1(D82066|pid:g2780343) "	DPlate 079	A02			AU057293				20	B03
5603	g_5603	SA0440	">HAU67261_1(U67261|pid:g1763000) Helicoverpa armigera   nucleopolyhedrovirus RING-finger protein (HOAR) gene,   partial cds; RING C3HC4 family member. "	DPlate 076	B02			AU056275	AU056276			20	C03
5604	g_5604	SA1341	">ATAC006955_4(AC006955|pid:g4544409) Arabidopsis thaliana chromosome   II BAC F28I8 genomic sequence, complete sequence; "	DPlate 079	B02			AU057316	AU057317			20	D03
5605	g_5605	SA0456		DPlate 076	C02			AU162669	AU056301			20	E03
5606	g_5606	SA1365		DPlate 079	C02			AU057344				20	F03
5607	g_5607	SA0480	>LEGALK_1(X99851|pid:g2292917) L.erecta mRNA for galactokinase. 	DPlate 076	D02			AU056333	AU056334			20	G03
5608	g_5608	SA1373	">AF093540_1(AF093540|pid:g3747050) Zea mays ribosomal protein L26   mRNA, partial cds; similar to Brassica rapa ribosomal   protein in GenBank Accession Number D78495. "	DPlate 079	D02			AU162749	AU057356			20	H03
5609	g_5609	SA0496		DPlate 076	E02			AU056351				20	I03
5610	g_5610	SA1302		DPlate 079	E02			AU057281	AU057282			20	J03
5611	g_5611	SA0525		DPlate 076	F02			AU173890	AU056377			20	K03
5612	g_5612	SA1310		DPlate 079	F02			AU057286				20	L03
5613	g_5613	SA0533		DPlate 076	G02			AU056385	AU056386			20	M03
5614	g_5614	SA1326		DPlate 079	G02			AU070282				20	N03
5615	g_5615	SA0557	>(P47735) RECEPTOR-LIKE PROTEIN KINASE 5 PRECURSOR (EC 2.7.1.-).   &ATF20O9_18(AL021749|pid:g2842492)   &ATHRLPKC_1(M84660|pid:g166850) &S27756(S27756) 	DPlate 076	H02			AU173893	AU056410			20	O03
5616	g_5616	SA1342	">F5O8_11(AC005990|pid:g4056438) Arabidopsis thaliana chromosome 1   BAC F5O8 sequence, complete sequence; "	DPlate 079	H02			AU173950	AU057318			20	P03
5617	g_5617	SA0644	>S56716(S56716) protein kinase SPK-3 (EC 2.7.1.-) - soybean   &SOYSPK3_1(L19361|pid:g310582) 	DPlate 076	A08			AU056506	AU056507			20	A15
5618	g_5618	SA1407	">AF036328_1(AF036328|pid:g2674203) Arabidopsis thaliana CLP protease   regulatory subunit CLPX mRNA, nuclear gene encoding   chloroplast protein, complete cds. "	DPlate 079	A08			AU057392				20	B15
5619	g_5619	SA0660	>(Q10716) CYSTEINE PROTEINASE 1 PRECURSOR (EC 3.4.22.-).   &MZECP_1(D45402|pid:g643597) &S59597(S59597) 	DPlate 076	B08			AU056528	AU056529			20	C15
5620	g_5620	SA1415	">SPAC57A7_5(Z95396|pid:g2104440) S.pombe chromosome I cosmid c57A7;   SPAC57A7.05, len:1337, SIMILARITY:, Q07660, , (1125 aa),   fasta scores: opt: 199, E():0.00029, (20.5% identity in   366 aa). "	DPlate 079	B08			AU057404	AU057405			20	D15
5621	g_5621	SA0668	>ATGTRNAS_1(AJ002062|pid:g2564215) Arabidopsis thaliana mRNA for   glycyl-tRNA synthetase. 	DPlate 076	C08			AU056541	AU056542			20	E15
5622	g_5622	SA1471	">ATAC002332_3(AC002332|pid:g2459409) Arabidopsis thaliana chromosome   II BAC F4P9 genomic sequence, complete sequence; "	DPlate 079	C08			AU057472	AU057473			20	F15
5623	g_5623	SA0684		DPlate 076	D08			AU056561				20	G15
5624	g_5624	SA1480	">ATAC002521_6(AC002521|pid:g2947061) Arabidopsis thaliana chromosome   II BAC T20F6 genomic sequence, complete sequence;   &D88207_1(D88207|pid:g2852449) "	DPlate 079	D08			AU057486	AU057487			20	H15
5625	g_5625	SA0629	">ATAC005395_18(AC005395|pid:g3643604) Arabidopsis thaliana   chromosome II BAC F17H15 genomic sequence, complete   sequence; "	DPlate 076	E08			AU056488	AU162690			20	I15
5626	g_5626	SA1496		DPlate 079	E08			AU057501	AU057502			20	J15
5627	g_5627	SA0677		DPlate 076	F08			AU056552				20	K15
5628	g_5628	SA1501		DPlate 079	F08			AU057503				20	L15
5629	g_5629	SA0693	">PVU77935_1(U77935|pid:g1684851) Phaseolus vulgaris DnaJ-like   protein mRNA, partial cds; synthesis and expression are   regulated by heavy metal stress, virus infection and   wounding treatment, suggesting that DnaJ-like protein   plays a role in plant defense.. "	DPlate 076	G08			AU173907	AU173908			20	M15
5630	g_5630	SA1517	>ATEST44B7_1(Y10084|pid:g1922242) Arabidopsis thaliana matching EST   44B7; matches EST 44B7. 	DPlate 079	G08			AU162754	AU057512			20	N15
5631	g_5631	SA0638	">F20D22_14(AC002411|pid:g3142300) Arabidopsis thaliana chromosome 1   BAC F20D22 sequence, complete sequence; Contains   similarity to pre-mRNA processing protein PRP39 gb|L29224   from S. cerevisiae. ESTs gb|R64908 and gb|T88158,   gb|N38703 and gb|AA651043 come from this gene.. "	DPlate 076	H08			AU056499	AU056500			20	O15
5632	g_5632	SA1525	>S31719(S31719) proline-rich protein - African clawed frog   &XLOOCM_1(X68249|pid:g64956) 	DPlate 079	H08			AU057519	AU057520			20	P15
5633	g_5633	SS0074	">AF051249_1(AF051249|pid:g2982328) Picea mariana pyruvate   dehydrogenase E1 beta subunit (Sb68) mRNA, partial cds. "	DPlate 081	A02			C23572	AU032453			21	A03
5634	g_5634	SS3962		DPlate 083	A02			D48037				21	B03
5635	g_5635	SS0019	">ATAC004482_3(AC004482|pid:g3152605) Arabidopsis thaliana chromosome   II BAC F27L4 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 081	B02			C23565	AU176535			21	C03
5636	g_5636	SS3970		DPlate 083	B02			D48043	AU174034			21	D03
5637	g_5637	SS0027	">AF059037_1(AF059037|pid:g3057150) Arabidopsis thaliana chaperonin   10 (CPN10) mRNA, complete cds. "	DPlate 081	C02			AU065759	AU032439			21	E03
5638	g_5638	SS3939		DPlate 083	C02			AU174032				21	F03
5639	g_5639	SS0043	>NTO7630_1(AJ007630|pid:g3550519) Nicotiana tabacum mRNA for   oxygenase. 	DPlate 081	D02			AU065764	AU032443			21	G03
5640	g_5640	SS3963		DPlate 083	D02			D48038	AU174033			21	H03
5641	g_5641	SS0059	">RC11591_1(Y11591|pid:g1877397) R.communis mRNA for shaggy-like   kinase, partial. "	DPlate 081	E02			AU065766	AU032449			21	I03
5642	g_5642	SS3987	">ATAC004481_14(AC004481|pid:g3337361) Arabidopsis thaliana chromosome   II BAC F13P17 genomic sequence, complete sequence; "	DPlate 083	E02			D48057	AU174037			21	J03
5643	g_5643	SS0067	">AC002330_4(AC002330|pid:g3892058) Arabidopsis thaliana BAC T10P11   from chromosome IV, near 15 cM, complete sequence;   similar to rat N-methyl-D-aspartate receptor   glutamate-binding chain, GenBank accession number   S19586; similar to D. melanogaster N-methyl-D-aspartate   receptor-associated protein, GenBank accession number   L37377; functional catalog ID=10.01.05; contains Pfam   signature for uncharacterized protein family UPF0005,   score=107.1. "	DPlate 081	F02			AU065771	AU101730			21	K03
5644	g_5644	SS3924	>(P49100) CYTOCHROME B5. &OSRNACB5_1(X75670|pid:g414705)   &S46307(S46307;S38582) 	DPlate 083	F02			D48014				21	L03
5645	g_5645	SS0091	>CELH17B01_3(AF040646|pid:g2746826) Caenorhabditis elegans cosmid   H17B01; coded for by C. elegans cDNA yk169c10.3; coded   for by C. elegans cDNA yk125b6.3; coded for by C. elegans   cDNA yk71e8.3; coded for by C. elegans cDNA CEESD11FB;   coded for by C. elegans cDNA CEESD11F; coded for by C.   elegans cDNA CEESD11FC; coded for by C. elegans cDNA   yk5h1.3; coded for by C. elegans cDNA yk32a1.3; coded for   by C. elegans cDNA yk90d11.3; coded for by C. elegans   cDNA CEESM46F; coded for by C. elegans cDNA yk71e8.5;   coded for by C. elegans cDNA yk68e12.5; coded for by C.   elegans cDNA yk169c10.5; coded for by C. elegans cDNA   yk5h1.5; coded for by C. elegans cDNA CEESD11R; coded for   by C. elegans cDNA yk188c12.5; coded for by C. elegans   cDNA yk90d11.5. 	DPlate 081	G02			C23575	AU032457			21	M03
5646	g_5646	SS3948		DPlate 083	G02			AU162982				21	N03
5647	g_5647	SS0004	>(P46274) OUTER MITOCHONDRIAL MEMBRANE PROTEIN PORIN   (VOLTAGE-DEPENDENT ANION-SELECTIVE CHANNEL PROTEIN)   (VDAC). &TAVDAC1_1(X77733|pid:g456672) 	DPlate 081	H02			AU065753	AU032429			21	O03
5648	g_5648	SS3972	>A43350(A43350) formate--tetrahydrofolate ligase (EC 6.3.4.3) -   spinach &SPISFS1A_1(M83940|pid:g170145) 	DPlate 083	H02			D48044	AU032752			21	P03
5649	g_5649	SS1627	">ATAC005313_4(AC005313|pid:g3548801) Arabidopsis thaliana chromosome   II BAC T18E12 genomic sequence, complete sequence;   &ATAC006284_27(AC006284|pid:g4335768) "	DPlate 081	A08			AU162834				21	A15
5650	g_5650	SS4901	>ATH9696_1(AJ009696|pid:g3549626) Arabidopsis thaliana wak1 gene. 	DPlate 083	A08			D48590				21	B15
5651	g_5651	SS1636	">AC004557_28(AC004557|pid:g3935185) Genomic sequence for Arabidopsis   thaliana BAC F17L21, complete sequence; similar to   lecithin:cholesterol acyltransferase precursor (M26268).   "	DPlate 081	B08			D46761	AU173986			21	C15
5652	g_5652	SS4973		DPlate 083	B08			D48643	AU075525			21	D15
5653	g_5653	SS1660		DPlate 081	C08			D46777				21	E15
5654	g_5654	SS4958	">D90903_7(D90903|pid:g1652134) Synechocystis sp. PCC6803 complete   genome, 5/27, 524346-630554; ORF_ID:slr1761.   &S75144(S75144) "	DPlate 083	C08			D48632	AU075519			21	F15
5655	g_5655	SS1693		DPlate 081	D08			AU176537	AU176538			21	G15
5656	g_5656	SS4990	>ATP4ZETCR_1(Z49776|pid:g886434) A.thaliana mRNA for ARP protein.   &S57614(S57614) 	DPlate 083	D08			AU174059	AU174060			21	H15
5657	g_5657	SS1606		DPlate 081	E08			D46741				21	I15
5658	g_5658	SS4928	">ATAC004683_19(AC004683|pid:g3395440) Arabidopsis thaliana   chromosome II BAC T19C21 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 083	E08			D48608				21	J15
5659	g_5659	SS1670		DPlate 081	F08			D46783	AU090607			21	K15
5660	g_5660	SS4952		DPlate 083	F08			D48627	AU075516			21	L15
5661	g_5661	SS1694		DPlate 081	G08			D46796	AU176539			21	M15
5662	g_5662	SS4984	">(P34791) PEPTIDYL-PROLYL CIS-TRANS ISOMERASE, CHLOROPLAST PRECURSOR   (EC 5.2.1.8) (PPIASE) (ROTAMASE) (CYCLOPHILIN)   (CYCLOSPORIN A-BINDING PROTEIN).   &ATHROC4ARA_1(L14845|pid:g405131)   &ATU42724_1(U42724|pid:g1322278) &B53422(B53422) "	DPlate 083	G08			D48651	AU075528			21	N15
5663	g_5663	SS1615	">(P05100) DNA-3-METHYLADENINE GLYCOSIDASE I (EC 3.2.2.20)   (3-METHYLADENINE-DNA GLYCOSYLASE I, CONSTITUTIVE) (TAG   I). &AE000432_4(AE000432|pid:g1789971)   &DGECM1(A24604;S47770;I58249;G65153)   &ECOTAG_1(J02606|pid:g147920)   &ECOUW76_105(U00039|pid:g466687)   &ECTAG_1(X03845|pid:g43030) "	DPlate 081	H08			D46747	AU101737			21	O15
5664	g_5664	SS4945	">AF004397_1(AF004397|pid:g2501846) Gallus gallus   chromo-helicase-DNA-binding on the Z chromosome protein,   variant with hydrophilic domain, (CHD-Z) mRNA, complete   cds; CHD protein with hydrophilic domain. "	DPlate 083	H08			D48621	AU070420			21	P15
5665	g_5665	SS5918	">GMU53418_1(U53418|pid:g1518540) Glycine max UDP-glucose   dehydrogenase mRNA, complete cds. "	DPlate 085	A02			AU070454				22	A03
5666	g_5666	ST0881	">RICCA_1(D29966|pid:g1261858) Rice CatA gene for catalase, complete   cds. &S70588(S70588) "	DPlate 087	A02			AU175153	C23619			22	B03
5667	g_5667	SS5966	">AF053345_1(AF053345|pid:g4091810) Arabidopsis thaliana fatty acid   elongase 3-ketoacyl-CoA synthase 1 (KCS1) gene, complete   cds; condensing enzyme. "	DPlate 085	B02			AU065928				22	C03
5668	g_5668	ST0810	">ATM7J2_19(AL022197|pid:g2980806) Arabidopsis thaliana DNA   chromosome 4, P1 clone M7J2 (ESSAII project); similarity   to antisense basic fibroblast growth factor, rat,   G1518635. "	DPlate 087	B02			D39464				22	D03
5669	g_5669	SS5928	">ATAC004261_3(AC004261|pid:g3402698) Arabidopsis thaliana chromosome   II BAC T3K9 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 085	C02			AU065913	AU174099			22	E03
5670	g_5670	ST0818		DPlate 087	C02			AU070520				22	F03
5671	g_5671	SS5952	">AF061577_1(AF061577|pid:g3126854) Oryza sativa chlorophyll a/b   binding protein (RCABP89) mRNA, nuclear gene encoding   chloroplast protein, complete cds. "	DPlate 085	D02			C24851				22	G03
5672	g_5672	ST0803		DPlate 087	D02			D39460				22	H03
5673	g_5673	SS5984		DPlate 085	E02			AU101845	AU174102			22	I03
5674	g_5674	ST0811		DPlate 087	E02			D39465	AU032996			22	J03
5675	g_5675	SS5992		DPlate 085	F02			AU163127	AU163128			22	K03
5676	g_5676	ST0819		DPlate 087	F02			D39470				22	L03
5677	g_5677	SS5905	>(P51253) CHLOROPLAST 30S RIBOSOMAL PROTEIN S20.   &PPU38804_67(U38804|pid:g1276719) &S73174(S73174) 	DPlate 085	G02			C24840	AU174096			22	M03
5678	g_5678	ST0851	>(P34788) 40S RIBOSOMAL PROTEIN S18.   &ATF17A8_15(AL049482|pid:g4538910)   &ATRBPS18A_1(Z23165|pid:g405613)   &ATS18RP1_1(Z28701|pid:g434343)   &ATS18RP2_1(Z28702|pid:g434345)   &ATS18RP3_1(Z28962|pid:g434906)   &ATY12227_7(Y12227|pid:g2505871)   &S37496(S46223;S39263;S39265;S39264;S37496)   &T22J18_5(AC003979|pid:g3287678) 	DPlate 087	G02			D39486	AU032999			22	N03
5679	g_5679	SS5945	>(P52303) BETA-ADAPTIN 1 (PLASMA MEMBRANE ADAPTOR HA2/AP2 ADAPTIN BETA   SUBUNIT) (CLATHRIN ASSEMBLY PROTEIN COMPLEX 2 BETA LARGE   CHAIN) (AP105A). &B32105(B32105)   &RATBCCAPA_1(M77245|pid:g203113) 	DPlate 085	H02			AU065922	AU174100			22	O03
5680	g_5680	ST0804	">PTY13772_1(Y13772|pid:g3805962) Populus trichocarpa mRNA for   laccase, lac90 gene. "	DPlate 087	H02			D39461	AU032995			22	P03
5681	g_5681	SS6203	">AC006266_2(AC006266|pid:g4309697) Arabidopsis thaliana BAC F1K3   from chromosome IV near 21 cM, complete sequence;   similar to A. fulgidus DNA-directed RNA polymerase   subunit M, GenBank accession number AE001019; similar to   S. pombe DNA-directed RNA polymerase III, GenBank   accession number O13896; functional catalog ID=04.05.01.   "	DPlate 085	A08			AU065963	AU101851			22	A15
5682	g_5682	ST0948	">ATU82202_1(U82202|pid:g1769568) Arabidopsis thaliana fumarase   (FUM1) mRNA, complete cds; fumarate hydratase. "	DPlate 087	A08			D39538	AU161584			22	B15
5683	g_5683	SS6219	>(P18567) RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN C PRECURSOR   (EC 4.1.1.39). &AF017364_1(AF017364|pid:g2407283)   &RICRUBPC1_1(D00643|pid:g218208) &RKRZS9(JA0070) 	DPlate 085	B08			AU032913	AU101854			22	C15
5684	g_5684	ST0980	">D90904_7(D90904|pid:g1652232) Synechocystis sp. PCC6803 complete   genome, 6/27, 630555-781448; ORF_ID:ssr1698.   &S75241(S75241) "	DPlate 087	B08			D39554	AU161587			22	D15
5685	g_5685	SS6292		DPlate 085	C08			C24958	AU174120			22	E15
5686	g_5686	ST1017	>AOUNKN_1(X77320|pid:g452714) A.officinalis L. unknown mRNA.   &S41890(S41890) 	DPlate 087	C08			AU181037				22	F15
5687	g_5687	SS6205	>A47104(A47104)chloride channel 64K chain - bovine 	DPlate 085	D08			AU070477				22	G15
5688	g_5688	ST1081	>(P20364) TUBULIN BETA CHAIN (FRAGMENT).   &DCBTUB1_1(U64029|pid:g1490665) 	DPlate 087	D08			AU161591				22	H15
5689	g_5689	SS6221	">AC005275_4(AC005275|pid:g4262140) Arabidopsis thaliana BAC F4C21   from chromosome IV, top arm, near 17 cM, complete   sequence; similar to U1 small nuclear ribonucleoprotein   C; functional catalog ID=04.05.03. "	DPlate 085	E08			C24933	AU174116			22	I15
5690	g_5690	ST1042	">AF020433_1(AF020433|pid:g2443755) Arabidopsis thaliana cyclophilin   (CYP5) gene, complete cds. "	DPlate 087	E08			D39571	AU097016			22	J15
5691	g_5691	SS6229	">ATAC006232_18(AC006232|pid:g4314401) Arabidopsis thaliana   chromosome II BAC F10A12 genomic sequence, complete   sequence; "	DPlate 085	F08			C24937				22	K15
5692	g_5692	ST1074	>HVEXTGENE_1(X91659|pid:g1885310) H.vulgare mRNA for endoxyloglucan   transferase; Xyloglucan endotransglycosylase (XET). 	DPlate 087	F08			D39587	AU091495			22	L15
5693	g_5693	SS6206	">ATF24G24_7(AL049488|pid:g4538956) Arabidopsis thaliana DNA   chromosome 4, BAC clone F24G24 (ESSA project);   similarity to wound-induced protein, Lycopersicon   esculentum, PIR2:S19773. &T9A4_3(AF096373|pid:g3695408)   "	DPlate 085	G08			AU065964	AU101852			22	M15
5694	g_5694	ST1082	>AMY010449_1(AJ010449|pid:g4127348) Alopecurus myosuroides mRNA for   glutathione transferase 1b. 	DPlate 087	G08			D39588	AU101928			22	N15
5695	g_5695	SS6222	">ATT19P19_12(AL022605|pid:g3080442) Arabidopsis thaliana DNA   chromosome 4, BAC clone T19P19 (ESSAII project);   contains EST gb:Z26779, T75611, Z33718, T46761. "	DPlate 085	H08			AU065968	AU032914			22	O15
5696	g_5696	ST1019	">ATT5C23_4(AL049500|pid:g4539452) Arabidopsis thaliana DNA   chromosome 4, BAC clone T5C23 (ESSA project); strong   similarity to phosphoribosylanthranilate transferase,   Pisum sativum, D86180. "	DPlate 087	H08			D39564				22	P15
5697	g_5697	ST2159		DPlate 089	A02			D40289	AU174250			23	A03
5698	g_5698	ST4005	>(P49248) IN2-1 PROTEIN. &S17743(S17743)   &ZMIN21_1(X58573|pid:g22347) 	DPlate 091	A02			D41482				23	B03
5699	g_5699	ST2104	">ATAC007017_13(AC007017|pid:g4510373) Arabidopsis thaliana   chromosome II BAC F11F19 genomic sequence, complete   sequence; "	DPlate 089	B02			D40256	AU033058			23	C03
5700	g_5700	ST4029	">NAU45958_1(U45958|pid:g1184100) Nicotiana alata pistil   extensin-like protein mRNA, complete cds. "	DPlate 091	B02			AU181049				23	D03
5701	g_5701	ST2168		DPlate 089	C02			D40294	AU174251			23	E03
5702	g_5702	ST4078	">ATF13M23_21(AL035523|pid:g4455250) Arabidopsis thaliana DNA   chromosome 4, BAC clone F13M23 (ESSAII project);   similarity to predicted protein, Arabidopsis thaliana. "	DPlate 091	C02			D41534	AU174313			23	F03
5703	g_5703	ST2121	">AF049881_1(AF049881|pid:g2944417) Linum usitatissimum peroxidase   FLXPER4 (PER4) mRNA, partial cds. "	DPlate 089	D02			D40265	AU163222			23	G03
5704	g_5704	ST4086	">CEF22E12_4(Z71180|pid:g3876299) Caenorhabditis elegans cosmid F22E12,   complete sequence; similar to BPTI/KUNITZ inhibitor   domain; cDNA EST EMBL:D68293 comes from this gene; cDNA   EST yk448h4.5 comes from this gene; cDNA EST yk249e6.5   comes from this gene; cDNA EST yk448h4.3 comes from this   gene. &CEY32F6A_4(AL021474|pid:g3880760) "	DPlate 091	D02			D41539	AU101993			23	H03
5705	g_5705	ST2129		DPlate 089	E02			D40269	AU161649			23	I03
5706	g_5706	ST4023		DPlate 091	E02			D41493	AU174310			23	J03
5707	g_5707	ST2137		DPlate 089	F02			D40275	AU033060			23	K03
5708	g_5708	ST4039	">AF043529_1(AF043529|pid:g3421099) Arabidopsis thaliana 20S   proteasome subunit PBA1 (PBA1) mRNA, complete cds.   &ATF8F16_11(AL021633|pid:g2827525)   &ATY13694_1(Y13694|pid:g2511594) "	DPlate 091	F02			AU174311	AU174312			23	L03
5709	g_5709	ST2177	">ATAC006068_2(AC006068|pid:g4263776) Arabidopsis thaliana chromosome   II BAC T20F21 genomic sequence, complete sequence;   unknown protein. &ATAC007017_30(AC007017|pid:g4510390) "	DPlate 089	G02			D40300	AU174252			23	M03
5710	g_5710	ST4008	">ATAC006068_19(AC006068|pid:g4263791) Arabidopsis thaliana   chromosome II BAC T20F21 genomic sequence, complete   sequence; "	DPlate 091	G02			D41483	AU101989			23	N03
5711	g_5711	ST2186	">ATF20O9_6(AL021749|pid:g2842481) Arabidopsis thaliana DNA   chromosome 4, BAC clone F20O9 (ESSAII project); strong   similarity to extensin-like protein, Zea mays,   Pir2:S49915. "	DPlate 089	H02			D40307	AU101946			23	O03
5712	g_5712	ST4032	>(Q41738) THIAMINE BIOSYNTHETIC ENZYME. &S61419(S61419)   &ZMU17350_1(U17350|pid:g596078) 	DPlate 091	H02			D41499	AU033141			23	P03
5713	g_5713	ST2606	>HSRANBP5_1(Y08890|pid:g2253156) H.sapiens mRNA for Ran_GTP binding   protein 5; RanBP5 is a predominantly cytoplasmic protein   that can bind to nuclear pore complexes. 	DPlate 089	A08			D40547	AU101953			23	A15
5714	g_5714	ST4851		DPlate 091	A08			D41879	AU174341			23	B15
5715	g_5715	ST2654	">ATAC004484_11(AC004484|pid:g3075394) Arabidopsis thaliana   chromosome II BAC T1D16 genomic sequence, complete   sequence; &ATH010713_1(AJ010713|pid:g3559809) "	DPlate 089	B08			D40582	AU174269			23	C15
5716	g_5716	ST4891	">RICSACPD_1(D38753|pid:g976257) Rice mRNA stearyl-ACP desaturase,   complete cds. "	DPlate 091	B08			AU174345	AU174346			23	D15
5717	g_5717	ST2607	">ATAC003680_25(AC003680|pid:g2979562) Arabidopsis thaliana   chromosome II BAC F17K2 genomic sequence, complete   sequence; unknown protein.   &ATAC004665_30(AC004665|pid:g3386623) "	DPlate 089	C08			D40548				23	E15
5718	g_5718	ST4812	>AE000443_4(AE000443|pid:g2367257) Escherichia coli K-12 MG1655   section 333 of 400 of the complete genome; f479; 100 pct   identical to 460 amino acids of YICJ_ECOLI SW: P31435   but has 19 additional N-ter residues; similar to   melibiosecarrier protein. &C65167(C65167) 	DPlate 091	C08							23	F15
5719	g_5719	ST2647		DPlate 089	D08			D40576				23	G15
5720	g_5720	ST4884	">AC002292_29(AC002292|pid:g2462748) Genomic sequence of Arabidopsis   BAC F8A5, complete sequence; "	DPlate 091	D08			D41900				23	H15
5721	g_5721	ST2648		DPlate 089	E08			AU174268				23	I15
5722	g_5722	ST4892	">AF002211_1(AF002211|pid:g2183249) Triticum aestivum   glutathione-S-transferase mRNA, complete cds.   &AF109714_1(AF109714|pid:g4185800) "	DPlate 091	E08			D41906	AU174347			23	J15
5723	g_5723	ST2656	">CEF15H10_1(Z73972|pid:g3875997) Caenorhabditis elegans cosmid   F15H10, complete sequence; predicted using Genefinder. "	DPlate 089	F08			D40584				23	K15
5724	g_5724	ST4821	">(P51975) CORTICOSTEROID 11-BETA-DEHYDROGENASE, ISOZYME 1 (EC   1.1.1.146) (11-DH) (11-BETA-HYDROXYSTEROID DEHYDROGENASE   1) (11-BETA-HSD1). &OA11BHDA_1(X69561|pid:g1191)   &S33117(S33117) "	DPlate 091	F08			AU174337	AU174338			23	L15
5725	g_5725	ST2672	>(Q40708) PIR7A PROTEIN. &OSPIR7BAR_1(Z34271|pid:g498744)   &S47086(S47086) 	DPlate 089	G08			D40596	AU108326			23	M15
5726	g_5726	ST4853	">AF032971_1(AF032971|pid:g2655285) Oryza sativa germin-like protein   1 (GER1) mRNA, complete cds; similar to wheat and barley   oxalate oxidase. "	DPlate 091	G08			D41881	AU102006			23	N15
5727	g_5727	ST2933		DPlate 089	H08			D40783	AU174273			23	O15
5728	g_5728	ST4861	>(Q42456) ASPARTIC PROTEINASE ORYZASIN 1 PRECURSOR (EC 3.4.23.-).   &RICAPA_1(D32144|pid:g1711289)   &RICAP_1(D32165|pid:g1030715) &S66516(S66516;S66517) 	DPlate 091	H08			AU174342				23	P15
5729	g_5729	ST6001		DPlate 093	A02			C25340	AU174378			24	A03
5730	g_5730	EE1340		DPlate 046	A06			AU172830				24	B03
5731	g_5731	ST6041		DPlate 093	B02			AU163248	AU033270			24	C03
5732	g_5732	EE1372		DPlate 046	B06			AU094756	AU029718			24	D03
5733	g_5733	ST6002	>(Q43292) 60S RIBOSOMAL PROTEIN L37. 	DPlate 093	C02			AU058141				24	E03
5734	g_5734	EE1417	">ATAC004705_3(AC004705|pid:g3252807) Arabidopsis thaliana chromosome   II BAC F26C24 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 046	C06			C91720	AU172835			24	F03
5735	g_5735	ST6082		DPlate 093	D02			AU181060				24	G03
5736	g_5736	EE1433	">OSOSR40C1_1(X95402|pid:g1296955) O.sativa mRNA for novel protein,   osr40c1; duplicated domain structure protein. "	DPlate 046	D06			AU166094	AU029738			24	H03
5737	g_5737	ST6011		DPlate 093	E02			AU058142				24	I03
5738	g_5738	EE1473		DPlate 046	E06			AU029759				24	J03
5739	g_5739	ST6051		DPlate 093	F02			AU097542				24	K03
5740	g_5740	EE1466	">LEU82123_1(U82123|pid:g2062421) Lycopersicon esculentum expansin   (LeEXP1) mRNA, complete cds; fruit ripening regulated   expansin. "	DPlate 046	F06			C91750	AU029756			24	L03
5741	g_5741	ST6060	">ATF24A6_10(AL035396|pid:g4454014) Arabidopsis thaliana DNA   chromosome 4, BAC clone F24A6 (ESSAII project);   similarity to pectinesterase - Citrus sinensis,   PID:g2098705; contains EST gb:T13918. "	DPlate 093	G02			C25364				24	M03
5742	g_5742	EE1474		DPlate 046	G06			C91753	AU029760			24	N03
5743	g_5743	ST6076		DPlate 093	H02			AU066283	AU174385			24	O03
5744	g_5744	EE1419	">OSU77637_1(U77637|pid:g1675394) Oryza sativa class III ADH enzyme   (AdhIII) gene, complete cds; glutathione dependent   formaldehyde dehydrogenase; formaldehyde:NAD+   oxidoreductase, glutathione formylating. "	DPlate 046	H06			C91721	AU029733			24	P03
5745	g_5745	ST6116	>(P20145) PROBABLE NONSPECIFIC LIPID-TRANSFER PROTEIN PRECURSOR   (LTP) (ALEURON- SPECIFIC 10 KD PROTEIN) (B-FABP).   &HVALSPE_1(X15257|pid:g18893)   &HVLTP2A_1(X69793|pid:g19041)   &HVLTPMR_1(X57270|pid:g19043)   &S04126(S04126;S14610;S31457) 	DPlate 093	A08			AU161851	AU161852			24	A15
5746	g_5746	posi17										24	B15
5747	g_5747	ST6124		DPlate 093	B08			AU070626	AU174386			24	C15
5748	g_5748	posi18										24	D15
5749	g_5749	ST6132	">ATAC006403_11(AC006403|pid:g4337197) Arabidopsis thaliana   chromosome II BAC T28I24 genomic sequence, complete   sequence; "	DPlate 093	C08			AU174388	AU161859			24	E15
5750	g_5750	posi19										24	F15
5751	g_5751	ST6172		DPlate 093	D08			AU102055				24	G15
5752	g_5752	posi20										24	H15
5753	g_5753	ST6217		DPlate 093	E08			C25385	AU174392			24	I15
5754	g_5754	posi21										24	J15
5755	g_5755	ST6225	">S22990(S22990;S14852) zein, 27K - maize (fragment)   &ZMZEIN27_1(X58197|pid:g22550) "	DPlate 093	F08			C25386	AU174395			24	K15
5756	g_5756	posi22										24	L15
5757	g_5757	ST6289		DPlate 093	G08			C25406	AU102064			24	M15
5758	g_5758	posi23										24	N15
5759	g_5759	ST6210		DPlate 093	H08			AU066287				24	O15
5760	g_5760	posi24										24	P15
5761	g_5761	EG0464	">ATAC004697_14(AC004697|pid:g3402683) Arabidopsis thaliana   chromosome II BAC T16B24 genomic sequence, complete   sequence; "	DPlate 050	A02			AU172959	AU030005			13	A04
5762	g_5762	EG1195		DPlate 052	A02			AU095092	AU030531			13	B04
5763	g_5763	EG0496	">LEDIF54_1(X99452|pid:g2052096) L.esculentum mRNA for extensin-like   protein, Dif54. "	DPlate 050	B02			C74704				13	C04
5764	g_5764	EG1196	">AB018587_1(AB018587|pid:g4240033) Zea mays ZmGR1a mRNA, complete   cds. "	DPlate 052	B02			AU162301	AU030532			13	D04
5765	g_5765	EG0517		DPlate 050	C02			AU065603	AU030026			13	E04
5766	g_5766	EG1233	">RICT151_1(D26060|pid:g483431) Rice mRNA for cyc07, complete cds.   &S42540(S42540) "	DPlate 052	C02			AU065740	AU030553			13	F04
5767	g_5767	EG0525		DPlate 050	D02			AU058338	AU166191			13	G04
5768	g_5768	EG1218	">ATF9D16_4(AL035394|pid:g4454026) Arabidopsis thaliana DNA   chromosome 4, BAC clone F9D16 (ESSAII project);   similarity to phosphoprotein phosphatase (EC 3.1.3.16)   PPT - rat; contains EST gb:AA042537, F14005. "	DPlate 052	D02			AU030541	AU165844			13	H04
5769	g_5769	EG0557		DPlate 050	E02			AU030051				13	I04
5770	g_5770	EG1242		DPlate 052	E02			AU101485	AU058443			13	J04
5771	g_5771	EG0565	">AF034949_1(AF034949|pid:g2668750) Zea mays ribosomal protein L30   (rpl30) mRNA, complete cds. "	DPlate 050	F02			AU058346	AU081342			13	K04
5772	g_5772	EG1250		DPlate 052	F02			AU030565	AU030566			13	L04
5773	g_5773	EG0573		DPlate 050	G02			AU030059				13	M04
5774	g_5774	EG1274		DPlate 052	G02			AU065746	AU030587			13	N04
5775	g_5775	EG0526	">S93804_1(S93804|pid:g1680182) BAF1/ABF1/YKL505=ARS-binding factor   I...tRNA-Ala [Saccharomyces cerevisiae, Genomic, 8   genes, 10660 nt]. "	DPlate 050	H02			AU030032	AU030033			13	O04
5776	g_5776	EG1228		DPlate 052	H02			AU030549	AU095100			13	P04
5777	g_5777	EG0613		DPlate 050	A08			AU065619	AU030090			13	A16
5778	g_5778	EH0158	">AC002330_5(AC002330|pid:g3892057) Arabidopsis thaliana BAC T10P11   from chromosome IV, near 15 cM, complete sequence;   similar to A. thaliana hypothetical protein from   chromosome III, GenBank accession number 3068704;   functional catalog ID=99. "	DPlate 052	A08			AU165872	AU030728			13	B16
5779	g_5779	EG0621	">ZMU65948_1(U65948|pid:g2340108) Zea mays starch branching enzyme   IIa (Sbe2a) mRNA, partial cds; starch branching enzyme   isozyme SBEIIa. "	DPlate 050	B08			AU030096	AU030097			13	C16
5780	g_5780	EH0182		DPlate 052	B08			AU065165	AU081343			13	D16
5781	g_5781	EG0645		DPlate 050	C08			AU030116	AU166197			13	E16
5782	g_5782	EH0191		DPlate 052	C08			AU172990				13	F16
5783	g_5783	EG0653	">AF057357_1(AF057357|pid:g3273743) Arabidopsis thaliana lipid   transfer protein 2 precursor (LTP2) gene, complete cds.    &ATAC005499_27(AC005499|pid:g3786019) "	DPlate 050	D08			AU030121				13	G16
5784	g_5784	EH0112		DPlate 052	D08			AU030684	AU030685			13	H16
5785	g_5785	EG0661		DPlate 050	E08			AU075777	AU075778			13	I16
5786	g_5786	EH0152		DPlate 052	E08			AU065162	AU101489			13	J16
5787	g_5787	EG0685	">AB012708_1(AB012708|pid:g3551257) Daucus carota mRNA for 98b,   complete cds. "	DPlate 050	F08			AU030146	AU030147			13	K16
5788	g_5788	EH0192	>D70894(D70894) probable pra protein - Mycobacterium tuberculosis   (strain H37RV) &MTV017_30(AL021897|pid:g2896715) 	DPlate 052	F08			AU030755	AU095134			13	L16
5789	g_5789	EG0693		DPlate 050	G08			AU030155	AU030156			13	M16
5790	g_5790	EH0121	">ATAC005395_22(AC005395|pid:g3643607) Arabidopsis thaliana   chromosome II BAC F17H15 genomic sequence, complete   sequence; unknown protein. "	DPlate 052	G08			AU162312	AU030694			13	N16
5791	g_5791	EG0606		DPlate 050	H08			AU030081	AU030082			13	O16
5792	g_5792	EH0145	">SPAC31G5_12(Z98979|pid:g2388963) S.pombe chromosome I cosmid c31G5;   SPAC31G5.12c, len:150aa; similarity: to a region of   YDR005C, MAF1_YEAST, P41910, required for sorting of   Mod5p, (395aa), fasta scores, opt:295, E():1.7e-14,   (42.5% identity in 106 aa overlap). "	DPlate 052	H08			AU162315	AU030720			13	P16
5793	g_5793	EH0729	">ATU43487_1(U43487|pid:g1244756) Arabidopsis thaliana xyloglucan   endotransglycosylase-related protein (XTR2) mRNA,   complete cds. &D63510_1(D63510|pid:g2154611)   &S71224(S71224) "	DPlate 054	A02			AU075452	AU031071			14	A04
5794	g_5794	EH1469		DPlate 056	A02			AU173048	AU173049			14	B04
5795	g_5795	EH0785	>OSRAPB_1(Y10905|pid:g2826786) Oryza sativa mRNA RAPB protein. 	DPlate 054	B02			AU075493	AU031094			14	C04
5796	g_5796	EH1477	>TACATHBG_1(X66013|pid:g21699) T.aestivum gene for cathepsin B   (Al16). 	DPlate 056	B02			AU173050				14	D04
5797	g_5797	EH0722	>ATY13649_1(Y13649|pid:g2959732) Arabidopsis thaliana mRNA for GATA   transcription factor 2. 	DPlate 054	C02			AU065218	AU075447			14	E04
5798	g_5798	EH1454	">AE000838_5(AE000838|pid:g2621630) Methanobacterium   thermoautotrophicum from bases 494834 to 505698 (section   44 of 148) of the complete genome; Function Code:14.01 -   Unknown, Conserved protein; similar to, pir:LN:D64388   AC:D64388, p()=5.9E-45, pid=47%. &C69173(C69173) "	DPlate 056	C02			C74969				14	F04
5799	g_5799	EH0778	">ATAC003096_3(AC003096|pid:g3132470) Arabidopsis thaliana chromosome   II BAC T29F13 genomic sequence, complete sequence;   unknown protein. "	DPlate 054	D02			AU075491	AU031091			14	G04
5800	g_5800	EH1462		DPlate 056	D02			AU031385				14	H04
5801	g_5801	EH0707	>(P31924) SUCROSE SYNTHASE 2 (EC 2.4.1.13) (SUCROSE-UDP   GLUCOSYLTRANSFERASE 2). &ORRSS2_1(X59046|pid:g20095) 	DPlate 054	E02			AU065217	AU075436			14	I04
5802	g_5802	EH1478		DPlate 056	E02			AU031395				14	J04
5803	g_5803	EH0755	">YUP8H12_20(AC000098|pid:g2388578) Arabidopsis thaliana chromosome 1   YAC yUP8H12 complete sequence; Similar to Mycobacterium   RlpF (gb|Z84395). ESTs gb|T75785,gb|R30580,gb|T04698   come from this gene.. "	DPlate 054	F02			AU075470	AU031084			14	K04
5804	g_5804	EH1486		DPlate 056	F02			AU162353	AU031398			14	L04
5805	g_5805	EH0763	>HVXYLISOP_1(X95257|pid:g1296809) H.vulgare mRNA for xylose   isomerase. 	DPlate 054	G02			AU173018	AU173019			14	M04
5806	g_5806	EH1439	">ATAC004705_3(AC004705|pid:g3252807) Arabidopsis thaliana chromosome   II BAC F26C24 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 056	G02			AU162351	AU031374			14	N04
5807	g_5807	EH0787		DPlate 054	H02			AU176495				14	O04
5808	g_5808	EH1495		DPlate 056	H02			C74976				14	P04
5809	g_5809	EH0848	>OSR40G3_1(Y08988|pid:g1658315) O.sativa osr40g3 gene. 	DPlate 054	A08			AU065231	AU101508			14	A16
5810	g_5810	EH1607	>(P48608) DIAPHANOUS PROTEIN. &DMU11288_1(U11288|pid:g575927) 	DPlate 056	A08			AU101553	AU101554			14	B16
5811	g_5811	EH0856		DPlate 054	B08			AU065233	AU101511			14	C16
5812	g_5812	EH1647	">ATF22I13_17(AL035539|pid:g4539348) Arabidopsis thaliana DNA   chromosome 4, BAC clone F22I13 (ESSA project); strong   similarity to pollen allergen - Pinu. "	DPlate 056	B08							14	D16
5813	g_5813	EH0872		DPlate 054	C08			AU065239	AU101520			14	E16
5814	g_5814	EH1671	>(P01056) BOWMAN-BIRK TYPE PROTEINASE INHIBITOR. &TILI(A01295) 	DPlate 056	C08			AU101563	AU101564			14	F16
5815	g_5815	EH0880	">JC2069(JC2069)zinc-finger protein, BR140 - human "	DPlate 054	D08			AU065243	AU165950			14	G16
5816	g_5816	EH1679	">ATAC002521_7(AC002521|pid:g2947062) Arabidopsis thaliana chromosome   II BAC T20F6 genomic sequence, complete sequence;   unknown protein. "	DPlate 056	D08			AU101568	AU101569			14	H16
5817	g_5817	EH0933	">ATAC007069_8(AC007069|pid:g4522012) Arabidopsis thaliana chromosome   II BAC T23K3 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 054	E08			AU162330				14	I16
5818	g_5818	EH1656	">AF028725_1(AF028725|pid:g2565423) Mus musculus interferon   regulatory factor 5 (mirf5) mRNA, complete cds. "	DPlate 056	E08			AU101560				14	J16
5819	g_5819	EH0941	">D89902_1(D89902|pid:g2130977) Mus musculus mRNA for high-glycine   tyrosine keratin type II.4, complete cds. "	DPlate 054	F08			AU065265	AU095256			14	K16
5820	g_5820	EH1709		DPlate 056	F08			AU101574				14	L16
5821	g_5821	EH0957	">AF093420_1(AF093420|pid:g3928869) Homo sapiens Hsp70 binding   protein HspBP1 mRNA, complete cds. "	DPlate 054	G08			AU164717	AU031133			14	M16
5822	g_5822	EH1725	>(P27743) DELTA-(L-ALPHA-AMINOADIPYL)-L-CYSTEINYL-D-VALINE SYNTHETASE   (EC 6.-.-.-) (ACV SYNTHETASE) (ACVS).   &NLPCBABC_1(X57310|pid:g45006)   &S18268(S18268;S15283;B38171) 	DPlate 056	G08			AU162366	AU031490			14	N16
5823	g_5823	EH0965	">ATAC006569_3(AC006569|pid:g4512693) Arabidopsis thaliana chromosome   II BAC F11A3 genomic sequence, complete sequence;   &ATSCLBS_1(AJ001808|pid:g3660469) "	DPlate 054	H08			AU065269	AU164718			14	O16
5824	g_5824	EH1733		DPlate 056	H08			AU031495	AU101577			14	P16
5825	g_5825	FE0168		DPlate 058	A02			AU174647	AU174646			15	A04
5826	g_5826	FL0072		DPlate 060	A02			AU174939	AU174938			15	B04
5827	g_5827	FE0184	">ATAC006931_2(AC006931|pid:g4512658) Arabidopsis thaliana chromosome   II BAC F7D19 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 058	B02			AU174662				15	C04
5828	g_5828	FL0088	">ATAC004561_44(AC004561|pid:g3980417) Arabidopsis thaliana chromosome   II BAC F16P2 genomic sequence, complete sequence; "	DPlate 060	B02			AU174960	AU174959			15	D04
5829	g_5829	FE0192	">(P50433) SERINE HYDROXYMETHYLTRANSFERASE, MITOCHONDRIAL PRECURSOR   (EC 2.1.2.1) (SERINE METHYLASE) (GLYCINE   HYDROXYMETHYLTRANSFERASE) (SHMT). &S40218(S40218)   &STGHMT_1(Z25863|pid:g438247) "	DPlate 058	C02			AU174673	AU174672			15	E04
5830	g_5830	FL0096		DPlate 060	C02			AU174965	AU174964			15	F04
5831	g_5831	FE0153		DPlate 058	D02			AU174635	AU174634			15	G04
5832	g_5832	FL0117		DPlate 060	D02			AU174975	AU174974			15	H04
5833	g_5833	FE0169	>ATU95973_11(U95973|pid:g2252631) Arabidopsis thaliana BAC T19D16   genomic sequence; hypothetical protein. 	DPlate 058	E02			AU174649	AU174648			15	I04
5834	g_5834	FL0125		DPlate 060	E02			AU174986	AU174985			15	J04
5835	g_5835	FE0185	">CRU31975_1(U31975|pid:g1353352) Chlamydomonas reinhardtii alanine   aminotransferase mRNA, complete cds; The translation   start site has not been experimentally tested, but a 55   kDa product can be detected in Western blot. "	DPlate 058	F02			AU174663	AU174664			15	K04
5836	g_5836	FL0141		DPlate 060	F02			AU174994				15	L04
5837	g_5837	FE0122	>(Q62785) 28 KD HEAT- AND ACID-STABLE PHOSPHOPROTEIN (HASPP28) (PDGF   ASSOCIATED PROTEIN). &RNU26541_1(U26541|pid:g847785)   &S62782(S62782;S62776) 	DPlate 058	G02			AU174616	AU174615			15	M04
5838	g_5838	FL0165	">ATAC006200_4(AC006200|pid:g4262224) Arabidopsis thaliana chromosome   II BAC F10A8 genomic sequence, complete sequence. "	DPlate 060	G02			AU175012	AU175011			15	N04
5839	g_5839	FE0130	">AF044489_1(AF044489|pid:g2832304) Oryza sativa receptor-like   protein kinase (drpk1) mRNA, partial cds. "	DPlate 058	H02			AU174623	AU174622			15	O04
5840	g_5840	FL0173	">AF035456_1(AF035456|pid:g2654208) Spinacia oleracea heat shock 70   protein (HSC70-9) mRNA, nuclear gene encoding   chloroplast protein, complete cds; chloroplast protein.    &AF039083_1(AF039083|pid:g2773050) "	DPlate 060	H02			AU175026				15	P04
5841	g_5841	FE0253	>(P48134) CYANELLE 30S RIBOSOMAL PROTEIN S6.   &CPU30821_129(U30821|pid:g1016212) 	DPlate 058	A08			AU174714	AU174713			15	A16
5842	g_5842	FL0188	">ATT19P19_12(AL022605|pid:g3080442) Arabidopsis thaliana DNA   chromosome 4, BAC clone T19P19 (ESSAII project);   contains EST gb:Z26779, T75611, Z33718, T46761. "	DPlate 060	A08			AU175040	AU175039			15	B16
5843	g_5843	FE0269		DPlate 058	B08			AU174726	AU174725			15	C16
5844	g_5844	RA0017		DPlate 060	B08			D23730	AU101591			15	D16
5845	g_5845	FE0277		DPlate 058	C08			AU174729				15	E16
5846	g_5846	RA0041		DPlate 060	C08			D23737	AU031629			15	F16
5847	g_5847	FE0285	">(Q42676) TRANSKETOLASE, CHLOROPLAST (EC 2.2.1.1) (TK) (FRAGMENT).   &CPTKT3_1(Z46646|pid:g664901) &S54300(S54300) "	DPlate 058	D08			AU174734	AU174733			15	G16
5848	g_5848	RA0057	>(P30171) ACTIN 97. &S20098(S20098) &STPOAC97_1(X55751|pid:g21544) 	DPlate 060	D08			D23746	AU164488			15	H16
5849	g_5849	FE0214	">ZMU43082_1(U43082|pid:g1421730) Zea mays T cytoplasm male sterility   restorer factor 2 (rf2) mRNA, complete cds; restorer   factor 2; Allele: Rf2+B73; putative aldehyde   dehydrogenase; T cytoplasm male sterility. "	DPlate 058	E08			AU174691	AU174690			15	I16
5850	g_5850	RA0010	">RICRCC2_1(L27209|pid:g786130) Oryza sativa root-specific RCc2 mRNA,   complete cds. &RICRCG2_1(L27210|pid:g786134)   &S53011(S53011) "	DPlate 060	E08			AU075821	AU075822			15	J16
5851	g_5851	FE0222		DPlate 058	F08			AU174694				15	K16
5852	g_5852	RA0026	">ATAC004138_10(AC004138|pid:g3461820) Arabidopsis thaliana   chromosome II BAC T17M13 genomic sequence, complete   sequence; unknown protein. "	DPlate 060	F08			D23733	AU031627			15	L16
5853	g_5853	FE0246	>A58801(A58801)mannose-specific lectin KM+ - Artocarpus integrifolia   	DPlate 058	G08			AU174708				15	M16
5854	g_5854	RA0082		DPlate 060	G08			D38978	AU101593			15	N16
5855	g_5855	FE0294		DPlate 058	H08			AU174741				15	O16
5856	g_5856	RA0090	">MMMHC29N7_13(AF030001|pid:g2564958) Mus musculus major   histocompatibility locus class III   region:butyrophilin-like protein gene, partial cds;   Notch4, PBX2, RAGE, lysophatidic acid acyl   transferase-alpha, palmitoyl-protein thioesterase 2   (PPT2), CREB-RP, and tenascin X (TNX) genes, complete   cds; and CYP21OHB pseudogene, complete sequence;   Intron-exon boundaries defined in relation to a bovine   cDNA found in Y11915 for exons 1-16. Exons 17-27 were   defined by GENSCAN. Exons 28-41 were defined in   relation to a mouse cDNA found in X73959. GENSCAN   predicts an exon between bases 1556236-156961 that is   not in the bovine cDNA. This exon has similarity to   chicken Tenascin Y by BLAST X.. "	DPlate 060	H08			D23763	AU031639			15	P16
5857	g_5857	RA0651	">AC002291_2(AC002291|pid:g2829924) Arabidopsis thaliana chromosome I   BAC F22K20 genomic sequence, complete sequence; Unknown   protein; Location of EST gb|AA394987. "	DPlate 062	A02			AU102207	AU102208			16	A04
5858	g_5858	RA1570	">ATAC004747_11(AC004747|pid:g3413706) Arabidopsis thaliana   chromosome II BAC T19L18 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 064	A02			D24241				16	B04
5859	g_5859	RA0628	">OSMYB1202_1(Y11414|pid:g1946265) O.sativa mRNA for myb factor, 1202   bp. "	DPlate 062	B02			AU082155	AU082156			16	C04
5860	g_5860	RA1586	>AE001048_5(AE001048|pid:g2649798) Archaeoglobus fulgidus section 59   of 172 of the complete genome; similar to GB:L77117   PID:1591676 percent identity: 48.77; identified by   sequence similarity; putative. &E69351(E69351) 	DPlate 064	B02			D24254	AU173174			16	D04
5861	g_5861	RA0660		DPlate 062	C02			AU065340				16	E04
5862	g_5862	RA1507	">AF057183_1(AF057183|pid:g3264596) Zea mays putative tonoplast   aquaporin mRNA, complete cds; hypoxically induced   transcript 1 (HIT1); induced by submergence, hypoxia,   mechanical impedence, and 40% O2 conditions. "	DPlate 064	C02			AU173162	AU173163			16	F04
5863	g_5863	RA0621		DPlate 062	D02			AU176503				16	G04
5864	g_5864	RA1547	">AB009398_1(AB009398|pid:g3618343) Homo sapiens mRNA for 26S   proteasome subunit p40.5, complete cds. "	DPlate 064	D02			D24224	AU031759			16	H04
5865	g_5865	RA0629	">ATAC007017_13(AC007017|pid:g4510373) Arabidopsis thaliana   chromosome II BAC F11F19 genomic sequence, complete   sequence; "	DPlate 062	E02			AU164588	AU164587			16	I04
5866	g_5866	RA1555	>(P54873) HYDROXYMETHYLGLUTARYL-COA SYNTHASE (EC 4.1.3.5) (HMG-COA   SYNTHASE) (3-HYDROXY-3-METHYLGLUTARYL COENZYME A   SYNTHASE). &ATHMGS_1(X83882|pid:g1143390)   &JC4567(JC4567) 	DPlate 064	E02			D24229	AU176519			16	J04
5867	g_5867	RA0645	>HVSERP_1(X97636|pid:g1310677) H.vulgare mRNA for serpin; reactive   site experimental. 	DPlate 062	F02			D23950	AU164594			16	K04
5868	g_5868	RA1524	>S63445(S63445;S66822;S71983) hypothetical protein YOL125w - yeast   (Saccharomyces cerevisiae)   &SCU41293_6(U41293|pid:g1209716)   &SCYOL125W_1(Z74867|pid:g1420007) 	DPlate 064	F02			D24205	AU173167			16	L04
5869	g_5869	RA0653	">T12M4_16(AC003114|pid:g3249106) Arabidopsis thaliana chromosome 1   BAC T12M4 sequence, complete sequence; "	DPlate 062	G02			D23955	AU164596			16	M04
5870	g_5870	RA1556	>(P36011) CELL PATTERN FORMATION-ASSOCIATED PROTEIN.   &A44068(A44068;S27413) &EMESTUA_1(M83569|pid:g168096) 	DPlate 064	G02			D24230	AU031762			16	N04
5871	g_5871	RA0685		DPlate 062	H02			D23968	AU031706			16	O04
5872	g_5872	RA1596		DPlate 064	H02			AU181012				16	P04
5873	g_5873	RA0740	>A70793(A70793) probable glycerol kinase - Mycobacterium   tuberculosis (strain H37RV)   &MTV025_45(AL022121|pid:g2960120) 	DPlate 062	A08			D23993	AU031715			16	A16
5874	g_5874	RA1766	">ATU18409_1(U18409|pid:g972917) Arabidopsis thaliana IAA7 (IAA7)   gene, complete cds; member of a multigene family of   primary auxin-responsive genes; homologous gene products   from pea are short-lived nuclear proteins.   &S58494(S58494) "	DPlate 064	A08			D24347	AU173219			16	B16
5875	g_5875	RA0748		DPlate 062	B08			D23995	AU162388			16	C16
5876	g_5876	RA1774	">AF015811_1(AF015811|pid:g2317725) Mus musculus putative   lysophosphatidic acid acyltransferase mRNA, complete   cds. "	DPlate 064	B08			AU173225	AU173226			16	D16
5877	g_5877	RA0835		DPlate 062	C08			D24008	AU082159			16	E16
5878	g_5878	RA1782	">AB010945_1(AB010945|pid:g2865175) Arabidopsis thaliana mRNA for   AtRer1A, complete cds. "	DPlate 064	C08			D24358	AU031793			16	F16
5879	g_5879	RA0851	">AF071527_14(AF071527|pid:g4206197) Arabidopsis thaliana BAC F9H3,   from chromosome IV near 18.8 cM, complete sequence;   similar to yeast pre-mRNA splicing factors; functional   catalog ID=04.05.03. "	DPlate 062	D08			D39035	AU081577			16	G16
5880	g_5880	RA1711		DPlate 064	D08			D24309	AU173209			16	H16
5881	g_5881	RA0859	">F20D22_15(AC002411|pid:g3142296) Arabidopsis thaliana chromosome 1   BAC F20D22 sequence, complete sequence; Contains   similarity to hypothetical mitochondrial import receptor   subunit gb|Z98597 from S. pombe. ESTs gb|T45575 and   gb|Z26435 and gb|AA394576 come from this gene.. "	DPlate 062	E08			D24014	AU164638			16	I16
5882	g_5882	RA1727	>ATPI4KG_1(AJ002685|pid:g4467359) Arabidopsis thaliana mRNA for   Phosphatidylinositol 4-Kinase. 	DPlate 064	E08			D24320	AU173211			16	J16
5883	g_5883	RA0868		DPlate 062	F08			AU176505				16	K16
5884	g_5884	RA1743	">AF026917_1(AF026917|pid:g3650466) Zea mays histone deacetylase   HD2-p39 (HD2) gene, complete cds; nucleolar   phosphoprotein. &ZMU82815_1(U82815|pid:g2257756) "	DPlate 064	F08			D39074	AU173215			16	L16
5885	g_5885	RA0821	>(P33297) PROBABLE 26S PROTEASE SUBUNIT TBP-1 (TAT-BINDING PROTEIN   HOMOLOG 1).   &S46605(S46605;S60993;S61675;S67002;S63870;S34352)   &SC130KBXV_34(X94335|pid:g1164962)   &SCXVORFS_8(X90518|pid:g1050819)   &SCYOR117W_1(Z75025|pid:g1420311)   &SCYTA1A_1(X73569|pid:g313878) 	DPlate 062	G08			D24003	AU164630			16	M16
5886	g_5886	RA1751	">OSU63530_1(U63530|pid:g1488297) Oryza sativa osRAD23 mRNA, complete   cds; RAD23 homolog. "	DPlate 064	G08			D24336	AU162419			16	N16
5887	g_5887	RA0806		DPlate 062	H08			D39027	AU162390			16	O16
5888	g_5888	RA1767	">ATAC006284_6(AC006284|pid:g4335750) Arabidopsis thaliana chromosome   II BAC T4M8 genomic sequence, complete sequence; "	DPlate 064	H08			AU173220				16	P16
5889	g_5889	RA2182	">AB014518_1(AB014518|pid:g3327050) Homo sapiens mRNA for KIAA0618   protein, complete cds. "	DPlate 066	A02			D24569	AU173326			17	A04
5890	g_5890	RA3017	">AF047444_1(AF047444|pid:g4105561) Oryza sativa   ribulose-5-phosphate-3-epimerase (RPE) mRNA, complete   cds. "	DPlate 068	A02			D39200	AU031979			17	B04
5891	g_5891	RA2190		DPlate 066	B02			AU173328				17	C04
5892	g_5892	RA3033	">ATT5L19_13(AL049481|pid:g4539003) Arabidopsis thaliana DNA   chromosome 4, BAC clone T5L19 (ESSA project); contains   EST gb:Aa394790, R30123. "	DPlate 068	B02			AU173424	AU173425			17	D04
5893	g_5893	RA2127	">AF033538_1(AF033538|pid:g4104220) Lolium perenne caffeic acid   O-methyltransferase (OMT1) mRNA, complete cds; LPOMT1. "	DPlate 066	C02			AU173313	AU173314			17	E04
5894	g_5894	RA3041	">LEAJ2298_1(AJ002298|pid:g2578365) Lycopersicon esculentum mRNA for   GTP cyclohydrolase II/3,4-dihydroxy-2-butanone   4-phosphate synthase. "	DPlate 068	C02			D39211	AU031986			17	F04
5895	g_5895	RA2128	>(P04707) ALCOHOL DEHYDROGENASE 2 (EC 1.1.1.1). &A23084(A23084)   &ZMADH2NR_1(X01965|pid:g22137) 	DPlate 066	D02			AU173315	AU173316			17	G04
5896	g_5896	RA3073		DPlate 068	D02			D39231	AU173431			17	H04
5897	g_5897	RA2136	">ATAC002339_6(AC002339|pid:g2335095) Arabidopsis thaliana chromosome   II BAC T11A7 genomic sequence, complete sequence; "	DPlate 066	E02			D24538	AU173317			17	I04
5898	g_5898	RA3089	>(Q07661) NUCLEOSIDE DIPHOSPHATE KINASE I (EC 2.7.4.6) (NDK I) (NDP   KINASE I). &RICNDKR_1(D16292|pid:g303849)   &S43330(S43330) 	DPlate 068	E02			D25065	AU031998			17	J04
5899	g_5899	RA2144	">ATAC004521_22(AC004521|pid:g3128184) Arabidopsis thaliana   chromosome II BAC F4I1 genomic sequence, complete   sequence; unknown protein. "	DPlate 066	F02			D24544	AU173318			17	K04
5900	g_5900	RA3026	">AF047001_1(AF047001|pid:g4204413) Oenococcus oeni temperate   bacteriophage fOg44 Lys44 and Int44 genes, complete cds;   and unknown genes; similar to phage encoded lysins. "	DPlate 068	F02			AU173421	AU173422			17	L04
5901	g_5901	RA2152	>A39659_1(A39659|pid:g2295932) Sequence 1 from Patent EP0612848;   unnamed protein product.   &NTHSR203_1(X77136|pid:g444002) &S42807(S42807) 	DPlate 066	G02			D24551	AU173319			17	M04
5902	g_5902	RA3074	>LELEUZIP_1(Z12127|pid:g19275) L.esculentum mRNA for protein with   leucine zipper; protein of unknown function.   &S21495(S21495) 	DPlate 068	G02			D39232	AU031993			17	N04
5903	g_5903	RA2168	">AB010918_1(AB010918|pid:g3273202) Arabidopsis thaliana mRNA for   responce reactor4, complete cds. "	DPlate 066	H02			D24560	AU173322			17	O04
5904	g_5904	RA3082	">T13D8_6(AC004473|pid:g3249066) Arabidopsis thaliana chromosome 1   BAC T13D8, complete sequence; Similar to S. cerevisiae   SIK1P protein gb|984964. ESTs gb|F15433 and gb|AA395158   come from this gene.. "	DPlate 068	H02			D39238	AU173435			17	P04
5905	g_5905	RA2278	">ATAC004450_17(AC004450|pid:g3763932) Arabidopsis thaliana   chromosome II BAC F14B2 genomic sequence, complete   sequence; "	DPlate 066	A08			D24627	C22590			17	A16
5906	g_5906	RA3152		DPlate 068	A08			AU173443	AU173444			17	B16
5907	g_5907	RA2239	">OSU72255_1(U72255|pid:g4097948) Oryza sativa beta-1,3-glucanase   precursor (Gns9) gene, complete cds. "	DPlate 066	B08			D24604	AU162425			17	C16
5908	g_5908	RA3121	>S39045(S39045) probable finger protein WZF1 - wheat   &WHTWZF1A_1(D16415|pid:g485814)   &WHTWZF1B_1(D16416|pid:g485816) 	DPlate 068	B08			D25079				17	D16
5909	g_5909	RA2287	">ATAC002535_4(AC002535|pid:g3522929) Arabidopsis thaliana chromosome   II BAC T30B22 genomic sequence, complete sequence;   &ATAC005309_4(AC005309|pid:g3738279) "	DPlate 066	C08			D24635				17	E16
5910	g_5910	RA3137	">ATT29A15_18(AL035602|pid:g4469020) Arabidopsis thaliana DNA   chromosome 4, BAC clone T29A15 (ESSA project); strong   similarity to essential for embryogenesis protein H beta   58, Mus musculus, PIR2:B44882; contains EST gb:N65360,   Z37712. "	DPlate 068	C08			D25091	AU032012			17	F16
5911	g_5911	RA2224		DPlate 066	D08			D24593	AU162424			17	G16
5912	g_5912	RA3193	">ATU93215_4(U93215|pid:g1946358) Arabidopsis thaliana chromosome II   BAC T06B20 genomic sequence, complete sequence; unknown   protein. "	DPlate 068	D08			AU173456	AU173457			17	H16
5913	g_5913	RA2272	">AB001422_1(AB001422|pid:g1864003) Nicotiana tabacum mRNA for 21D7,   complete cds. "	DPlate 066	E08			D24625	AU031867			17	I16
5914	g_5914	RA3130	">ATAC005967_7(AC005967|pid:g4115377) Arabidopsis thaliana chromosome   II BAC F27D4 genomic sequence, complete sequence;   unknown protein. "	DPlate 068	E08			D25086	AU090571			17	J16
5915	g_5915	RA2280	>(P46611) S-ADENOSYLMETHIONINE SYNTHETASE (EC 2.5.1.6) (METHIONINE   ADENOSYLTRANSFERASE) (ADOMET SYNTHETASE).   &OSSAMS1_1(Z26867|pid:g450549) 	DPlate 066	F08			D24629	AU031868			17	K16
5916	g_5916	RA3154		DPlate 068	F08			D25100	AU173445			17	L16
5917	g_5917	RA2288	">AF030516_1(AF030516|pid:g4103987) Pisum sativum   5,10-methylenetetrahydrofolate   dehydrogenase-5,10-methenyltetrahydrofolate   cyclohydrolase mRNA, complete cds; bifunctional protein;   31.3 kDa protein. "	DPlate 066	G08			AU173341	AU173342			17	M16
5918	g_5918	RA3170	">ATAC002341_10(AC002341|pid:g2342727) Arabidopsis thaliana   chromosome II BAC T14G11 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 068	G08			AU173449	AU173450			17	N16
5919	g_5919	RA2325	">AF027173_1(AF027173|pid:g2827141) Arabidopsis thaliana cellulose   synthase catalytic subunit (Ath-A) mRNA, complete cds;   RSW1-like. "	DPlate 066	H08			D24655	AU101663			17	O16
5920	g_5920	RA3194	">AF016713_1(AF016713|pid:g4102839) Lycopersicon esculentum   oligopeptide transporter (LeOPT1) mRNA, complete cds;   oligopeptide transporter. "	DPlate 068	H08			AU173458	AU173459			17	P16
5921	g_5921	RA3668	">TOBNTRAF_1(L29273|pid:g623586) Nicotiana tabacum SR1 Nt-rab6 mRNA,   complete cds; putative. "	DPlate 070	A02			AU173528	AU173529			18	A04
5922	g_5922	RB0329		DPlate 072	A02			AU077754	AU077755			18	B04
5923	g_5923	RA3684		DPlate 070	B02			AU173533				18	C04
5924	g_5924	RB0337		DPlate 072	B02			AU070839	AU101696			18	D04
5925	g_5925	RA3613	>B70815(B70815) hypothetical protein Rv0858c - Mycobacterium   tuberculosis (strain H37RV)   &MTV043_50(AL022004|pid:g2916917) 	DPlate 070	C02			AU164691	AU032132			18	E04
5926	g_5926	RB0377	">TRBBEALTUB_2(M96849|pid:g1220548) Trypanosoma cruzi beta and alpha   tubulin genes, 3'end and complete cds.   &TRBBEALTU_2(M97956|pid:g1220545) "	DPlate 072	C02			AU070858	AU162591			18	F04
5927	g_5927	RA3637		DPlate 070	D02			AU162505	AU032154			18	G04
5928	g_5928	RB0393	>(P51286) CHLOROPLAST 30S RIBOSOMAL PROTEIN S10.   &PPU38804_100(U38804|pid:g1276752) &S73207(S73207) 	DPlate 072	D02			AU173850	AU173851			18	H04
5929	g_5929	RA3645	">ATU38916_1(U38916|pid:g1145627) Arabidopsis thaliana lipase mRNA,   complete cds. &S68410(S68410) "	DPlate 070	E02			AU075834	AU032163			18	I04
5930	g_5930	RB0306	">AF064732_1(AF064732|pid:g3769472) Dianthus caryophyllus clone   cfpi-3 putative phospholipase A2 mRNA, complete cds. "	DPlate 072	E02			AU070820	AU101694			18	J04
5931	g_5931	RA3661	">ATU89986_1(U89986|pid:g1890130) Arabidopsis thaliana valyl tRNA   synthetase (valRS) mRNA, complete cds. "	DPlate 070	F02			AU032176	AU032177			18	K04
5932	g_5932	RB0346	">ATAC002334_15(AC002334|pid:g2924781) Arabidopsis thaliana chromosome   II BAC F25I18 genomic sequence, complete sequence; "	DPlate 072	F02			AU078363	AU082165			18	L04
5933	g_5933	RA3677	">ATAC002340_4(AC002340|pid:g2880042) Arabidopsis thaliana chromosome   II BAC T11J7 genomic sequence, complete sequence; "	DPlate 070	G02			AU032193	AU173532			18	M04
5934	g_5934	RB0371	">ATAC002387_27(AC002387|pid:g2583132) Arabidopsis thaliana   chromosome II BAC F4L23 genomic sequence, complete   sequence; unknown protein. "	DPlate 072	G02			AU070854	AU163467			18	N04
5935	g_5935	RA3622	">BLYLOXC_1(L37358|pid:g2429087) Hordeum vulgare lipoxygenase 2 (LoxC)   mRNA, complete cds. "	DPlate 070	H02			AU173526	AU173527			18	O04
5936	g_5936	RB0387		DPlate 072	H02			AU070865				18	P04
5937	g_5937	RA3834	">HSDAN15_1(Y08266|pid:g1770392) H.sapiens mRNA for DAN15 protein,   partial. "	DPlate 070	A08			AU162534	AU032275			18	A16
5938	g_5938	RB0657	>(P39062) ACETYL-COENZYME A SYNTHETASE (EC 6.2.1.1) (ACETATE--COA   LIGASE) (ACYL- ACTIVATING ENZYME) (ACETYL-COA SYNTHASE).   &AF008220_124(AF008220|pid:g2293224)   &BACACUCBA_6(L17309|pid:g348053)   &BSUB0016_41(Z99119|pid:g2635452) &S39646(S39646;B69582)   	DPlate 072	A08			AU071052	AU101704			18	B16
5939	g_5939	RA3842	">SPCC790_3(AL031855|pid:g3738201) S.pombe chromosome III cosmid   c790; SPCC790.03, len:248, SIMILARITY:Saccharomyces   cerevisiae, YPL246C, Q12270, chromosome xvi reading   frame orf ypl246c, (262 aa), fasta scores: opt: 250,   E():2.7e-07, (27.0% identity in 211 aa). "	DPlate 070	B08			AU032282	AU032283			18	C16
5940	g_5940	RB0665		DPlate 072	B08			AU071059				18	D16
5941	g_5941	RA3866	">ATFCA3_29(Z97338|pid:g2244899) Arabidopsis thaliana DNA chromosome   4, ESSA I contig fragment No. 3; similar to UFD1   protein. &G71418(G71418) "	DPlate 070	C08			AU032306	AU032307			18	E16
5942	g_5942	RB0610	>(P52428) PROTEASOME COMPONENT C2 (EC 3.4.99.46) (MACROPAIN SUBUNIT   C2) (MULTICATALYTIC ENDOPEPTIDASE COMPLEX SUBUNIT C2).   &RICPC2SA_1(D37886|pid:g1066151) 	DPlate 072	C08			AU071013	AU101701			18	F16
5943	g_5943	RA3890	">CEZK856_9(Z70783|pid:g3881813) Caenorhabditis elegans cosmid ZK856,   complete sequence; "	DPlate 070	D08			AU070227	AU173814			18	G16
5944	g_5944	RB0626	>(Q39054) MOLYBDOPTERIN BIOSYNTHESIS CNX1 PROTEIN (MOLYBDENUM   COFACTOR BIOSYNTHESIS ENZYME CNX1).   &ATH236870_1(AJ236870|pid:g4469123)   &ATHCNX1R_1(L47323|pid:g1263314) 	DPlate 072	D08			AU071028				18	H16
5945	g_5945	RA3811	">AF022457_1(AF022457|pid:g2738996) Glycine max cytochrome P450   monooxygenase CYP97B2p (CYP97B2) mRNA, complete cds;   cytochrome P450 monooxygenase. "	DPlate 070	E08			AU173808	AU173809			18	I16
5946	g_5946	RB0634	">ATF10N7_21(AL021636|pid:g2827637) Arabidopsis thaliana DNA   chromosome 4, BAC clone (ESSA project); similarity to   EREBP-4 homolog, Arabidopsis thaliana. "	DPlate 072	E08			AU071035	AU163479			18	J16
5947	g_5947	RA3835	">AC002291_9(AC002291|pid:g2829923) Arabidopsis thaliana chromosome I   BAC F22K20 genomic sequence, complete sequence; Similar   to uridylyl transferases; Location of EST gb|T41877,   gb|H37063, and gb|R90512. "	DPlate 070	F08			AU162535	AU032276			18	K16
5948	g_5948	RB0658	>(P42791) 60S RIBOSOMAL PROTEIN L18.   &ATU15741_1(U15741|pid:g606970) 	DPlate 072	F08			AU071053	AU162616			18	L16
5949	g_5949	RA3843	">T2K10_1(AC005966|pid:g4249390) Arabidopsis thaliana chromosome 1   BAC T2K10 sequence, complete sequence; Similar to   gb|AF039182 probable aldo-keto reductase from Fragaria x   ananassa. This gene may be cut off. EST gb|U74151   comes from this gene.. "	DPlate 070	G08			AU173810	AU032284			18	M16
5950	g_5950	RB0666	>(P32617) HYPOTHETICAL 18.5 KD PROTEIN IN GLY1-GDA1 INTERGENIC   REGION. &S30833(S30833;S50500)   &SCE8199_10(U18779|pid:g603635) 	DPlate 072	G08			AU071060				18	N16
5951	g_5951	RA3820		DPlate 070	H08			AU162530	AU032259			18	O16
5952	g_5952	RB0603		DPlate 072	H08			AU071006				18	P16
5953	g_5953	SA0047	">OSAF001396_1(AF001396|pid:g2072555) Oryza sativa   metallothionein-like protein mRNA, complete cds. "	DPlate 074	A02			AU055773	AU055774			19	A04
5954	g_5954	SA0972		DPlate 078	A02			AU173933				19	B04
5955	g_5955	SA0063	">ATFCA1_4(Z97336|pid:g2244792) Arabidopsis thaliana DNA chromosome   4, ESSA I contig fragment No. 1; similarity to ankyrin   2, long form - human. &E71405(E71405) "	DPlate 074	B02			AU055803	AU055804			19	C04
5956	g_5956	SA0980	">ATF6I18_20(AL022198|pid:g2980777) Arabidopsis thaliana DNA   chromosome 4, BAC clone F6I18 (ESSAII project);   similarity to ubiquitin carboxyl-terminal hydrolase, Mus   musculus, PATCHX:D1012895. "	DPlate 078	B02			AU056919	AU056920			19	D04
5957	g_5957	SA0071	">AF043347_1(AF043347|pid:g4105125) Zea mays cell wall invertase   (incw4) gene, complete cds; beta-fructosidase; Incw4. "	DPlate 074	C02			AU055812	AU055813			19	E04
5958	g_5958	SA0996	">RICWSI76_1(D26537|pid:g537404) Rice mRNA for WSI76 protein induced   by water stress, complete cds. "	DPlate 078	C02			AU173938	AU173939			19	F04
5959	g_5959	SA0079	">AC005106_5(AC005106|pid:g3935141) Genomic sequence for Arabidopsis   thaliana BAC T25N20, complete sequence; similar to RNA   polymerase II elongation factor homolog (S59773). "	DPlate 074	D02			AU055822	AU055823			19	G04
5960	g_5960	SA1001		DPlate 078	D02			AU056936				19	H04
5961	g_5961	SA0087		DPlate 074	E02			AU055836	AU055837			19	I04
5962	g_5962	SA1057	">ATAC005397_26(AC005397|pid:g3702339) Arabidopsis thaliana   chromosome II BAC T3F17 genomic sequence, complete   sequence; unknown protein. "	DPlate 078	E02			AU057003				19	J04
5963	g_5963	SA0095		DPlate 074	F02			AU055851	AU055852			19	K04
5964	g_5964	SA1081	">AF039000_1(AF039000|pid:g2754849) Fritillaria agrestis putative   serine-glyoxylate aminotransferase (SGA) mRNA, complete   cds. "	DPlate 078	F02			AU057034	AU101718			19	L04
5965	g_5965	SA0008	">ATAC002510_6(AC002510|pid:g2618689) Arabidopsis thaliana chromosome   II BAC T32G6 genomic sequence, complete sequence;   unknown protein. "	DPlate 074	G02			AU055706	AU055707			19	M04
5966	g_5966	SA1002	">ATAC002510_4(AC002510|pid:g2618687) Arabidopsis thaliana chromosome   II BAC T32G6 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 078	G02			AU056937	AU056938			19	N04
5967	g_5967	SA0048	">ATT4L20_6(AL023094|pid:g3641838) Arabidopsis thaliana DNA   chromosome 4, BAC clone T4L20 (ESSAII project); contains   EST gb:R30196. "	DPlate 074	H02			AU055775	AU055776			19	O04
5968	g_5968	SA1090		DPlate 078	H02			AU057046	AU057047			19	P04
5969	g_5969	SA0146	>(P74457) URIDYLATE KINASE (EC 2.7.4.-) (UK) (URIDINE MONOPHOSPHATE   KINASE) (UMP KINASE). &D90915_42(D90915|pid:g1653646)   &S76429(S76429) 	DPlate 074	A08			AU082266	AU055914			19	A16
5970	g_5970	SA1144	">ATAC006234_4(AC006234|pid:g4454451) Arabidopsis thaliana chromosome   II BAC F5H14 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 078	A08			AU057096	AU057097			19	B16
5971	g_5971	SA0154	">AF023472_1(AF023472|pid:g2655098) Hordeum vulgare peptide   transporter (ptr1) mRNA, complete cds; PTR1; integral   membrane protein. "	DPlate 074	B08			AU055921	AU055922			19	C16
5972	g_5972	SA1152		DPlate 078	B08			AU057106				19	D16
5973	g_5973	SA0178		DPlate 074	C08			AU055956	AU055957			19	E16
5974	g_5974	SA1168	>CELF37C4_3(AF036705|pid:g2749982) Caenorhabditis elegans cosmid   F37C4; Similar to phytoene desaturase; coded for by C.   elegans cDNA CEESX74F; coded for by C. elegans cDNA   yk303f4.3; coded for by C. elegans cDNA yk257d4.3; coded   for by C. elegans cDNA yk303f4.5; coded for by C.   elegans cDNA yk257d4.5; coded for by C. elegans cDNA   cm3a12. 	DPlate 078	C08			AU057119	AU057120			19	F16
5975	g_5975	SA0107	">D90908_28(D90908|pid:g1652753) Synechocystis sp. PCC6803 complete   genome, 10/27, 1188886-1311234; ORF_ID:sll1770.   &S77114(S77114) "	DPlate 074	D08			AU055862	AU055863			19	G16
5976	g_5976	SA1192		DPlate 078	D08			AU057147				19	H16
5977	g_5977	SA0115		DPlate 074	E08			AU085986	AU055872			19	I16
5978	g_5978	SA1185		DPlate 078	E08			AU057137				19	J16
5979	g_5979	SA0131	">ATU80668_1(U80668|pid:g4098647) Arabidopsis thaliana homogentisate   1,2-dioxygenase mRNA, complete cds; dioxygenase. "	DPlate 074	F08			AU091710	AU055892			19	K16
5980	g_5980	SA1146		DPlate 078	F08			AU057100				19	L16
5981	g_5981	SA0139	>PDBF(1TGL) TRIACYLGLYCEROL ACYLHYDROLASE (E.C.3.1.1.3) 	DPlate 074	G08			AU055904	AU055905			19	M16
5982	g_5982	SA1154		DPlate 078	G08			AU057108				19	N16
5983	g_5983	SA0155	">ATAP22_34(Z99708|pid:g4006910) Arabidopsis thaliana DNA chromosome   4, ESSA I AP2 contig fragment No. 2; similar to   hypothetical protein, Synechocystis sp., PIR2:S77419. "	DPlate 074	H08			AU055923	AU055924			19	O16
5984	g_5984	SA1178	">AB005290_1(AB005290|pid:g2780746) Oryza sativa mRNA for plastid RNA   polymerase sigma factor, complete cds; putative. "	DPlate 078	H08			AU057130	AU057131			19	P16
5985	g_5985	SA0722		DPlate 077	A02			AU056600				20	A04
5986	g_5986	SA1637	">AF020787_1(AF020787|pid:g2511541) Oryza sativa DNA-binding protein   GBP16 (Rgbp16) mRNA, complete cds. "	DPlate 080	A02			AU057638				20	B04
5987	g_5987	SA0738		DPlate 077	B02			AU056623	AU056624			20	C04
5988	g_5988	SA1661		DPlate 080	B02			AU075864	AU075865			20	D04
5989	g_5989	SA0746		DPlate 077	C02			AU056634				20	E04
5990	g_5990	SA1669	">F9K20_25(AC005679|pid:g3834323) Arabidopsis thaliana chromosome 1   BAC F9K20 sequence, complete sequence; "	DPlate 080	C02			AU057671	AU057672			20	F04
5991	g_5991	SA0762		DPlate 077	D02			AU181021				20	G04
5992	g_5992	SA1694	>S53521(S53521) histone H2A.4 - wheat   &WHTPH2AC_1(D38089|pid:g536892)   &WHTPH2AE_1(D38091|pid:g536896) 	DPlate 080	D02			AU082124	AU082125			20	H04
5993	g_5993	SA0770		DPlate 077	E02			AU056666				20	I04
5994	g_5994	SA1631	>BVRAB2_1(Z49190|pid:g974778) B.vulgaris mRNA for small G protein   (clone 1S2). 	DPlate 080	E02			AU057630	AU057631			20	J04
5995	g_5995	SA0786	>E70824(E70824) hypothetical glycine-rich protein Rv0746 -   Mycobacterium tuberculosis (strain H37RV)   &MTV041_18(AL021958|pid:g2911020) 	DPlate 077	F02			AU173916	AU173917			20	K04
5996	g_5996	SA1639	>(P51338) CHLOROPLAST 50S RIBOSOMAL PROTEIN L1.   &PPU38804_152(U38804|pid:g1276804) &S73259(S73259) 	DPlate 080	F02			AU057639				20	L04
5997	g_5997	SA0715	">ATFCA6_29(Z97341|pid:g2245020) Arabidopsis thaliana DNA chromosome   4, ESSA I contig fragment No. 6; similarity to   auxin-independent growth promoter - Nicotiana tabacum.   &F71433(F71433) "	DPlate 077	G02			AU056590	AU056591			20	M04
5998	g_5998	SA1671		DPlate 080	G02			AU057674				20	N04
5999	g_5999	SA0739	">AB008845_1(AB008845|pid:g4008156) Oryza sativa mRNA for NADH   dependent Glutamate Synthase, complete cds. "	DPlate 077	H02			AU056625	AU056626			20	O04
6000	g_6000	SA1679		DPlate 080	H02			AU057683	AU057684			20	P04
6001	g_6001	SA0816	>(P49249) IN2-2 PROTEIN. 	DPlate 077	A08			AU056711	AU056712			20	A16
6002	g_6002	SA1818	>(Q40635) VACUOLAR ATP SYNTHASE 16 KD PROTEOLIPID SUBUNIT (EC   3.6.1.34). &OSU27098_1(U27098|pid:g857574) 	DPlate 080	A08			AU057817	AU057818			20	B16
6003	g_6003	SA0832	>S30167(S30167)protochlorophyllide reductase (EC 1.3.1.33) precursor   - loblolly pine 	DPlate 077	B08			AU056729	AU056730			20	C16
6004	g_6004	SA1826		DPlate 080	B08			AU057829				20	D16
6005	g_6005	SA0848		DPlate 077	C08			AU056754				20	E16
6006	g_6006	SA1842	>S29851(S29851;S27760) protein kinase 6 (EC 2.7.1.-) - soybean   &SOYPROKIN_1(M67449|pid:g170047) 	DPlate 080	C08			AU057849	AU057850			20	F16
6007	g_6007	SA0864	">D90904_102(D90904|pid:g1652327) Synechocystis sp. PCC6803 complete   genome, 6/27, 630555-781448; ORF_ID:sll1925.   &S75336(S75336) "	DPlate 077	D08			AU162718	AU056774			20	G16
6008	g_6008	SA1866	">SPCC1020_11(AL023518|pid:g3130054) S.pombe chromosome III cosmid   c1020; SPCC1020.11c, unknown; questionable orf,   len:102aa. "	DPlate 080	D08			AU057876	AU057877			20	H16
6009	g_6009	SA0872		DPlate 077	E08			AU056782	AU056783			20	I16
6010	g_6010	SA1843	>A38800_1(A38800|pid:g2295233) Sequence 16 from Patent WO9413790;   unnamed protein product. 	DPlate 080	E08			AU057851	AU162784			20	J16
6011	g_6011	SA0896	">D45066_1(D45066|pid:g1669341) Cucurbita maxima mRNA for AOBP   (ascorbate oxidase promoter-binding protein), complete   cds; Pumpkin cDNA for protein that binds to AT-rich   direct repeat sequence of pumpkin ascorbate oxidase   promoter.. "	DPlate 077	F08			AU181022				20	K16
6012	g_6012	SA1859		DPlate 080	F08			AU057868				20	L16
6013	g_6013	SA0909	">ATAC005315_12(AC005315|pid:g3461846) Arabidopsis thaliana   chromosome II BAC T9I4 genomic sequence, complete   sequence; "	DPlate 077	G08			AU056823	AU056824			20	M16
6014	g_6014	SA1828	">RRU70825_1(U70825|pid:g1732065) Rattus norvegicus 5-oxo-L-prolinase   mRNA, complete cds; oxoprolinase. "	DPlate 080	G08			AU057831				20	N16
6015	g_6015	SA0917	">ATF6H11_13(AL021684|pid:g2827711) Arabidopsis thaliana DNA chromosome   5, BAC clone F6H11 (ESSAII project); similarity to   oxoglutarate dehydrogenase precursor, Saccharomyces   cerevisiae, PIR1:DEBY. "	DPlate 077	H08			AU056835	AU056836			20	O16
6016	g_6016	SA1852	>ATAJ10735_1(AJ010735|pid:g3559811) Arabidopsis thaliana gr1 gene;   tagged gene in a mutant susceptible to Peronospora. 	DPlate 080	H08			AU057861				20	P16
6017	g_6017	SS2688		DPlate 082	A02			D47362	AU070358			21	A04
6018	g_6018	SS5125	">SPBC215_13(AL033534|pid:g3873550) S.pombe chromosome II cosmid   c215; SPBC215.13, len:534, SIMILARITY:Mus musculus,   O70567, dentin sialophosphoprotein precursor., (932 aa),   fasta scores: opt: 694, E():8e-27, (41.8% identity in   457 aa). "	DPlate 084	A02			D48735	AU174075			21	B04
6019	g_6019	SS3101		DPlate 082	B02			D47533				21	C04
6020	g_6020	SS5173	>(P54773) PHOTOSYSTEM II 22 KD PROTEIN PRECURSOR.   &LEU04336_1(U04336|pid:g706853) 	DPlate 084	B02			D48778	AU174080			21	D04
6021	g_6021	SS3109		DPlate 082	C02			D47540	AU101756			21	E04
6022	g_6022	SS5102		DPlate 084	C02			D48715	AU101811			21	F04
6023	g_6023	SS3102	">AF094775_1(AF094775|pid:g3789952) Oryza sativa chlorophyll   a/b-binding protein presursor (Cab27) mRNA, nuclear gene   encoding chloroplast protein, complete cds; 27 KDa. "	DPlate 082	D02			D47534	AU101755			21	G04
6024	g_6024	SS5126	>(P31093) PHOTOSYSTEM I REACTION CENTRE SUBUNIT PSAN PRECURSOR   (PSI-N). &HVPSANMR_1(X66428|pid:g19095)   &S35159(S35159;S24938) 	DPlate 084	D02			D48736				21	H04
6025	g_6025	SS3118		DPlate 082	E02			D47548	AU101757			21	I04
6026	g_6026	SS5158	>A38889(A38889;PS0189)photosystem II oxygen-evolving complex protein   1 - rice (strain Nihonbare) 	DPlate 084	E02			D48765				21	J04
6027	g_6027	SS3174		DPlate 082	F02			D47589	AU096268			21	K04
6028	g_6028	SS5103	">AC003027_30(AC003027|pid:g4204310) Arabidopsis thaliana chromosome   I BAC F21M11 genomic sequence, complete sequence;   Hypothetical protein; contains Zinc finger,C3HC4 type   (RING finger), motif. "	DPlate 084	F02			D48716	AU163074			21	L04
6029	g_6029	SS3182	">AF069507_1(AF069507|pid:g3202020) Medicago sativa DnaJ-like protein   MsJ1 gene, complete cds.   &MSDNAJ_1(AJ000995|pid:g2370312) "	DPlate 082	G02			D47596	AU101763			21	M04
6030	g_6030	SS5143	">AC000348_17(AC000348|pid:g2213597) Genomic sequence for Arabidopsis   thaliana BAC T7N9, complete sequence; unknown; similar   to ESTs gb|T88591 and gb|AA394730. "	DPlate 084	G02			D48751				21	N04
6031	g_6031	SS3103		DPlate 082	H02			D47535	AU032654			21	O04
6032	g_6032	SS5112	">AF094508_1(AF094508|pid:g4322670) Homo sapiens dentin phosphoryn   mRNA, complete cds. "	DPlate 084	H02			D48725	AU174073			21	P04
6033	g_6033	SS3857	">ATAC005314_12(AC005314|pid:g3608138) Arabidopsis thaliana   chromosome II BAC T32F12 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 082	A08			AU065831	AU032730			21	A16
6034	g_6034	SS5610	>CELT15B7_14(AF022985|pid:g2384956) Caenorhabditis elegans cosmid   T15B7; 	DPlate 084	A08			D49003	AU097684			21	B16
6035	g_6035	SS3802		DPlate 082	B08			D47971	AU101778			21	C16
6036	g_6036	SS5650		DPlate 084	B08			D49032	AU101828			21	D16
6037	g_6037	SS3810	">AF004358_1(AF004358|pid:g2190992) Aegilops squarrosa glutathione   S-transferase TSI-1 mRNA, complete cds; GST isozyme. "	DPlate 082	C08			D47978	AU032714			21	E16
6038	g_6038	SS5611	">ATF24G24_19(AL049488|pid:g4538968) Arabidopsis thaliana DNA   chromosome 4, BAC clone F24G24 (ESSA project);   similarity to CLV1 receptor kinase, Arabidopsis   thaliana, gb:U96879; Contains Protein kinases signatures   and profile, Protein_Kinase_Atp   [IGSGGYSSIYMARFSGSDKAALK], Protein_Kinase_St   [IVHGDIKSSNVLL]. "	DPlate 084	C08			D49004	AU174083			21	F16
6039	g_6039	SS3834	">AF013487_1(AF013487|pid:g2331301) Zea mays ribosomal protein S4   type I (rps4) mRNA, complete cds. "	DPlate 082	D08			AU032725				21	G16
6040	g_6040	SS5619	>AOHIS2B_1(X82362|pid:g563329) A.officinalis mRNA for histone 2B.   &S48838(S48838) 	DPlate 084	D08			AU065894				21	H16
6041	g_6041	SS3850		DPlate 082	E08			AU077853	AU077852			21	I16
6042	g_6042	SS5651	">F8K4_23(AC004392|pid:g3367536) Arabidopsis thaliana chromosome 1   BAC F8K4 sequence, complete sequence; Contains   similarity to symbiosis-related like protein F1N20.80   gi|2961343 from A. thaliana BAC gb|AL022140. EST   gb|T04695 comes from this gene.. "	DPlate 084	E08			D49033	AU101829			21	J16
6043	g_6043	SS3803	>AE001011_18(AE001011|pid:g2649239) Archaeoglobus fulgidus section   96 of 172 of the complete genome; similar to SP:P24297   percent identity: 67.92; identified by sequence   similarity; putative. &D69418(D69418) 	DPlate 082	F08			D47972	AU174021			21	K16
6044	g_6044	SS5667		DPlate 084	F08			D49047	AU174086			21	L16
6045	g_6045	SS3819	">ATAC006232_4(AC006232|pid:g4314378) Arabidopsis thaliana chromosome   II BAC F10A12 genomic sequence, complete sequence; "	DPlate 082	G08			D47985	AU032718			21	M16
6046	g_6046	SS5628		DPlate 084	G08			AU070438				21	N16
6047	g_6047	SS3835	">ATT13J8_13(AL035524|pid:g4455361) Arabidopsis thaliana DNA   chromosome 4, BAC clone T13J8 (ESSAII project);   similarity to regulator protein, Pseudomonas aeruginosa,   AF052586; contains EST gb:H76524, H76272. "	DPlate 082	H08			D47995	AU032726			21	O16
6048	g_6048	SS5652	>(Q00327) PHOTOSYSTEM I REACTION CENTRE SUBUNIT V PRECURSOR   (PHOTOSYSTEM I 9 KD PROTEIN) (PSI-G).   &HVPSAG_1(X60158|pid:g19091) &S20937(S20937;S39408) 	DPlate 084	H08			D49034	AU070440			21	P16
6049	g_6049	SS6531		DPlate 086	A02			AU174131	AU101881			22	A04
6050	g_6050	ST1139	">AF123253_1(AF123253|pid:g4337025) Arabidopsis thaliana AIM1 protein   (AIM1) gene, complete cds; multifunctional protein. "	DPlate 088	A02			D39620	AU174203			22	B04
6051	g_6051	SS6555	>(P40280) HISTONE H2A. &ZMU08225_1(U08225|pid:g473603) 	DPlate 086	B02			D49327				22	C04
6052	g_6052	ST1147	>ASSGT_1(Z83832|pid:g2462911) A.sativa mRNA for UDP-glucose:sterol   glucosyltransferase. 	DPlate 088	B02			D39624	AU083562			22	D04
6053	g_6053	SS6563	">AF077549_1(AF077549|pid:g3386484) Clonorchis sinensis antigen   (Cs31) mRNA, partial cds. "	DPlate 086	C02			D49332	AU101882			22	E04
6054	g_6054	ST1155	">YUP8H12R_13(AC002986|pid:g3152559) Arabidopsis thaliana chromosome   1 YAC YUP8H12R sequence, complete sequence; Similarity   to A. thaliana gene product F21M12.20, gb|AC000132. EST   gb|Z25651 comes from this gene.. "	DPlate 088	C02			D39630	AU108942			22	F04
6055	g_6055	SS6587	">ATAC005824_21(AC005824|pid:g3860264) Arabidopsis thaliana   chromosome II BAC F15K20 genomic sequence, complete   sequence; unknown protein. "	DPlate 086	D02			D49345	AU161497			22	G04
6056	g_6056	ST1187	">AC000348_10(AC000348|pid:g2213590) Genomic sequence for Arabidopsis   thaliana BAC T7N9, complete sequence; similar to   transport protein; similar to ESTs gb|T43913 and   gb|L46413. "	DPlate 088	D02			D39645	AU101931			22	H04
6057	g_6057	SS6540	">T22H22_25(AC005388|pid:g3776578) Sequence of BAC T22H22 from   Arabidopsis thaliana chromosome 1, complete sequence;   ESTs gb|F13915 and gb|F13916 come from this gene.. "	DPlate 086	E02			AU174132				22	I04
6058	g_6058	ST1116		DPlate 088	E02			D39605	AU161596			22	J04
6059	g_6059	SS6580		DPlate 086	F02			AU070484				22	K04
6060	g_6060	ST1124	">AC005142_4(AC005142|pid:g4263042) Arabidopsis thaliana BAC T5L23 from   chromosome IV, near 19 cM, complete sequence; similar to   1,3-beta glucan synthase; identical to F9H3.18, GenBank   accession number AF071527; functional catalog   ID=01.05.99; functional catalog ID=09.01.   &AF071527_2(AF071527|pid:g4206209) "	DPlate 088	F02			D39611	AU174199			22	L04
6061	g_6061	ST0009		DPlate 086	G02			AU066034	AU032947			22	M04
6062	g_6062	ST1148	">AF036340_1(AF036340|pid:g3158394) Arabidopsis thaliana   LRR-containing F-box protein (COI1) mRNA, complete cds.    &ATAF002109_9(AF002109|pid:g2088647) "	DPlate 088	G02			D39625	AU174204			22	N04
6063	g_6063	ST0049	>XLKLP2_1(X94082|pid:g1129173) X.laevis mRNA for KLP2 protein. 	DPlate 086	H02			AU032956	D39367			22	O04
6064	g_6064	ST1172	">AF046125_3(AF046125|pid:g2996116) Rat cytomegalovirus immediate   early 1 (R123), immediate early 2A (R122a), and   immediate early 2 (R122) genes, complete cds; IE1;   putative transactivator of early and late genes;   homologous to Homo sapiens cytomegalovirus IE1;   expressed during immediate early phase of infection. "	DPlate 088	H02			D39636	AU090661			22	P04
6065	g_6065	ST0525	>(P23096) NONSPECIFIC LIPID-TRANSFER PROTEIN 1 PRECURSOR (LTP 1)   (PAPI). &OSLPI_1(Y08691|pid:g1619604)   &OSU77295_1(U77295|pid:g1667590) 	DPlate 086	A08			AU066062	AU161527			22	A16
6066	g_6066	ST1777	">ZMU85494_1(U85494|pid:g1816586) Zea mays LON1 protease (LON1) mRNA,   complete cds; Lon protease homolog. "	DPlate 088	A08			D40049	AU161627			22	B16
6067	g_6067	ST0565	">ATAC004521_25(AC004521|pid:g3128187) Arabidopsis thaliana   chromosome II BAC F4I1 genomic sequence, complete   sequence; "	DPlate 086	B08			AU066064	AU032984			22	C16
6068	g_6068	ST1786		DPlate 088	B08			D40056	AU101937			22	D16
6069	g_6069	ST0581	">ATAC002335_13(AC002335|pid:g2288999) Arabidopsis thaliana   chromosome II BAC T01O24 genomic sequence, complete   sequence; "	DPlate 086	C08			AU032985	AU032986			22	E16
6070	g_6070	ST1707		DPlate 088	C08			D39995	AU167018			22	F16
6071	g_6071	ST0582	">ZMU66241_1(U66241|pid:g1698670) Zea mays S-like RNase (kin1) mRNA,   complete cds; target of Knotted1. "	DPlate 086	D08			AU066065	AU101903			22	G16
6072	g_6072	ST1715	">OSAF001395_1(AF001395|pid:g2072553) Oryza sativa salT mRNA,   complete cds. "	DPlate 088	D08			D40003	AU033048			22	H16
6073	g_6073	ST0527	">F8K4_9(AC004392|pid:g3367522) Arabidopsis thaliana chromosome 1 BAC   F8K4 sequence, complete sequence; EST gb|T04691 comes   from this gene.. "	DPlate 086	E08			AU091490				22	I16
6074	g_6074	ST1723	">ATT5C23_4(AL049500|pid:g4539452) Arabidopsis thaliana DNA chromosome   4, BAC clone T5C23 (ESSA project); strong similarity to   phosphoribosylanthranilate transferase, Pisum sativum,   D86180. "	DPlate 088	E08			D40008	AU165964			22	J16
6075	g_6075	ST0551	">ATAC003105_1(AC003105|pid:g2760830) Arabidopsis thaliana chromosome   II BAC F18A8 genomic sequence, complete sequence. "	DPlate 086	F08			AU070498				22	K16
6076	g_6076	ST1731	>(Q03015) NADH-UBIQUINONE OXIDOREDUCTASE 12 KD SUBUNIT PRECURSOR (EC   1.6.5.3) (EC 1.6.99.3) (COMPLEX I-12KD) (CI-12KD).   &NCNUO_1(X68965|pid:g3040) &S32568(S32568;S29557) 	DPlate 088	F08			D40014	AU161620			22	L16
6077	g_6077	ST0592	">ATF28A21_8(AL035526|pid:g4539386) Arabidopsis thaliana DNA   chromosome 4, BAC clone F28A21 (ESSA project); strong   similarity to extensin-like protein - maize,   PIR2:S49915. "	DPlate 086	G08			AU174146				22	M16
6078	g_6078	ST1779	">ATAC004561_22(AC004561|pid:g3980396) Arabidopsis thaliana   chromosome II BAC F16P2 genomic sequence, complete   sequence; "	DPlate 088	G08			D40051	AU161628			22	N16
6079	g_6079	ST0529		DPlate 086	H08			D39392				22	O16
6080	g_6080	ST1787	>NTY16644_1(Y16644|pid:g4539545) Nicotiana tabacum mRNA for   proteasome A-type subunit. 	DPlate 088	H08			D40057	AU101938			22	P16
6081	g_6081	ST3186	>(P40954) CHITINASE 3 PRECURSOR (EC 3.2.1.14).   &CAU15801_1(U15801|pid:g571429) 	DPlate 090	A02			AU175160				23	A04
6082	g_6082	ST5241		DPlate 092	A02			AU058125				23	B04
6083	g_6083	ST3171		DPlate 090	B02			AU108362	AU108363			23	C04
6084	g_6084	ST5249		DPlate 092	B02			AU058126				23	D04
6085	g_6085	ST3116	">AC002291_1(AC002291|pid:g2829918) Arabidopsis thaliana chromosome I   BAC F22K20 genomic sequence, complete sequence; similar   to ""tub"" protein gp|U82468|2072162; location of EST   gb|T45528 and gb|AA395363. "	DPlate 090	C02			D40925	AU174287			23	E04
6086	g_6086	ST5257		DPlate 092	C02			AU097483				23	F04
6087	g_6087	ST3132	>AF041468_133(AF041468|pid:g3603065) Guillardia theta complete   plastid genome; 	DPlate 090	D02			D40938	AU101965			23	G04
6088	g_6088	ST5202	">HSU10248_1(U10248|pid:g806697) Human ribosomal protein L29   (humrpl29) mRNA, complete cds.   &HSU49083_1(U49083|pid:g1215742) &S65784(S65784;S54204) "	DPlate 092	D02			C25084	AU161732			23	H04
6089	g_6089	ST3549	">AF071893_1(AF071893|pid:g3264767) Prunus armeniaca AP2 domain   containing protein (AP2DCP) mRNA, partial cds. "	DPlate 090	E02			AU097299	AU097300			23	I04
6090	g_6090	ST5226		DPlate 092	E02			AU033208				23	J04
6091	g_6091	ST3565	">ATT9A14_14(AL035656|pid:g4490338) Arabidopsis thaliana DNA   chromosome 4, BAC clone T9A14 (ESSA project); strong   similarity to auxin-induced protein 10A, Glycine max.,   PIR2:JQ1099. "	DPlate 090	F02			D41219	AU097301			23	K04
6092	g_6092	ST5250	">ATF20M13_24(AL035540|pid:g4467155) Arabidopsis thaliana DNA   chromosome 4, BAC clone F20M13 (ESSA project); Contains   'Cold-shock' DNA-binding domain signature   [FGFITPDDGGDDLFVHQSSI]; contains EST gb:H36206, T04463,   T75608. &JQ1061(JQ1061) &S47408_1(S47408|pid:g259445) "	DPlate 092	F02			AU091737	AU091738			23	L04
6093	g_6093	ST3526	">TAU86763_1(U86763|pid:g4099408) Triticum aestivum delta-type   tonoplast intrinsic protein mRNA, complete cds;   delta-TIP. "	DPlate 090	G02			D41197	AU097295			23	M04
6094	g_6094	ST5266	>S68416(S68416)phosphoenolpyruvate carboxylase (EC 4.1.1.31) 4 -   Kalanchoe blossfeldiana (fragment) 	DPlate 092	G02			AU066153				23	N04
6095	g_6095	ST3574	">AB001888_1(AB001888|pid:g3618320) Oryza sativa mRNA for zinc finger   protein, complete cds, clone:S3574. &JE0113(JE0113) "	DPlate 090	H02			D41222	AU108379			23	O04
6096	g_6096	ST5274	">AB002109_1(AB002109|pid:g1944000) Oryza sativa DNA for protein   kinase, complete cds; a novel protein kinase. "	DPlate 092	H02			C22690	C22689			23	P04
6097	g_6097	ST3882	>STRNAAAH_1(X97012|pid:g2145473) S.tuberosum mRNA for   aconitase/aconitate hydratase. 	DPlate 090	A08			D41402	AU108431			23	A16
6098	g_6098	ST5485	">ATU93215_15(U93215|pid:g1946369) Arabidopsis thaliana chromosome II   BAC T06B20 genomic sequence, complete sequence; unknown   protein. "	DPlate 092	A08			AU033230				23	B16
6099	g_6099	ST3890	">RICSODB_1(D01000|pid:g218226) Oryza sativa mRNA for   copper/zinc-superoxide dismutase, complete cds,   clone:RSODB. &RICSODCC2A_1(L19434|pid:g310321)   &S21136(S21136;S26354) "	DPlate 090	B08			D41409	AU174303			23	C16
6100	g_6100	ST5470	">ATT13J8_11(AL035524|pid:g4455359) Arabidopsis thaliana DNA   chromosome 4, BAC clone T13J8 (ESSAII project);   similarity to MSP1, Saccharomyces cerevisiae,   PIR2:A49506; Contains AAA-protein family signatur. "	DPlate 092	B08			C25162	AU161783			23	D16
6101	g_6101	ST3803	">OSU30477_1(U30477|pid:g1041710) Oryza sativa expansin Os-EXP2   (Os-EXP2) mRNA, complete cds; former gene name RiExB. "	DPlate 090	C08			D41340	AU078735			23	E16
6102	g_6102	ST5478	">TOBBY4D_1(D38126|pid:g1208498) Tobacco mRNA for EREBP-2, complete   cds. "	DPlate 092	C08			C25163				23	F16
6103	g_6103	ST3811	">ATF24G24_6(AL049488|pid:g4538955) Arabidopsis thaliana DNA   chromosome 4, BAC clone F24G24 (ESSA project); strong   similarity to fructokinase, Lycopersicon esculentum,   gb:U62329; Contains pfkB family of carbohydrate kinases   signatures, Pfkb_Kinases_1 [GGAPANVACAITKLGGKSAFIGKFG],   Pfkb_Kinases_2 [DTTGAGDSFVGAFL].   &T9A4_4(AF096373|pid:g3695403) "	DPlate 090	D08			D41344	AU174298			23	G16
6104	g_6104	ST5486	">ATAC003105_1(AC003105|pid:g2760830) Arabidopsis thaliana chromosome   II BAC F18A8 genomic sequence, complete sequence. "	DPlate 092	D08			C25166	AU102029			23	H16
6105	g_6105	ST3827	">AF079782_1(AF079782|pid:g4454799) Zea mays translation initiation   factor 4A2 (tif4A2) mRNA, partial cds. "	DPlate 090	E08			D41355	AU108416			23	I16
6106	g_6106	ST5407		DPlate 092	E08			AU033221	AU102025			23	J16
6107	g_6107	ST3812	">ATAC004683_11(AC004683|pid:g3395432) Arabidopsis thaliana   chromosome II BAC T19C21 genomic sequence, complete   sequence; unknown protein. "	DPlate 090	F08			D41345				23	K16
6108	g_6108	ST5431	">ATAC006260_3(AC006260|pid:g4371280) Arabidopsis thaliana chromosome   II BAC T2N18 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 092	F08			AU175170				23	L16
6109	g_6109	ST3844	">AC005223_10(AC005223|pid:g4204265) Arabidopsis thaliana chromosome   I BAC T5A14 genomic sequence, complete sequence;   Hypothetical protein. "	DPlate 090	G08			D41369	AU101986			23	M16
6110	g_6110	ST5447	">ATAC002333_22(AC002333|pid:g2281103) Arabidopsis thaliana   chromosome II BAC F18O19 genomic sequence, complete   sequence; "	DPlate 092	G08			C25155	AU161777			23	N16
6111	g_6111	ST3860	">AB000801_1(AB000801|pid:g1816444) Oryza sativa mRNA for chalcone   synthase, complete cds. "	DPlate 090	H08			D41381				23	O16
6112	g_6112	ST5487	">AF036957_1(AF036957|pid:g2708634) Oryza sativa gamma-tubulin   (TubG2) mRNA, complete cds; tubulin subunit. "	DPlate 092	H08			C25167	AU161790			23	P16
6113	g_6113	ST6481	">AF001453_1(AF001453|pid:g2228771) Helianthus annuus Dc3   promoter-binding factor-1 (DPBF-1) mRNA, complete cds. "	DPlate 094	A02			C25467	AU102070			24	A04
6114	g_6114	EE1578		DPlate 046	A12			C91806	AU172858			24	B04
6115	g_6115	ST6426	">ATAC002388_8(AC002388|pid:g2344893) Arabidopsis thaliana chromosome   II BAC T13E15 genomic sequence, complete sequence;   &ATHB4_1(Y09582|pid:g1694713) "	DPlate 094	B02			C25442	AU161934			24	C04
6116	g_6116	EE1523		DPlate 046	B12			AU064484	AU101436			24	D04
6117	g_6117	ST6482	">ATAC006836_11(AC006836|pid:g4406772) Arabidopsis thaliana   chromosome II BAC F19B11 genomic sequence, complete   sequence; "	DPlate 094	C02			C25468	AU161959			24	E04
6118	g_6118	EE1531		DPlate 046	C12			C91780	AU101439			24	F04
6119	g_6119	ST6403		DPlate 094	D02			AU066313	AU174415			24	G04
6120	g_6120	EE1539	">F17O7_13(AC003671|pid:g3176684) Arabidopsis thaliana chromosome 1   BAC F17O7 complete sequence; Contains similarity to   equilibratiave nucleoside transporter 1 gb|U81375 from   Homo sapiens. ESTs gb|N65317, gb|T20785, gb|AA586285   and gb|AA712578 come from this gene.. "	DPlate 046	D12			AU172849	AU172850			24	H04
6121	g_6121	ST6419		DPlate 094	E02			AU091501	AU091502			24	I04
6122	g_6122	EE1563		DPlate 046	E12			C91796	AU091944			24	J04
6123	g_6123	ST6443	">ATAC006234_19(AC006234|pid:g4454465) Arabidopsis thaliana   chromosome II BAC F5H14 genomic sequence, complete   sequence; unknown protein. "	DPlate 094	F02			AU066322	AU161942			24	K04
6124	g_6124	EE1571		DPlate 046	F12			AU165843	AU029777			24	L04
6125	g_6125	ST6459	">ATU90439_12(U90439|pid:g1871184) Arabidopsis thaliana chromosome II   BAC T06D20 genomic sequence, complete sequence; unknown   protein. "	DPlate 094	G02			C25458	AU174417			24	M04
6126	g_6126	EE1579	>(P39942) VACUOLAR ATP SYNTHASE SUBUNIT D (EC 3.6.1.34) (V-ATPASE D   SUBUNIT) (28 KD ACCESSORY PROTEIN). &A55910(A55910)   &BTU11927_1(U11927|pid:g517446) 	DPlate 046	G12			AU064494	AU166116			24	N04
6127	g_6127	ST6467	>(P36408) GUANINE NUCLEOTIDE-BINDING PROTEIN BETA SUBUNIT.   &A47370(A47370) &DDGPBS_1(X73641|pid:g460981) 	DPlate 094	H02			C25462	AU161952			24	O04
6128	g_6128	EE1587	>T14P8_8(AF069298|pid:g3193303) Arabidopsis thaliana BAC T14P8;   similar to several proteins containing a tandem repeat   region such as Plasmodium falciparum GGM tandem repeat   protein (GB:U27807); partial CDS; coded for by A.   thaliana cDNA T46208. 	DPlate 046	H12			AU064496				24	P04
6129	g_6129	ST6516		DPlate 094	A08			C25477				24	A16
6130	g_6130	posi25										24	B16
6131	g_6131	ST6564		DPlate 094	B08			AU175175				24	C16
6132	g_6132	posi26										24	D16
6133	g_6133	ST6580		DPlate 094	C08			C25493	AU174426			24	E16
6134	g_6134	posi27										24	F16
6135	g_6135	D94Water+D		DPlate 094	D08							24	G16
6136	g_6136	posi28										24	H16
6137	g_6137	D94Water+D		DPlate 094	E08							24	I16
6138	g_6138	posi29										24	J16
6139	g_6139	D94Water+D		DPlate 094	F08							24	K16
6140	g_6140	posi30										24	L16
6141	g_6141	D94Water+D		DPlate 094	G08							24	M16
6142	g_6142	posi31										24	N16
6143	g_6143	D94Water+D		DPlate 094	H08							24	O16
6144	g_6144	posi32										24	P16
6145	g_6145	EG0143	>OSR40G3_1(Y08988|pid:g1658315) O.sativa osr40g3 gene. 	DPlate 049	A03			AU102202	AU058202			13	A05
6146	g_6146	EG0866	>SSY10783_1(Y10783|pid:g1808686) S.stapfianus pSD.39 mRNA. 	DPlate 051	A03			AU166212	AU030290			13	B05
6147	g_6147	EG0167		DPlate 049	B03			AU162286	AU058212			13	C05
6148	g_6148	EG0874		DPlate 051	B03			AU030299	AU030300			13	D05
6149	g_6149	EG0112	>(P47111) HYPOTHETICAL 15.7 KD PROTEIN IN NUP85-SSC1 INTERGENIC   REGION. &S57063(S57063;S63768)   &SCYJR044C_1(Z49544|pid:g1015699)   &YSCTGGMS_12(L36344|pid:g1197072) 	DPlate 049	C03			AU029879	AU095005			13	E05
6150	g_6150	EG0890		DPlate 051	C03			AU030311	AU030312			13	F05
6151	g_6151	EG0128		DPlate 049	D03			AU029888	AU029889			13	G05
6152	g_6152	EG0811	">HSU94832_1(U94832|pid:g2055427) Human KH type splicing regulatory   protein KSRP mRNA, complete cds; RNA binding protein; KH   type RNA binding domain; alternative splicing regulator;   cooperative complex formation. "	DPlate 051	D03			AU065653	AU030244			13	H05
6153	g_6153	EG0136	>NTNADI_1(X96727|pid:g3021506) N.tabacum mRNA for NAD-dependent   isocitrate dehydrogenase. 	DPlate 049	E03			AU058199	AU081337			13	I05
6154	g_6154	EG0843		DPlate 051	E03			AU065658	AU030276			13	J05
6155	g_6155	EG0168	>A71428(A71428) hypothetical protein - Arabidopsis thaliana   &ATFCA5_24(Z97340|pid:g2244974) 	DPlate 049	F03			AU058213	AU172942			13	K05
6156	g_6156	EG0867		DPlate 051	F03			AU030291	AU030292			13	L05
6157	g_6157	EG0105	">OSU65957_1(U65957|pid:g1519251) Oryza sativa GF14-c protein mRNA,   complete cds; rice 14-3-3 protein homolog; osGF14c. "	DPlate 049	G03			AU029876	AU029877			13	M05
6158	g_6158	EG0875	>(P46265) TUBULIN BETA CHAIN. &RICBTB_1(D30717|pid:g493710) 	DPlate 051	G03			AU058395	AU166213			13	N05
6159	g_6159	EG0121	>S26826(S26826) histone H1 - maize &ZMH1HIS_1(X57077|pid:g22321) 	DPlate 049	H03			AU070139				13	O05
6160	g_6160	EG0804		DPlate 051	H03			AU030235	AU030236			13	P05
6161	g_6161	EG0353		DPlate 049	A09			AU029963	AU029964			13	A17
6162	g_6162	EG0962	">AC002130_8(AC002130|pid:g2760323) The sequence of BAC F1N21 from   Arabidopsis thaliana chromosome 1, complete sequence;   unknown. "	DPlate 051	A09			AU065680	AU030367			13	B17
6163	g_6163	EG0369	>I46412(I46412;S34215) keratin KAP5.4 - sheep   &OAKRTAPA_1(X73434|pid:g313720) 	DPlate 049	B09			AU162288	AU058290			13	C17
6164	g_6164	EG0970	">PTU31309_9(U31309|pid:g974294) Pinus taeda chitinase homolog LP6   (lp6) gene, complete cds; chitinase homolog. "	DPlate 051	B09			AU030372	AU030373			13	D17
6165	g_6165	EG0393		DPlate 049	C09			AU058303	AU091395			13	E17
6166	g_6166	EG0915		DPlate 051	C09			AU077703	AU077704			13	F17
6167	g_6167	EG0306		DPlate 049	D09			AU058272				13	G17
6168	g_6168	EG0947		DPlate 051	D09			AU095048	AU030360			13	H17
6169	g_6169	EG0346		DPlate 049	E09			AU029960	AU029961			13	I17
6170	g_6170	EG0987		DPlate 051	E09			AU058405	AU095050			13	J17
6171	g_6171	EG0378	">AB003280_1(AB003280|pid:g2189964) Arabidopsis thaliana mRNA for   Phosphoglycerate dehydrogenase, complete cds.   &AB010407_1(AB010407|pid:g2804258) "	DPlate 049	F09			AU172950	AU058295			13	K17
6172	g_6172	EG0995		DPlate 051	F09			AU065688	AU030389			13	L17
6173	g_6173	EG0307	>S51590(S51590) mitochondrial processing peptidase (EC 3.4.99.41)   alpha-II chain precursor - potato   &STAIIMPP_1(X80236|pid:g587562) 	DPlate 049	G09			AU172946	AU172947			13	M17
6174	g_6174	EG0916		DPlate 051	G09			AU082091	AU030330			13	N17
6175	g_6175	EG0315	">ATAC005170_11(AC005170|pid:g3738322) Arabidopsis thaliana   chromosome II BAC T29E15 genomic sequence, complete   sequence; "	DPlate 049	H09			AU058274	AU091378			13	O17
6176	g_6176	EG0940	>RICEF1B_1(D12821|pid:g218161) Oryza sativa mRNA for elongation   factor 1 beta'. &S29224(S29224;S39846;JS0729) 	DPlate 051	H09			AU166217	AU030357			13	P17
6177	g_6177	EH0382	>SSY10783_1(Y10783|pid:g1808686) S.stapfianus pSD.39 mRNA. 	DPlate 053	A03			AU173004				14	A05
6178	g_6178	EH1063		DPlate 055	A03			AU065279	AU101535			14	B05
6179	g_6179	EH0390		DPlate 053	B03			AU065185	AU091455			14	C05
6180	g_6180	EH1079		DPlate 055	B03			AU031166				14	D05
6181	g_6181	EH0319	>HSKINEC_1(Z22551|pid:g296164) H.sapiens kinectin gene; subcellular   localization: perinuclear and ER;conserved among several   species. &S32763(S32763;I37947) 	DPlate 053	C03			AU172993	AU030835			14	E05
6182	g_6182	EH1040	>A56154(A56154) Abl substrate ena (enabled) - fruit fly (Drosophila   melanogaster) &DMU21123_1(U21123|pid:g755821) 	DPlate 055	C03			AU077732	AU077733			14	F05
6183	g_6183	EH0343		DPlate 053	D03			AU095161	AU030849			14	G05
6184	g_6184	EH1072	">ATAC002339_11(AC002339|pid:g2335108) Arabidopsis thaliana chromosome   II BAC T11A7 genomic sequence, complete sequence; "	DPlate 055	D03			AU031163				14	H05
6185	g_6185	EH0359	>CELB0546_1(AF038604|pid:g2702370) Caenorhabditis elegans cosmid   B0546; contains similarity to Drosophila ovarian tumor   locus protein (GB:X13693); coded for by C. elegans cDNA   yk389b1.5; coded for by C. elegans cDNA yk332a1.5; coded   for by C. elegans cDNA yk314b10.5; coded for by C.   elegans cDNA yk343g3.5; coded for by C. elegans cDNA   yk331e1.5; coded for by C. elegans cDNA yk98b1.5; coded   for by C. elegans cDNA yk468f9.5; coded for by C.   elegans cDNA yk290c1.5; coded for by C. elegans cDNA   yk374c12.5; coded for by C. elegans cDNA yk281e9.5;   coded for by C. elegans cDNA yk157a6.5; coded for by C.   elegans cDNA yk215g3.5. 	DPlate 053	E03			AU030864	AU030865			14	I05
6186	g_6186	EH1117		DPlate 055	E03			AU031186	AU031187			14	J05
6187	g_6187	EH0367	">AF047428_1(AF047428|pid:g4091117) Oryza sativa nucleic acid binding   protein mRNA, complete cds; RNBP91. "	DPlate 053	F03			AU173000	AU030871			14	K05
6188	g_6188	EH1125		DPlate 055	F03			AU164758	AU065288			14	L05
6189	g_6189	EH0383		DPlate 053	G03			AU091451				14	M05
6190	g_6190	EH1165	>(P32495) HIGH MOBILITY GROUP-LIKE NUCLEAR PROTEIN 2.   &CS39KBCIV_11(X99000|pid:g1429348)   &S67767(S67767;S15037) &SCNHP2GEN_1(X57714|pid:g666101)   &SCYDL208W_1(Z74256|pid:g1431346) 	DPlate 055	G03			AU031225				14	N05
6191	g_6191	EH0328	>LELRPGENE_1(X95269|pid:g1619300) L.esculentum LRP gene. 	DPlate 053	H03			AU030840				14	O05
6192	g_6192	EH1110		DPlate 055	H03			AU164754				14	P05
6193	g_6193	EH0510	">AF018093_1(AF018093|pid:g3941289) Pisum sativum similarity to   SCAMP37 (psam2) mRNA, complete cds. "	DPlate 053	A09			AU173008	AU173009			14	A17
6194	g_6194	EH1317		DPlate 055	A09			AU031307	AU031308			14	B17
6195	g_6195	EH0558	">ATAP21_24(Z99707|pid:g4006865) Arabidopsis thaliana DNA chromosome   4, ESSA I AP2 contig fragment No. 1; last 3 exons   covered by ESTs; similar to Sequence of BAC F5I14 from   Arabidopsis thaliana chromosome 1, gene F5I14.19;   contains EST gb:H36844, AA394956, AA712501. "	DPlate 053	B09			AU173012	AU173013			14	C17
6196	g_6196	EH1326	>DMSAP471_1(X80111|pid:g929571) D.melanogaster sap47-1 mRNA.   &S60652(S60652) 	DPlate 055	B09			AU031316	AU031317			14	D17
6197	g_6197	EH0519	">HUMRSC419_1(D13630|pid:g286001) Human mRNA for KIAA0005 gene,   complete cds. "	DPlate 053	C09			AU165914	AU030980			14	E17
6198	g_6198	EH1342		DPlate 055	C09			AU031328	AU031329			14	F17
6199	g_6199	EH0543	">ATAC005560_22(AC005560|pid:g3785989) Arabidopsis thaliana   chromosome II BAC F2I9 genomic sequence, complete   sequence; unknown protein. "	DPlate 053	D09			AU082547	AU082548			14	G17
6200	g_6200	EH1350	">AF010579_1(AF010579|pid:g2331131) Oryza sativa glycine-rich protein   (OSGRP1) mRNA, complete cds. "	DPlate 055	D09			AU173043				14	H17
6201	g_6201	EH0551	">ATAC005560_13(AC005560|pid:g3785980) Arabidopsis thaliana   chromosome II BAC F2I9 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 053	E09			AU162326	AU031004			14	I17
6202	g_6202	EH1358	">ATF20D10_14(AL035538|pid:g4467108) Arabidopsis thaliana DNA   chromosome 4, BAC clone F20D10 (ESSA project); "	DPlate 055	E09			AU162348				14	J17
6203	g_6203	EH0583	">OSU76004_1(U76004|pid:g1800227) Oryza sativa Bowman-Birk proteinase   inhibitor mRNA, complete cds. "	DPlate 053	F09			AU065199	AU095196			14	K17
6204	g_6204	EH1366		DPlate 055	F09			AU164810				14	L17
6205	g_6205	EH0504	">ATAC006439_25(AC006439|pid:g4309744) Arabidopsis thaliana   chromosome II BAC T30D6 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 053	G09			AU030971	AU165911			14	M17
6206	g_6206	EH1374		DPlate 055	G09			AU031340	AU031341			14	N17
6207	g_6207	EH0536	">AC003027_24(AC003027|pid:g4204314) Arabidopsis thaliana chromosome I   BAC F21M11 genomic sequence, complete sequence;   Hypothetical protein. "	DPlate 053	H09			AU030991	AU030992			14	O17
6208	g_6208	EH1390	">(P26360) ATP SYNTHASE GAMMA CHAIN, MITOCHONDRIAL PRECURSOR (EC   3.6.1.34). &A47493(A47493;A33306)   &IPBF1ATPG_1(D14699|pid:g303626) "	DPlate 055	H09			AU097678				14	P17
6209	g_6209	EH1831	">ATAC005169_18(AC005169|pid:g3687239) Arabidopsis thaliana   chromosome II BAC F6F22 genomic sequence, complete   sequence; "	DPlate 057	A03			AU065331	AU101582			15	A05
6210	g_6210	FE0401	">AB012107_1(AB012107|pid:g3062907) Oryza sativa RINO1 mRNA for   myo-inositol phosphate synthase, complete cds. "	DPlate 059	A03			AU174807				15	B05
6211	g_6211	EH1895		DPlate 057	B03			AU176496				15	C05
6212	g_6212	FE0409		DPlate 059	B03			AU174809				15	D05
6213	g_6213	EH1832	">AC002311_9(AC002311|pid:g2829898) Arabidopsis thaliana chromosome I   BAC T26J12 genomic sequence, complete sequence;   Hypothetical protein. "	DPlate 057	C03			AU031549	AU101583			15	E05
6214	g_6214	FE0417		DPlate 059	C03			AU174818	AU174817			15	F05
6215	g_6215	EH1840	">ATF28M20_6(AL031004|pid:g3281853) Arabidopsis thaliana DNA   chromosome 4, BAC clone F28M20 (ESSAII project);   similarity to protein phosphatase 2C, Medicago sativa,   PID:g2582800; Contains Mitochondrial energy transfer   proteins signature [PEEGAKRLMM], Protein phosphatase 2C   signature [LFGVFDGHG]. "	DPlate 057	D03			AU031552	AU031553			15	G05
6216	g_6216	FE0441	">(P25864) 50S RIBOSOMAL PROTEIN L9, CHLOROPLAST PRECURSOR (CL9).   &ATRPCL9G_1(Z11509|pid:g16501)   &ATRPCL9_1(Z11129|pid:g16499)   &R5MUL9(S20943;S22960;S18025;S22121) "	DPlate 059	D03			AU174833	AU174832			15	H05
6217	g_6217	EH1909	>S48690(S48690;S55873;S45021) ubiquinol--cytochrome-c reductase (EC   1.10.2.2) 11K protein - potato   &STCR7_1(X79273|pid:g488712) 	DPlate 057	E03			AU173058				15	I05
6218	g_6218	FE0457	">AF032976_1(AF032976|pid:g2655295) Oryza sativa germin-like protein   6 (GER6) mRNA, complete cds; similar to wheat and barley   oxalate oxidase. "	DPlate 059	E03			AU174848	AU174849			15	J05
6219	g_6219	EH1973		DPlate 057	F03			AU031613	AU031614			15	K05
6220	g_6220	FE0465	>(P36494) CHLOROPHYLL A-B BINDING PROTEIN CP24 PRECURSOR.   &CHSO20KCP_1(Z25886|pid:g437991) &S40210(S40210) 	DPlate 059	F03			AU174853				15	L05
6221	g_6221	EH1910		DPlate 057	G03			AU162372				15	M05
6222	g_6222	FE0473		DPlate 059	G03			AU174857	AU174858			15	N05
6223	g_6223	EH1918		DPlate 057	H03			AU082696				15	O05
6224	g_6224	FE0481		DPlate 059	H03			AU174869	AU174868			15	P05
6225	g_6225	FE0028	">ATF13M23_30(AL035523|pid:g4455259) Arabidopsis thaliana DNA   chromosome 4, BAC clone F13M23 (ESSAII project);   similarity to serine/threonine-specific receptor protein   kinase, Arabidopsis thaliana, PIR2:S71277; Contains   Protein kinases signatures and profile,   Protein_Kinase_Atp [IGMGAYGAVYKCNLHHTTAVVK],   Protein_Kinase_St [IIHRDLKPANILL]; contains EST   gb:AA712567. "	DPlate 057	A09			C22579	C22578			15	A17
6226	g_6226	FL0026	">F20D22_6(AC002411|pid:g3142294) Arabidopsis thaliana chromosome 1   BAC F20D22 sequence, complete sequence; Strong   similarity to initiation factor eIF-2, gb|U37354 from S.   pombe. ESTs gb|T41979, gb|N37284 and gb|N37529 come   from this gene.. "	DPlate 059	A09			AU174899	AU174898			15	B17
6227	g_6227	FE0060	>(Q01594) ALLIIN LYASE PRECURSOR (EC 4.4.1.4) (ALLIINASE) (CYSTEINE   SULPHOXIDE LYASE). &ASALLIIN_1(Z12622|pid:g16109)   &S29302(S29302;S35459;S22078) 	DPlate 057	B09			AU174578				15	C17
6228	g_6228	FL0034		DPlate 059	B09			AU174904				15	D17
6229	g_6229	FE0068	">ATAC005168_5(AC005168|pid:g3426037) Arabidopsis thaliana chromosome   II BAC F12C20 genomic sequence, complete sequence; "	DPlate 057	C09			AU174584	AU174583			15	E17
6230	g_6230	FL0050	>(P36886) PHOTOSYSTEM I REACTION CENTRE SUBUNIT X PRECURSOR   (LIGHT-HARVESTING COMPLEX I 7 KD PROTEIN) (PSI-K).   &A48527(A48527) &BLYCPPHSYS_1(L12707|pid:g304220) 	DPlate 059	C09			AU174919	AU174918			15	F17
6231	g_6231	FE0076		DPlate 057	D09			AU174588	AU174587			15	G17
6232	g_6232	FL0074	">ATAC002332_22(AC002332|pid:g2459427) Arabidopsis thaliana   chromosome II BAC F4P9 genomic sequence, complete   sequence; "	DPlate 059	D09			AU174942				15	H17
6233	g_6233	FE0013	>ATAJ6404_1(AJ006404|pid:g3281846) Arabidopsis thaliana mRNA for   LATE ELONGATED HYPOCOTYL MYB transcription factor. 	DPlate 057	E09			AU174553	AU174552			15	I17
6234	g_6234	FL0082	">CTRP450A_1(L19074|pid:g404688) Catharanthus roseus Cp3 cytochrome   P450 (CYP72B) gene, complete cds. "	DPlate 059	E09			AU174952	AU174951			15	J17
6235	g_6235	FE0069	">ATF10M6_8(AL021811|pid:g2864615) Arabidopsis thaliana DNA chromosome   4, BAC clone F10M6 (ESSAII project); similarity to   Aux22d, Vigna radiata, PATCHX:D1021691; contains EST   gb:N37449, T22982. "	DPlate 057	F09			AU174586	AU174585			15	K17
6236	g_6236	FL0090	">CE1_1(Z98262|pid:g3873621) Caenorhabditis elegans cosmid VF15C11L,   complete sequence; similar to Ubiquitin family; cDNA EST   EMBL:C11990 comes from this gene; cDNA EST EMBL:C08080   comes from this gene; cDNA EST EMBL:C08013 comes from   this gene; cDNA EST EMBL:C08074 comes from this gene;   cDNA EST EMBL:C09592 comes from this gene; cDNA EST   EMBL:C09069 comes from this gene; cDNA EST EMBL:C09669   comes from this gene; cDNA EST EMBL:C09678 comes from   this gene; cDNA EST yk444b12.3 comes from this gene;   cDNA EST yk444b12.5 comes from this gene; cDNA EST   yk443b6.3 comes from this gene; cDNA EST yk443b6.5 comes   from this gene; cDNA EST yk411e1.3 comes from this gene;   cDNA EST yk411e1.5 comes from this gene; cDNA EST   yk460c10.3 comes from this gene; cDNA EST yk460c10.5   comes from this gene; cDNA EST yk451h11.3 comes from   this gene; cDNA EST yk451h11.5 comes from this gene;   cDNA EST yk452b6.3 comes from this gene; cDNA EST   yk452b6.5 comes from this gene; cDNA EST yk447a12.3   comes from this gene; cDNA EST yk447a12.5 comes from   this gene; cDNA EST yk416h9.3 comes from this gene; cDNA   EST yk416h9.5 comes from this gene; cDNA EST yk392d12.3   comes from this gene; cDNA EST yk392d12.5 comes from   this gene; cDNA EST yk363h4.3 comes from this gene; cDNA   EST yk363h4.5 comes from this gene; cDNA EST yk309b2.3   comes from this gene; cDNA EST yk309b2.5 comes from this   gene; cDNA EST yk326d5.3 comes from this gene; cDNA EST   yk326d5.5 comes from this gene; cDNA EST yk320c9.3 comes   from this gene; cDNA EST yk320c9.5 comes from this gene;   cDNA EST yk308g8.3 comes from this gene; cDNA EST   yk308g8.5 comes from this gene; cDNA EST yk271h9.3 comes   from this gene; cDNA EST yk271h9.5 comes from this gene;   cDNA EST yk253g7.3 comes from this gene; cDNA EST   yk253g7.5 comes from this gene; cDNA EST yk262h4.3 comes   from this gene; cDNA EST yk262h4.5 comes from this gene;   cDNA EST yk331c7.5 comes from this gene.   &CEF15C11_2(Z71260|pid:g3875993) "	DPlate 059	F09			AU174962	AU174961			15	L17
6237	g_6237	FE0085		DPlate 057	G09			AU174595	AU174594			15	M17
6238	g_6238	FL0011	">ATAC004667_7(AC004667|pid:g3668080) Arabidopsis thaliana chromosome   II BAC T4C15 genomic sequence, complete sequence;   unknown protein. "	DPlate 059	G09			AU174885	AU174884			15	N17
6239	g_6239	FE0093	>T3H13_7(AF128396|pid:g4325368) Arabidopsis thaliana BAC T3H13;   T3H13.5; coded for by A. thaliana cDNA T04188; coded for   by A. thaliana cDNA R90231. 	DPlate 057	H09			AU174602	AU174601			15	O17
6240	g_6240	FL0019	">AF067401_1(AF067401|pid:g4056615) Oryza sativa Scl1 protein (Scl1)   mRNA, partial cds; Scarecrow-like; similar to Oryza   sativa sequence presented in GenBank Accession Number   D41474. "	DPlate 059	H09			AU174893	AU174892			15	P17
6241	g_6241	RA0223	">AF051217_1(AF051217|pid:g2982268) Picea mariana probable 40S   ribosomal protein S15 (Sb23) mRNA, complete cds; similar   to Arabidopsis thaliana ribosomal protein S15 encoded by   GenBank Accession Number Z23161. "	DPlate 061	A03			AU173067				16	A05
6242	g_6242	RA1063	">AF062403_1(AF062403|pid:g3746581) Oryza sativa glutathione   S-transferase II mRNA, complete cds. "	DPlate 063	A03			D24073	AU167000			16	B05
6243	g_6243	RA0239		DPlate 061	B03			D23814	AU101600			16	C05
6244	g_6244	RA1016		DPlate 063	B03			D24052	AU031731			16	D05
6245	g_6245	RA0247	">AF093632_1(AF093632|pid:g3885888) Oryza sativa high mobility group   protein (HMG) mRNA, complete cds. "	DPlate 061	C03			D23818	AU091705			16	E05
6246	g_6246	RA1064	">ATAC003105_7(AC003105|pid:g2760836) Arabidopsis thaliana chromosome   II BAC F18A8 genomic sequence, complete sequence; "	DPlate 063	C03			D24074	AU162402			16	F05
6247	g_6247	RA0255	">AC002294_1(AC002294|pid:g2443875) Arabidopsis thaliana chromosome I   BAC F11P17 genomic sequence, complete sequence. "	DPlate 061	D03			AU173069	AU173070			16	G05
6248	g_6248	RA1088		DPlate 063	D03			AU173127	AU173128			16	H05
6249	g_6249	RA0271		DPlate 061	E03			D23825	AU173072			16	I05
6250	g_6250	RA1118		DPlate 063	E03							16	J05
6251	g_6251	RA0295		DPlate 061	F03			AU173073				16	K05
6252	g_6252	RA1167	>(P55309) CATALASE ISOZYME B (EC 1.11.1.6) (CAT-B).   &RICPOSCATB_1(D26484|pid:g516839) 	DPlate 063	F03			D24082	AU162405			16	L05
6253	g_6253	RA0208	>HVHVST1_1(X96431|pid:g1217967) H.vulgare mRNA for high affinity   sulphate transporter. 	DPlate 061	G03			D23805	AU031651			16	M05
6254	g_6254	RA1161		DPlate 063	G03			AU176507				16	N05
6255	g_6255	RA0288	">GHU37060_1(U37060|pid:g1019946) Gossypium hirsutum ascorbate   peroxidase mRNA, complete cds; glyoxysomal   membrane-bound protein. "	DPlate 061	H03			D23832	AU031659			16	O05
6256	g_6256	RA1170	">ATU28214_1(U28214|pid:g881521) Arabidopsis thaliana hexokinase 1   (AtHXK1) mRNA, complete cds. &S71205(S71205) "	DPlate 063	H03			AU173130	AU173131			16	P05
6257	g_6257	RA0424	">ATAC004561_38(AC004561|pid:g3980411) Arabidopsis thaliana   chromosome II BAC F16P2 genomic sequence, complete   sequence; "	DPlate 061	A09			D23856	AU101606			16	A17
6258	g_6258	RA1427	>BSUB0008_28(Z99111|pid:g2633727) Bacillus subtilis complete genome   (section 8 of 21): from 1394791 to 1603020;   &D69863(D69863) 	DPlate 063	A09			AU031747	AU031746			16	B17
6259	g_6259	RA0440	>OSA011078_1(AJ011078|pid:g3646373) Oryza sativa mRNA for RGP1   protein. 	DPlate 061	B09			D28284	AU031672			16	C17
6260	g_6260	RA1436	">ATFCA1_4(Z97336|pid:g2244792) Arabidopsis thaliana DNA chromosome 4,   ESSA I contig fragment No. 1; similarity to ankyrin 2,   long form - human. &E71405(E71405) "	DPlate 063	B09			D24152	AU031748			16	D17
6261	g_6261	RA0448	">OSU30479_1(U30479|pid:g1041712) Oryza sativa expansin Os-EXP3   (Os-EXP3) mRNA, complete cds; induces extension (creep)   in plant cell walls; former gene name RiExD. "	DPlate 061	C09			D23861	AU031673			16	E17
6262	g_6262	RA1460		DPlate 063	C09			D24168	AU173152			16	F17
6263	g_6263	RA0480	>(Q05737) GTP-BINDING PROTEIN YPTM2. &B38202(B38202)   &ZMYPTM2A_1(X63278|pid:g287835) 	DPlate 061	D09			D23874	AU031678			16	G17
6264	g_6264	RA1413	">D89726_1(D89726|pid:g2723473) Oryza sativa DAD-1 mRNA for defender   against apoptotic death 1 protein, complete cds.   &D89727_1(D89727|pid:g2723883) "	DPlate 063	D09			D24136	AU176515			16	H17
6265	g_6265	RA0496		DPlate 061	E09			D23880	AU031681			16	I17
6266	g_6266	RA1469		DPlate 063	E09			AU175071	AU176516			16	J17
6267	g_6267	RA0517		DPlate 061	F09			AU176502				16	K17
6268	g_6268	RA1485		DPlate 063	F09			AU031752	AU031751			16	L17
6269	g_6269	RA0525		DPlate 061	G09			D23892	AU101618			16	M17
6270	g_6270	RA1470		DPlate 063	G09			D24175	AU173153			16	N17
6271	g_6271	RA0549	">ATT4L20_3(AL023094|pid:g3641837) Arabidopsis thaliana DNA chromosome   4, BAC clone T4L20 (ESSAII project); strong similarity to   coat protein gamma-cop, Bos primigenius; Contains 2-oxo   acid dehydrogenases acyltransferase component lipoyl   binding site, Lipoyl [NPVVSSAALVSGLHLLKTNPQIVKRWSNEV];   contains EST gb:AA395649, N96014, H36940, R90482,   AA042453, T43773, R90315, T46306, T75984. "	DPlate 061	H09			D23905	AU101620			16	O17
6272	g_6272	RA1478	">ATAC004411_15(AC004411|pid:g3522942) Arabidopsis thaliana   chromosome II BAC F14M4 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 063	H09			D24179	AU173154			16	P17
6273	g_6273	RA1862	">ATAC002337_9(AC002337|pid:g2275203) Arabidopsis thaliana chromosome   II BAC T08I13 genomic sequence, complete sequence; "	DPlate 065	A03			D24417	AU031808			17	A05
6274	g_6274	RA2454	">T1G11_14(AC002376|pid:g2494132) Sequence of BAC T1G11 from   Arabidopsis thaliana chromosome 1, complete sequence;   Contains similarity to human dimethylaniline   monooxygenase (gb|M64082).. "	DPlate 067	A03			D24732	AU031898			17	B05
6275	g_6275	RA1870		DPlate 065	B03			D24422	AU031811			17	C05
6276	g_6276	RA2470	>(P52712) SERINE CARBOXYPEPTIDASE-LIKE PRECURSOR (EC 3.4.16.-).   &RICCBP31_1(D17587|pid:g409582) 	DPlate 067	B03			AU173376	AU173377			17	D05
6277	g_6277	RA1807	">AF027174_1(AF027174|pid:g2827143) Arabidopsis thaliana cellulose   synthase catalytic subunit (Ath-B) mRNA, complete cds;   RSW1-like. "	DPlate 065	C03			D24375	AU162420			17	E05
6278	g_6278	RA2486	">ATAC005499_13(AC005499|pid:g3786005) Arabidopsis thaliana   chromosome II BAC T6A23 genomic sequence, complete   sequence; "	DPlate 067	C03			D24748	AU173383			17	F05
6279	g_6279	RA1815	">AB022732_1(AB022732|pid:g4200044) Glycyrrhiza echinata CYP Ge-31   mRNA for cytochrome P450, complete cds. "	DPlate 065	D03			AU173235				17	G05
6280	g_6280	RA2423	">AC003027_22(AC003027|pid:g4204302) Arabidopsis thaliana chromosome   I BAC F21M11 genomic sequence, complete sequence;   Hypothetical protein. "	DPlate 067	D03			AU173360	AU173361			17	H05
6281	g_6281	RA1863		DPlate 065	E03			AU173246	AU173247			17	I05
6282	g_6282	RA2447	>(P39524) PROBABLE CALCIUM-TRANSPORTING ATPASE 3 (EC 3.6.1.38)   (ENDOPLASMIC RETICULUM CA2+-ATPASE).   &S51995(S51995;B54591;S30768)   &SCU12980_44(U12980|pid:g595560)   &YSCATPA_1(L01795|pid:g171114) 	DPlate 067	E03			D24727	AU031896			17	J05
6283	g_6283	RA1871	">ATAC006234_21(AC006234|pid:g4454467) Arabidopsis thaliana   chromosome II BAC F5H14 genomic sequence, complete   sequence; unknown protein. "	DPlate 065	F03			D24423	AU173249			17	K05
6284	g_6284	RA2479	>(P40107) VANADATE RESISTANCE PROTEIN GOG5/VRG4/VAN2.   &S50238(S50238;S56042;S59268;S64247)   &SCU15599_1(U15599|pid:g603046)   &SCYGL225W_1(Z72747|pid:g1322877)   &YSCVRG_1(L33915|pid:g499894) 	DPlate 067	F03			D24744	AU031903			17	L05
6285	g_6285	RA1879	">ATAC006284_11(AC006284|pid:g4335754) Arabidopsis thaliana   chromosome II BAC T4M8 genomic sequence, complete   sequence; "	DPlate 065	G03			D24429	AU173252			17	M05
6286	g_6286	RA2495	">HUMMFAPA_1(L38486|pid:g790817) Human microfibril-associated   glycoprotein 4 (MFAP4) mRNA, 3' end of cds. "	DPlate 067	G03			AU173386				17	N05
6287	g_6287	RA1856		DPlate 065	H03			D24413				17	O05
6288	g_6288	RA2416	">PTY13772_1(Y13772|pid:g3805962) Populus trichocarpa mRNA for   laccase, lac90 gene. "	DPlate 067	H03			D24710	AU162435			17	P05
6289	g_6289	RA1964	">AF067207_1(AF067207|pid:g3192867) Drosophila melanogaster CLOCK   mRNA, complete cds. "	DPlate 065	A09			D39100	AU173269			17	A17
6290	g_6290	RA2949		DPlate 067	A09			D25023	AU095498			17	B17
6291	g_6291	RA1972		DPlate 065	B09			D39104	AU173271			17	C17
6292	g_6292	RA2957	>ZMY13905_1(Y13905|pid:g2224846) Zea mays mRNA for anionic   peroxidase. 	DPlate 067	B09			D25030	AU173410			17	D17
6293	g_6293	RA1980	>IG002N01_25(AF007269|pid:g2191150) Arabidopsis thaliana BAC   IG002N01; similar to mitochondrial carrier family; coded   for by A. thaliana cDNA H37480; coded for by A. thaliana   cDNA H36980. 	DPlate 065	C09			D39109	AU173275			17	E17
6294	g_6294	RA2965	>CMPMEL2_1(Z70521|pid:g1843440) C.melo mRNA (clone pMel2). 	DPlate 067	C09			D25037				17	F17
6295	g_6295	RA1988	">ATAC002339_11(AC002339|pid:g2335108) Arabidopsis thaliana   chromosome II BAC T11A7 genomic sequence, complete   sequence; "	DPlate 065	D09			AU173278	AU173279			17	G17
6296	g_6296	RA2973		DPlate 067	D09			D25044	AU173413			17	H17
6297	g_6297	RA2025	>ATCLCD_1(Z71450|pid:g1742959) A.thaliana mRNA for CLC-d chloride   channel protein. 	DPlate 065	E09			D24482	AU031836			17	I17
6298	g_6298	RA2989	>OSAJ2893_1(AJ002893|pid:g2624326) Oryza sativa mRNA for   glycine-rich RNA-binding protein (OsGRP1); glycine-rich   RNA-binding protein 1. 	DPlate 067	E09			AU173417				17	J17
6299	g_6299	RA2073	>ATAJ1911_1(AJ001911|pid:g2467088) Arabidopsis thaliana mRNA for   ethylene-responsive element binding protein. 	DPlate 065	F09			D24504	AU173302			17	K17
6300	g_6300	RA2910		DPlate 067	F09			D24991	AU173403			17	L17
6301	g_6301	RA2018	">ATAC006283_17(AC006283|pid:g4432845) Arabidopsis thaliana   chromosome II BAC T1B3 genomic sequence, complete   sequence; unknown protein. "	DPlate 065	G09			D24475	AU031834			17	M17
6302	g_6302	RA2918	">AB024712_1(AB024712|pid:g4521159) Arabidopsis thaliana ATC   (centroradialis) gene, complete cds, strain:Landsberg.   &AB024714_1(AB024714|pid:g4521161)   &AB024715_1(AB024715|pid:g4521163)   &ATAC005824_32(AC005824|pid:g3860275)   &ATAC006232_22(AC006232|pid:g4314395) "	DPlate 067	G09			D24998	AU101668			17	N17
6303	g_6303	RA2074	">(Q01859) ATP SYNTHASE BETA CHAIN, MITOCHONDRIAL PRECURSOR (EC   3.6.1.34). &RICATPB_1(D10491|pid:g218147)   &S25304(S25304) "	DPlate 065	H09			D24505	AU173303			17	O17
6304	g_6304	RA2926		DPlate 067	H09			D25004	AU173405			17	P17
6305	g_6305	RA3335		DPlate 069	A03			AU173489				18	A05
6306	g_6306	RA3979	">S82324_1(S82324|pid:g1839597) calcium/calmodulin-dependent protein   kinase homolog|CaM kinase homolog|MCK1 [Zea mays=maize,   cv. Merit, root caps, mRNA, 2483 nt]; This sequence comes   from Fig. 1.. "	DPlate 071	A03			AU032386				18	B05
6307	g_6307	RA3343	">ATAC007048_6(AC007048|pid:g4512651) Arabidopsis thaliana chromosome   II BAC F23N11 genomic sequence, complete sequence; "	DPlate 069	B03			D25143				18	C05
6308	g_6308	RA3924	>ATCNX2MR_1(Z48047|pid:g662871) A.thaliana mRNA for molybdenum   cofactor biosynthesis Cnx2 protein. 	DPlate 071	B03			AU032347				18	D05
6309	g_6309	RA3351		DPlate 069	C03			AU162461	C23561			18	E05
6310	g_6310	RA3956		DPlate 071	C03			AU173825	AU173826			18	F05
6311	g_6311	RA3375	>ZMCCAP_1(X96758|pid:g2959358) Z.mays mRNA for clathrin coat   assembly protein. 	DPlate 069	D03			D25151	AU032054			18	G05
6312	g_6312	RA3972	">ATF25I24_16(AL049525|pid:g4539369) Arabidopsis thaliana DNA   chromosome 4, BAC clone F25I24 (ESSA project);   similarity to proline-rich protein, Brassica napus,   PIR2:S16748. "	DPlate 071	D03			AU181019				18	H05
6313	g_6313	RA3304		DPlate 069	E03			AU173480	AU173481			18	I05
6314	g_6314	RB0017	">HIM11207_1(AJ011207|pid:g3355405) Human immunodeficiency virus type   2 gag gene, isolate b1095. "	DPlate 071	E03			AU070653				18	J05
6315	g_6315	RA3312	>(P26204) NON-CYANOGENIC BETA-GLUCOSIDASE PRECURSOR (EC 3.2.1.21).   &GLJY31(S16581) &TRBG361_1(X56734|pid:g21955) 	DPlate 069	F03			D28326	AU032044			18	K05
6316	g_6316	RB0033	">SPAC167_7(AL035248|pid:g4164404) S.pombe chromosome I cosmid c167;   SPAC167.07c, len:   &243,SIMILARITY:Homosapiens,Q15386,orf,completecds.,   (1083aa) "	DPlate 071	F03			AU070664				18	L05
6317	g_6317	RA3360	">ATAC002334_4(AC002334|pid:g2924772) Arabidopsis thaliana chromosome   II BAC F25I18 genomic sequence, complete sequence;   unknown protein. "	DPlate 069	G03			D39334	AU173496			18	M05
6318	g_6318	RB0073		DPlate 071	G03			AU173834				18	N05
6319	g_6319	RA3305		DPlate 069	H03			D39306	AU173482			18	O05
6320	g_6320	RB0081	">AC004557_18(AC004557|pid:g3935175) Genomic sequence for Arabidopsis   thaliana BAC F17L21, complete sequence; hypothetical   protein. "	DPlate 071	H03			AU070685				18	P05
6321	g_6321	RA3437		DPlate 069	A09			AU164683	AU164684			18	A17
6322	g_6322	RB0177	">AF062894_1(AF062894|pid:g3941480) Arabidopsis thaliana putative   transcription factor (MYB59) mRNA, complete cds; MYB59;   R2R3-MYB factor family member. "	DPlate 071	A09			AU070742	AU082164			18	B17
6323	g_6323	RA3445	">AF020553_1(AF020553|pid:g2444420) Glycine max ribosome-associated   protein p40 mRNA, complete cds; similar to laminin   receptor protein. "	DPlate 069	B09			AU162478	AU162479			18	C17
6324	g_6324	RB0185		DPlate 071	B09			AU070747	AU162575			18	D17
6325	g_6325	RA3469		DPlate 069	C09			AU070195	AU173513			18	E17
6326	g_6326	RB0193		DPlate 071	C09			AU070754				18	F17
6327	g_6327	RA3406	">AF052503_1(AF052503|pid:g4079800) Oryza sativa S-phase-specific   ribosomal protein (RSPSP94) mRNA, complete cds. "	DPlate 069	D09			AU065343	AU095507			18	G17
6328	g_6328	RB0106		DPlate 071	D09			AU173837	AU173838			18	H17
6329	g_6329	RA3414	">RCU23145_6(U23145|pid:g2564976) Rhodobacter capsulatus Calvin cycle   carbon dioxide fixation operon:   fructose-1,6-/sedoheptulose-1,7-bisphosphate aldolase   (cbbA) gene, partial cds, Form II   ribulose-1,5-bisphosphate carboxylase/oxygenase (cbbM)   gene, complete cds, and Calvin cycle operon:   pentose-5-phosphate-3-epimerase (cbbE), phosphoglycolate   phosphatase (cbbZ), and cbbY genes, complete cds; "	DPlate 069	E09			AU101673	AU101674			18	I17
6330	g_6330	RB0186	>(P47815) EUKARYOTIC TRANSLATION INITIATION FACTOR 1A (EIF-1A)   (EIF-4C). &A53045(A53045) 	DPlate 071	E09			AU070748				18	J17
6331	g_6331	RA3430	>(P80608) CYSTEINE SYNTHASE (EC 4.2.99.8) (O-ACETYLSERINE   SULFHYDRYLASE) (O-ACETYLSERINE (THIOL)-LYASE) (CSASE).   &S52738(S52738) &ZMCSOATL_1(X85803|pid:g758353) 	DPlate 069	F09			AU173507				18	K17
6332	g_6332	RB0194	">ATF23E13_7(AL022141|pid:g2961377) Arabidopsis thaliana DNA   chromosome 4, BAC clone F23E13 (ESSAII project);   similarity to Cf-2.1 leucine rich repeat protein,   Solanum pimpinellifolium, PATX:G1184075. "	DPlate 071	F09			AU070755	AU101691			18	L17
6333	g_6333	RA3438	>BSUB0008_28(Z99111|pid:g2633727) Bacillus subtilis complete genome   (section 8 of 21): from 1394791 to 1603020;   &D69863(D69863) 	DPlate 069	G09			AU032070	AU095512			18	M17
6334	g_6334	RB0107	">AF017366_1(AF017366|pid:g2407287) Oryza sativa metallothionein-like   protein mRNA, complete cds. "	DPlate 071	G09			AU173839				18	N17
6335	g_6335	RA3454		DPlate 069	H09			AU173509	AU173510			18	O17
6336	g_6336	RB0115		DPlate 071	H09			AU070697				18	P17
6337	g_6337	RB0748		DPlate 073	A03			AU071108				19	A05
6338	g_6338	SA0239	">ATAC003680_4(AC003680|pid:g2979544) Arabidopsis thaliana chromosome   II BAC F17K2 genomic sequence, complete sequence; "	DPlate 075	A03			AU056035	AU056036			19	B05
6339	g_6339	RB0780		DPlate 073	B03			AU078047				19	C05
6340	g_6340	SA0271		DPlate 075	B03			AU056079	AU056080			19	D05
6341	g_6341	RB0841	">ZMU62752_1(U62752|pid:g2431769) Zea mays acidic ribosomal protein   P1a (rpp1a) mRNA, complete cds; P1 and P2 dimerize and   form a stalk structure that is present in the active   site of the large ribosomal subunit (60S); the stalk   structure is thought to assist in the late initiation   and elongation phases of translation via interactions   with tRNA, rRNA and translation factors. "	DPlate 073	C03			AU078049				19	E05
6342	g_6342	SA0279	">ATAC005623_3(AC005623|pid:g3885328) Arabidopsis thaliana chromosome   II BAC T20P8 genomic sequence, complete sequence; "	DPlate 075	C03			AU056086	AU056087			19	F05
6343	g_6343	RB0865	">CEY54G11A_13(AL034488|pid:g4008447) Caenorhabditis elegans cosmid   Y54G11A, complete sequence; predicted using Genefinder. "	DPlate 073	D03			AU071181	AU095621			19	G05
6344	g_6344	SA0287		DPlate 075	D03			AU173873	AU173874			19	H05
6345	g_6345	RB0873		DPlate 073	E03			AU163494	AU163495			19	I05
6346	g_6346	SA0295		DPlate 075	E03			AU056111	AU056112			19	J05
6347	g_6347	RB0889		DPlate 073	F03			AU071198				19	K05
6348	g_6348	SA0208	">ATAC003105_1(AC003105|pid:g2760830) Arabidopsis thaliana chromosome   II BAC F18A8 genomic sequence, complete sequence. "	DPlate 075	F03			AU055992	AU055993			19	L05
6349	g_6349	RB0810		DPlate 073	G03			AU071141	AU081367			19	M05
6350	g_6350	SA0240	">MCU60315_107(U60315|pid:g1492050) Molluscum contagiosum virus   subtype 1, complete genome; putative core protein;   Description: homolog of vaccinia A4L and variola A5L. "	DPlate 075	G03			AU056037	AU056038			19	N05
6351	g_6351	RB0834		DPlate 073	H03			AU081585	AU081584			19	O05
6352	g_6352	SA0288	>(P34250) HYPOTHETICAL 125.6 KD PROTEIN IN AAT1-GFA1 INTERGENIC   REGION. &S37932(S37932;S39099)   &SCHAPLAP_6(X71133|pid:g431211)   &SCYKL105C_1(Z28105|pid:g486177) 	DPlate 075	H03			AU056100	AU056101			19	P05
6353	g_6353	RB0947	>LELEUZIP_1(Z12127|pid:g19275) L.esculentum mRNA for protein with   leucine zipper; protein of unknown function.   &S21495(S21495) 	DPlate 073	A09			AU163503	AU163504			19	A17
6354	g_6354	SA0356	">ATF6I18_13(AL022198|pid:g2980770) Arabidopsis thaliana DNA   chromosome 4, BAC clone F6I18 (ESSAII project); strong   similarity to serine/threonine protein kinase,   Arabidopsis thaliana, PATCHX:D1006875; contains EST   gb:N96591. "	DPlate 075	A09			AU056182	AU056183			19	B17
6355	g_6355	RB0955	">ATAC005395_16(AC005395|pid:g3643602) Arabidopsis thaliana   chromosome II BAC F17H15 genomic sequence, complete   sequence; "	DPlate 073	B09			AU083018	AU071244			19	C17
6356	g_6356	SA0380	>A58393_1(A58393|pid:g3714050) Sequence 1 from Patent WO9635805;   unnamed protein product.   &RNU50194_1(U50194|pid:g1245343) &S68431(S68431;S68483) 	DPlate 075	B09			AU056209	AU056210			19	D17
6357	g_6357	RB0987	">ATAC004401_4(AC004401|pid:g3169173) Arabidopsis thaliana chromosome   II BAC F21P24 genomic sequence, complete sequence.   &ATAC004786_19(AC004786|pid:g3445215) "	DPlate 073	C09			AU071268	AU101712			19	E17
6358	g_6358	SA0433		DPlate 075	C09			AU056264	AU056265			19	F17
6359	g_6359	SA0049		DPlate 073	D09			AU055777	AU055778			19	G17
6360	g_6360	SA0441		DPlate 075	D09			AU056277	AU056278			19	H17
6361	g_6361	SA0057	">AB007193_1(AB007193|pid:g3041775) Oryza sativa mRNA for   fructose-1,6-bisphosphatase (cytosolic isoform),   complete cds; cytosolic isoform. "	DPlate 073	E09			AU055793	AU055792			19	I17
6362	g_6362	SA0457	">ATAF002109_15(AF002109|pid:g2088653) Arabidopsis thaliana   chromosome II BAC T28M21 genomic sequence, complete   sequence; "	DPlate 075	E09			AU056302	AU056303			19	J17
6363	g_6363	SA0081		DPlate 073	F09			AU078721	AU055826			19	K17
6364	g_6364	SA0465		DPlate 075	F09			AU056315				19	L17
6365	g_6365	SA0089	">AC002292_19(AC002292|pid:g2462760) Genomic sequence of Arabidopsis   BAC F8A5, complete sequence; Hypothetical protein. "	DPlate 073	G09			AU055839	AU055840			19	M17
6366	g_6366	SA0473		DPlate 075	G09			AU162672	AU056324			19	N17
6367	g_6367	SA0010	">ATAC006260_19(AC006260|pid:g4371296) Arabidopsis thaliana chromosome   II BAC T2N18 genomic sequence, complete sequence; "	DPlate 073	H09			AU055710	AU055711			19	O17
6368	g_6368	SA0481	">ATAC005170_13(AC005170|pid:g3738339) Arabidopsis thaliana   chromosome II BAC T29E15 genomic sequence, complete   sequence; "	DPlate 075	H09			AU056335	AU056336			19	P17
6369	g_6369	SA0510	>SGHRDT_1(X79979|pid:g887638) S.griseus hrdT gene. 	DPlate 076	A03			AU056360	AU056361			20	A05
6370	g_6370	SA1350		DPlate 079	A03			AU057326	AU057327			20	B05
6371	g_6371	SA0518	">AF034946_1(AF034946|pid:g2668744) Zea mays ubiquitin conjugating   enzyme (UBC) mRNA, complete cds. "	DPlate 076	B03			AU056370	AU056371			20	C05
6372	g_6372	SA1311		DPlate 079	B03			AU057287	AU057288			20	D05
6373	g_6373	SA0542	>(P37890) SERINE CARBOXYPEPTIDASE I PRECURSOR (EC 3.4.16.5)   (CARBOXYPEPTIDASE C). &RICCBPI_1(D17586|pid:g409580)   &S43516(S43516) 	DPlate 076	C03			AU056393	AU056394			20	E05
6374	g_6374	SA1335		DPlate 079	C03			AU173948	AU173949			20	F05
6375	g_6375	SA0590	">ATF13C5_1(AL021711|pid:g2832612) Arabidopsis thaliana DNA   chromosome 4, BAC clone F13C5 (ESSAII project);   similarity to unknown protein, Arabidopsis thaliana,   PATCHX:E248504. "	DPlate 076	D03			AU162687	AU056444			20	G05
6376	g_6376	SA1359	>GACAD1C2_1(Y16432|pid:g2879841) Gossypium arboreum mRNA for   (+)-delta-cadinene synthase. 	DPlate 079	D03			AU057337	AU057338			20	H05
6377	g_6377	SA0503		DPlate 076	E03			AU056354	AU093403			20	I05
6378	g_6378	SA1391		DPlate 079	E03			AU173954	AU173955			20	J05
6379	g_6379	SA0567	>(P45871) HYPOTHETICAL 14.8 KD PROTEIN IN TDK-PRFA INTERGENIC   REGION. &BSDNA320D_23(Z49782|pid:g853775)   &BSUB0019_198(Z99122|pid:g2636227)   &S55436(S55436;C70061) 	DPlate 076	F03			AU162683	AU056422			20	K05
6380	g_6380	SA1320		DPlate 079	F03			AU173947				20	L05
6381	g_6381	SA0504		DPlate 076	G03			AU166253	AU056355			20	M05
6382	g_6382	SA1336	">ATU43486_1(U43486|pid:g1244754) Arabidopsis thaliana xyloglucan   endotransglycosylase-related protein (XTR4) mRNA, 3'   end, partial cds. &S71223(S71223) "	DPlate 079	G03			AU162743	AU057309			20	N05
6383	g_6383	SA0520		DPlate 076	H03			AU162678	AU056373			20	O05
6384	g_6384	SA1376	">ATAC004077_21(AC004077|pid:g3128217) Arabidopsis thaliana   chromosome II BAC T31E10 genomic sequence, complete   sequence; hypothetical protein.   &ATAC004481_29(AC004481|pid:g3337374) "	DPlate 079	H03			AU057361	AU057362			20	P05
6385	g_6385	SA0678		DPlate 076	A09			AU056553				20	A17
6386	g_6386	SA1518		DPlate 079	A09			AU057513				20	B17
6387	g_6387	SA0686	">SPIRPAA_1(M55322|pid:g170131) Spinach chloroplast ribosomal protein   30S subunit, complete cds. "	DPlate 076	B09			AU056563	AU056564			20	C17
6388	g_6388	SA1566	">AF093631_1(AF093631|pid:g3885886) Oryza sativa Rieske Fe-S   precursor protein (RISP) mRNA, complete cds. "	DPlate 079	B09			AU057566	AU057567			20	D17
6389	g_6389	SA0694		DPlate 076	C09			AU173909				20	E17
6390	g_6390	SA1574	">ATU79160_1(U79160|pid:g4098521) Arabidopsis thaliana HMG-CoA   synthase (MVA1) mRNA, complete cds.   &ATU79161_1(U79161|pid:g4098523) "	DPlate 079	C09			AU057575				20	F17
6391	g_6391	SA0607		DPlate 076	D09			AU056455				20	G17
6392	g_6392	SA1582		DPlate 079	D09			AU057580				20	H17
6393	g_6393	SA0623	>ATDI19_1(X78584|pid:g469110) A.thaliana (Columbia) Di19 mRNA.   &S51478(S51478;S43179) 	DPlate 076	E09			AU056480	AU056481			20	I17
6394	g_6394	SA1519	">AF076924_1(AF076924|pid:g3395938) Arabidopsis thaliana   polypyrimidine tract-binding protein homolog (PTB) mRNA,   complete cds. "	DPlate 079	E09			AU057514				20	J17
6395	g_6395	SA0647		DPlate 076	F09			AU162695	AU056512			20	K17
6396	g_6396	SA1543		DPlate 079	F09			AU162755	AU162756			20	L17
6397	g_6397	SA0655	>ATATAF1_1(X74755|pid:g1345506) A.thaliana ATAF1 mRNA; Protein   sequence is in conflict with the conceptual   translation.. &S37101(S37101) 	DPlate 076	G09			AU162697	AU056522			20	M17
6398	g_6398	SA1559	">AF049930_1(AF049930|pid:g4105798) Petunia x hybrida PGP237-11   (PGP237-11) mRNA, complete cds; contains a cytochrome c   family heme binding site. "	DPlate 079	G09			AU057561				20	N17
6399	g_6399	SA0663	">AF100333_1(AF100333|pid:g3929325) Dendrobium grex Madame Thong-IN   putative DNA-binding protein (ovg30) mRNA, partial cds. "	DPlate 076	H09			AU056531	AU056532			20	O17
6400	g_6400	SA1567		DPlate 079	H09			AU057568				20	P17
6401	g_6401	SS0012		DPlate 081	A03			C23564	AU165962			21	A05
6402	g_6402	SS3980		DPlate 083	A03			AU175146	AU176542			21	B05
6403	g_6403	SS0028	">BTU51100_1(U51100|pid:g4115341) Bos taurus chromaffin granule   ATPase II mRNA, complete cds; P-type ATPase. "	DPlate 081	B03			AU065760	AU173978			21	C05
6404	g_6404	SS4217	">AC002294_12(AC002294|pid:g2443886) Arabidopsis thaliana chromosome   I BAC F11P17 genomic sequence, complete sequence;   Unknown protein; location of EST emb|Z25559. "	DPlate 083	B03			D48148				21	D05
6405	g_6405	SS0044	">ATAP21_8(Z99707|pid:g4006854) Arabidopsis thaliana DNA chromosome   4, ESSA I AP2 contig fragment No. 1; similarity to   hypothetical protein Schizosacch. pombe, PATCHX:E339924.   "	DPlate 081	C03			AU173981				21	E05
6406	g_6406	SS4249	">ATAC004665_23(AC004665|pid:g3386615) Arabidopsis thaliana   chromosome II BAC F4I18 genomic sequence, complete   sequence; "	DPlate 083	C03			AU181027				21	F05
6407	g_6407	SS0068	">POPVEGSTRA_1(L20233|pid:g309839) P.trichocarpa x P.deltoides   vegetative storage protein mRNA, 3' end; this is a   nearly full-length cDNA that has been sequenced   completely at least twice on both strands.; putative.   &S39502(S39502) "	DPlate 081	D03			C23571	AU032452			21	G05
6408	g_6408	SS4257		DPlate 083	D03			AU176543	AU176544			21	H05
6409	g_6409	SS0084	">AF026166_1(AF026166|pid:g4090929) Homo sapiens   chaperonin-containing TCP-1 beta subunit homolog mRNA,   complete cds; similar to mouse chaperonin-containing   TCP-1 beta subunit. &AF026293_1(AF026293|pid:g2559012) "	DPlate 081	E03			AU032454	AU095659			21	I05
6410	g_6410	SS4265	>A38889(A38889;PS0189)photosystem II oxygen-evolving complex protein   1 - rice (strain Nihonbare) 	DPlate 083	E03			D48184	AU163002			21	J05
6411	g_6411	SS0092	">ATF13C5_18(AL021711|pid:g2832629) Arabidopsis thaliana DNA   chromosome 4, BAC clone F13C5 (ESSAII project); strong   similarity to 4-coumarate-CoA ligase, Arabidopsis   thaliana, PIR2:S57784. "	DPlate 081	F03			AU173984				21	K05
6412	g_6412	SS4210		DPlate 083	F03			AU175147				21	L05
6413	g_6413	SS0005	">AF080249_1(AF080249|pid:g3421378) Arabidopsis thaliana kinesin-like   heavy chain (KATD) mRNA, complete cds. "	DPlate 081	G03			AU065754	AU175140			21	M05
6414	g_6414	SS4250	">(P45434) TRANSLOCON-ASSOCIATED PROTEIN, ALPHA SUBUNIT PRECURSOR   (TRAP-ALPHA) (SIGNAL SEQUENCE RECEPTOR ALPHA SUBUNIT)   (SSR-ALPHA) (FRAGMENT). &ATHTRAP_1(L32016|pid:g547391) "	DPlate 083	G03			D48174	AU174044			21	N05
6415	g_6415	SS0045	">AC002292_29(AC002292|pid:g2462748) Genomic sequence of Arabidopsis   BAC F8A5, complete sequence; "	DPlate 081	H03			C23569	AU032444			21	O05
6416	g_6416	SS4258		DPlate 083	H03			D48178	AU174045			21	P05
6417	g_6417	SS1695	">ATAC005560_22(AC005560|pid:g3785989) Arabidopsis thaliana   chromosome II BAC F2I9 genomic sequence, complete   sequence; unknown protein. "	DPlate 081	A09			D46797	AU175143			21	A17
6418	g_6418	SS4953	">ATAC004665_11(AC004665|pid:g3386604) Arabidopsis thaliana   chromosome II BAC F4I18 genomic sequence, complete   sequence; "	DPlate 083	A09			D48628	AU075517			21	B17
6419	g_6419	SS1616		DPlate 081	B09			D46748	AU101738			21	C17
6420	g_6420	SS4969	">AB011670_1(AB011670|pid:g3928519) Triticum aestivum mRNA for wpk4   protein kinase, complete cds. "	DPlate 083	B09			D48640	C22641			21	D17
6421	g_6421	SS1624	">ATAC004667_13(AC004667|pid:g3668086) Arabidopsis thaliana   chromosome II BAC T4C15 genomic sequence, complete   sequence; unknown protein. "	DPlate 081	C09			D46755	AU176536			21	E17
6422	g_6422	SS4922	">ATU93215_19(U93215|pid:g1946372) Arabidopsis thaliana chromosome II   BAC T06B20 genomic sequence, complete sequence; yeast   hypothetical protein YDB1_SCHPO isolog. "	DPlate 083	C09			D48604	AU075508			21	F17
6423	g_6423	SS2617		DPlate 081	D09			D47319				21	G17
6424	g_6424	SS4938		DPlate 083	D09			D48615	AU075512			21	H17
6425	g_6425	SS2625	>(P29194) PHOSPHOENOLPYRUVATE CARBOXYLASE 2 (EC 4.1.1.31) (PEPCASE)   (CP28). &S18240(S18240) &SVPEPCG_1(X59925|pid:g22593) 	DPlate 081	E09			D47323	AU173991			21	I17
6426	g_6426	SS4954	>AE000956_15(AE000956|pid:g2648379) Archaeoglobus fulgidus section   151 of 172 of the complete genome; similar to   PID:1045016 SP:Q51790 percent identity: 31.21;   identified by sequence similarity; putative.   &G69518(G69518) 	DPlate 083	E09			AU174055	AU174056			21	J17
6427	g_6427	SS2633		DPlate 081	F09			AU173996				21	K17
6428	g_6428	SS4962	">ATF20M13_14(AL035540|pid:g4467145) Arabidopsis thaliana DNA   chromosome 4, BAC clone F20M13 (ESSA project); EST   Ab015102 is pobably unspliced; putative metal-binding   protein; contains EST gb:Aa041071, AA720245, Aa389832,   Ab015102. "	DPlate 083	F09			D48633	AU075520			21	L17
6429	g_6429	SS2665	">OSU86018_1(U86018|pid:g1835731) Oryza sativa photosystem II 10 kDa   polypeptide mRNA, complete cds. "	DPlate 081	G09			D47348	AU101753			21	M17
6430	g_6430	SS4931	">ATF6I18_24(AL022198|pid:g2980781) Arabidopsis thaliana DNA   chromosome 4, BAC clone F6I18 (ESSAII project);   similarity to various predicted proteins. "	DPlate 083	G09			D48610	AU174053			21	N17
6431	g_6431	SS2602	>AF060862_1(AF060862|pid:g3094014) Homo sapiens unknown mRNA;   similar to yeast protein P38191. 	DPlate 081	H09			D47307	AU162881			21	O17
6432	g_6432	SS4955	">AF094775_1(AF094775|pid:g3789952) Oryza sativa chlorophyll   a/b-binding protein presursor (Cab27) mRNA, nuclear gene   encoding chloroplast protein, complete cds; 27 KDa. "	DPlate 083	H09			D48629				21	P17
6433	g_6433	SS5977		DPlate 085	A03			AU070458				22	A05
6434	g_6434	ST0812	">HVU88090_1(U88090|pid:g1848225) Hordeum vulgare nonspecific lipid   transfer protein (ltp-BR1) mRNA, complete cds; inducible   in root cells subjected to nutrient deprivation. "	DPlate 087	A03			AU174159				22	B05
6435	g_6435	SS5906		DPlate 085	B03			AU070452				22	C05
6436	g_6436	ST0820		DPlate 087	B03			D39471	AU088709			22	D05
6437	g_6437	SS5962		DPlate 085	C03			AU065927	AU174101			22	E05
6438	g_6438	ST0876		DPlate 087	C03			AU097009				22	F05
6439	g_6439	SS5978	>S14981(S14981)extensin class I (clone w1-8 L) - tomato (fragment) 	DPlate 085	D03			AU181033				22	G05
6440	g_6440	ST0884	">ATAC002332_8(AC002332|pid:g2459414) Arabidopsis thaliana chromosome   II BAC F4P9 genomic sequence, complete sequence;   &ATU18415_1(U18415|pid:g972929) &S58499(S58499) "	DPlate 087	D03			D39504	AU174172			22	H05
6441	g_6441	SS5931	>NTRNPHTR_1(X75088|pid:g403023) N.tabacum mRNA for phosphate   translocator. &S42583(S42583;S37224) 	DPlate 085	E03			C24843	AU163124			22	I05
6442	g_6442	ST0805	>S32369(S32369)gamma-SNAP protein - bovine 	DPlate 087	E03			D39462	AU174157			22	J05
6443	g_6443	SS5988	>(P52876) HYPOTHETICAL 22.4 KD PROTEIN SLL0615. &S76502(S76502)   &SSU38892_5(U38892|pid:g1256592)   &SYCSLRD_5(D64002|pid:g1001617) 	DPlate 085	F03			C24859	AU174103			22	K05
6444	g_6444	ST0813		DPlate 087	F03			D39466	AU097007			22	L05
6445	g_6445	SS5996		DPlate 085	G03			AU174104				22	M05
6446	g_6446	ST0821	">ATAC003672_26(AC003672|pid:g3341697) Arabidopsis thaliana   chromosome II BAC F16B22 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 087	G03			AU176545				22	N05
6447	g_6447	SS6017	">ATU74669_1(U74669|pid:g2231303) Arabidopsis thaliana ras-related   small GTPase (AtRAB11c) mRNA, complete cds.   &F21M12_2(AC000132|pid:g2160157) "	DPlate 085	H03			C24869	AU162104			22	O05
6448	g_6448	ST0829		DPlate 087	H03			D39477	AU174160			22	P05
6449	g_6449	SS6238	">ATAC005662_11(AC005662|pid:g3894190) Arabidopsis thaliana   chromosome II BAC F13H10 genomic sequence, complete   sequence; "	DPlate 085	A09			AU032916	AU101856			22	A17
6450	g_6450	ST1067		DPlate 087	A09			AU174188	AU174189			22	B17
6451	g_6451	SS6270	>CELK11H12_2(U88168|pid:g1825597) Caenorhabditis elegans cosmid   K11H12; similar to E. coli bola protein (SP:P15298);   coded for by C. elegans cDNA CEESR81F. 	DPlate 085	B09			AU065978	AU101858			22	C17
6452	g_6452	ST1091	>HSAY18046_1(Y18046|pid:g4454263) Homo sapiens mRNA for FOP (FGFR1   oncogene partner). 	DPlate 087	B09			D39592	AU174194			22	D17
6453	g_6453	SS6278		DPlate 085	C09			AU065981				22	E17
6454	g_6454	ST1036	>(P32017) COLLAGEN ALPHA 3(IX) CHAIN PRECURSOR.   &CHK3ACOL_1(M83179|pid:g211041) 	DPlate 087	C09			D39568				22	F17
6455	g_6455	SS6294	">ATAC002505_26(AC002505|pid:g2739383) Arabidopsis thaliana   chromosome II BAC T9J22 genomic sequence, complete   sequence; unknown protein. "	DPlate 085	D09			D49192				22	G17
6456	g_6456	ST1084	>CELC15H9_2(U56965|pid:g1293835) Caenorhabditis elegans cosmid   C15H9; 	DPlate 087	D09			C23621	AU078277			22	H17
6457	g_6457	SS6224	">AF053565_1(AF053565|pid:g2995953) Mesembryanthemum crystallinum   glutaredoxin I mRNA, complete cds; thioltransferase. "	DPlate 085	E09			AU163132	AU174117			22	I17
6458	g_6458	ST1037		DPlate 087	E09			D39569	AU174187			22	J17
6459	g_6459	SS6248		DPlate 085	F09			C24945	AU174119			22	K17
6460	g_6460	ST1085		DPlate 087	F09			AU174193				22	L17
6461	g_6461	SS6264	>ATH9695_1(AJ009695|pid:g3355308) Arabidopsis thaliana wak4 gene. 	DPlate 085	G09			C24950	AU162136			22	M17
6462	g_6462	ST1093	">AF104329_1(AF104329|pid:g4206765) Arabidopsis thaliana putative   type 1 membrane protein (PMP) mRNA, complete cds. "	DPlate 087	G09			D39594	AU174195			22	N17
6463	g_6463	SS6280	>ZMDNAFER1_1(X83076|pid:g1103628) Z.mays Fer1 gene. 	DPlate 085	H09			D49189	AU082276			22	O17
6464	g_6464	ST1006		DPlate 087	H09			D39561	AU174183			22	P17
6465	g_6465	ST2107		DPlate 089	A03			D40258	AU101939			23	A05
6466	g_6466	ST4048	">LEU21801_1(U21801|pid:g717142) Lycopersicon esculentum alcohol   dehydrogenase homolog (GAD3) mRNA, partial cds; mRNA is   supressed in the presence of gibberellin; similar to   nonmetallo-short-chain alcohol dehydrogenases, PIR   Accession Number A47542. "	DPlate 091	A03			D41510	AU033144			23	B05
6467	g_6467	ST2123	">ATF13M23_3(AL035523|pid:g4455232) Arabidopsis thaliana DNA   chromosome 4, BAC clone F13M23 (ESSAII project);   similarity to acid phosphatase (EC 3.1.3.2) PAP,   Phaseolus vulgaris, PIR1:S51031. "	DPlate 089	B03			AU174246	AU161647			23	C05
6468	g_6468	ST4080		DPlate 091	B03			AU181050				23	D05
6469	g_6469	ST2131	">HVU54767_1(U54767|pid:g1314742) Hordeum vulgare caffeic acid   O-methyltransferase (HvCOMT) gene, complete cds. "	DPlate 089	C03			D40271	AU081603			23	E05
6470	g_6470	ST4096	>(P40392) RAS-RELATED PROTEIN RIC1. &S38740(S38740)   &S66160_1(S66160|pid:g432607) 	DPlate 091	C03			D41546	AU161680			23	F05
6471	g_6471	ST2163	>RCUNKN_1(Z81012|pid:g1621268) R.communis mRNA for unknown protein. 	DPlate 089	D03			D40291	AU101944			23	G05
6472	g_6472	ST4301	">AB012116_1(AB012116|pid:g4115538) Vigna mungo UFGlyT mRNA for   UDP-glycose:flavonoid glycosyltransferase, partial cds. "	DPlate 091	D03			D41652	AU174314			23	H05
6473	g_6473	ST2171		DPlate 089	E03			AU070535	AU097101			23	I05
6474	g_6474	ST4309	>(P20973) UBIQUITIN-ACTIVATING ENZYME E1 1. &A38373(A38373;A42873)   &WHTUBA1_1(M55604|pid:g170780) 	DPlate 091	E03			D41659	AU174316			23	J05
6475	g_6475	ST2116	">ATY16327_1(Y16327|pid:g3096947) Arabidopsis thaliana mRNA for   putative cyclic nucleotide-regulated ion channel, cngc1.   "	DPlate 089	F03			AU174245	AU101940			23	K05
6476	g_6476	ST4317	">TOMTPX2A_1(L13653|pid:g295355) Lycopersicon esculentum peroxidase   (TPX2) mRNA, complete cds. "	DPlate 091	F03			D41665				23	L05
6477	g_6477	ST2124	>YLGYP7_1(AJ001414|pid:g2370595) Yarrowia lipolytica gyp7 gene. 	DPlate 089	G03			AU077882	AU077883			23	M05
6478	g_6478	ST4373	">ATAC004747_11(AC004747|pid:g3413706) Arabidopsis thaliana   chromosome II BAC T19L18 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 091	G03			D41702	AU174331			23	N05
6479	g_6479	ST2172	>(P40978) 40S RIBOSOMAL PROTEIN S19. 	DPlate 089	H03			D40297	AU078162			23	O05
6480	g_6480	ST4374		DPlate 091	H03			AU066112	AU174332			23	P05
6481	g_6481	ST2957	">ATAC003105_7(AC003105|pid:g2760836) Arabidopsis thaliana chromosome   II BAC F18A8 genomic sequence, complete sequence; "	DPlate 089	A09			D40803	AU078066			23	A17
6482	g_6482	ST4869	>(P24231) PMBA PROTEIN (TLDE PROTEIN).   &AE000494_12(AE000494|pid:g1790682)   &ECOTLDE2_2(D44452|pid:g1732440)   &ECOUW93_148(U14003|pid:g537077)   &ECPMBA_1(X54152|pid:g42440)   &S13730(S13730;S56461;F65235) 	DPlate 091	A09							23	B17
6483	g_6483	ST2958	">ATAC004521_33(AC004521|pid:g3128203) Arabidopsis thaliana   chromosome II BAC F4I1 genomic sequence, complete   sequence; unknown protein. "	DPlate 089	B09			D40804				23	C17
6484	g_6484	ST4807	>(P51425) 60S RIBOSOMAL PROTEIN L39.   &ZMRPL39_1(X95458|pid:g1177369) 	DPlate 091	B09			D41860				23	D17
6485	g_6485	ST2990		DPlate 089	C09			D40828	AU097230			23	E17
6486	g_6486	ST4815	">AF016896_1(AF016896|pid:g2384758) Oryza sativa GDP dissociation   inhibitor protein OsGDI1 (OsGDI1) mRNA, complete cds;   GDP dissociation inhibitor1. "	DPlate 091	C09			D41864	AU161685			23	F17
6487	g_6487	ST2967	>(P28752) TUBULIN ALPHA-1 CHAIN. &OSTA274_1(X91808|pid:g1136124)   &OSTUBA1M_1(Z11931|pid:g20379) &S20758(S20758) 	DPlate 089	D09			D40811	AU108346			23	G17
6488	g_6488	ST4879		DPlate 091	D09			AU161690	AU161691			23	H17
6489	g_6489	ST2904		DPlate 089	E09			D40760	AU174270			23	I17
6490	g_6490	ST4840	">CEB0035_7(Z73102|pid:g3873699) Caenorhabditis elegans cosmid B0035,   complete sequence; predicted using Genefinder;   Similarity to viral non-structural proteins   (SW:POLN_EEVV3); cDNA EST EMBL:D65747 comes from this   gene; cDNA EST EMBL:D69295 comes from this gene; cDNA   EST EMBL:C10380 comes from this gene; cDNA EST   EMBL:C12052 comes from this gene; cDNA EST yk387a3.3   comes from this gene; cDNA EST yk365c11.3 comes from   this gene; cDNA EST yk365c11.5 comes from this gene. "	DPlate 091	E09			AU174339	AU174340			23	J17
6491	g_6491	ST2912		DPlate 089	F09			D40768	AU174271			23	K17
6492	g_6492	ST4848		DPlate 091	F09			AU102005	AU102004			23	L17
6493	g_6493	ST2928		DPlate 089	G09			D40780				23	M17
6494	g_6494	ST4872	">ATFCA0_24(Z97335|pid:g2244771) Arabidopsis thaliana DNA chromosome   4, ESSA I contig fragment No. 0; similarity to X.laevis   mRNA for KLP2 (kinesin-like protein required for   centrosome separation during mitosis). &H71402(H71402) "	DPlate 091	G09			D41894	AU161689			23	N17
6495	g_6495	ST2952		DPlate 089	H09			D40799	AU174274			23	O17
6496	g_6496	ST4880		DPlate 091	H09			AU174343	AU174344			23	P17
6497	g_6497	ST6005	">AC004557_12(AC004557|pid:g3935169) Genomic sequence for Arabidopsis   thaliana BAC F17L21, complete sequence; unknown;   similar to EST gb|AA650671 and gb|T20610. "	DPlate 093	A03			C25341	AU174379			24	A05
6498	g_6498	EE0874		DPlate 044	A06			C74319	AU162265			24	B05
6499	g_6499	ST6013	">ATF26P21_3(AL031804|pid:g3688172) Arabidopsis thaliana DNA   chromosome 4, BAC clone F26P21 (ESSAII project);   contains EST gb:R89997. "	DPlate 093	B03			C25344	AU174380			24	C05
6500	g_6500	EE0803		DPlate 044	B06			C74283	AU101417			24	D05
6501	g_6501	ST6021		DPlate 093	C03			AU181058				24	E05
6502	g_6502	EE0819	>ATDNACON_1(Y10556|pid:g2695705) A.thaliana constans gene.   &ATRNACON_1(Y10555|pid:g2695703) 	DPlate 044	C06			C74289	AU101418			24	F05
6503	g_6503	ST6029		DPlate 093	D03			C25350	AU167025			24	G05
6504	g_6504	EE0827		DPlate 044	D06			C74292				24	H05
6505	g_6505	ST6053	">F5O8_38(AC005990|pid:g4056467) Arabidopsis thaliana chromosome 1   BAC F5O8 sequence, complete sequence; Strong similarity   to gb|AB006693 spermidine synthase from Arabidopsis   thaliana. ESTs gb|AA389822, gb|T41794, gb|N38455,   gb|AI100106, gb|F14442 and gb|F14256 come from this   gene.. "	DPlate 093	E03			AU066279	AU174382			24	I05
6506	g_6506	EE0851	>YSCL8543_8(U20618|pid:g2258167) Saccharomyces cerevisiae chromosome   XII cosmid 8543; 	DPlate 044	E06			AU029480	AU029481			24	J05
6507	g_6507	ST6054	">ATJ000930_1(AJ000930|pid:g4454056) Arabidopsis thaliana, mRNA for   nuclear-encoded ClpP proteolytic subunit. "	DPlate 093	F03			AU066280	AU174383			24	K05
6508	g_6508	EE0867		DPlate 044	F06			AU058082				24	L05
6509	g_6509	ST6086		DPlate 093	G03			AU066285				24	M05
6510	g_6510	EE0875	">AF041433_1(AF041433|pid:g2791806) Mus musculus bet3 (Bet3) mRNA,   complete cds; similar to yeast Bet3p. "	DPlate 044	G06			C74320	AU166063			24	N05
6511	g_6511	ST6007	>EPRZ(S06427)phospholipid transfer protein homolog - rice 	DPlate 093	H03			AU033268	AU102035			24	O05
6512	g_6512	EE0812	">AF043521_1(AF043521|pid:g3421077) Arabidopsis thaliana 20S   proteasome subunit PAC1 (PAC1) mRNA, complete cds. "	DPlate 044	H06			AU058081	AU082527			24	P05
6513	g_6513	ST6234	">ATU63815_5(U63815|pid:g1532167) Arabidopsis thaliana AT.I.24-1,   AT.I.24-2, AT.I.24-3, AT.I.24-4, AT.I.24-5, AT.I.24-6,   AT.I.24-9 and AT.I.24-14 genes, partial cds, AT.I.24-7,   ascorbate peroxidase (ATHAPX1), EF-1alpha-A1, -A2 and   -A3 (EF-1alpha) and AT.I.24-13 genes, complete cds;   localized according to blastn similarity to EST   sequences; therefore, the coding span corresponds only   to an area of similarity since the initation codon and   stop codon could not be precisely determined. "	DPlate 093	A09			C25390	AU174396			24	A17
6514	g_6514	no clone										24	B17
6515	g_6515	ST6250		DPlate 093	B09			C25397	AU174398			24	C17
6516	g_6516	no clone										24	D17
6517	g_6517	ST6203		DPlate 093	C09			AU181061				24	E17
6518	g_6518	no clone										24	F17
6519	g_6519	ST6211	">ATAC003674_2(AC003674|pid:g2795804) Arabidopsis thaliana chromosome   II BAC F17A14 genomic sequence, complete sequence;   unknown protein. &ATAC004218_29(AC004218|pid:g3355492) "	DPlate 093	D09			AU066288	AU174391			24	G17
6520	g_6520	no clone										24	H17
6521	g_6521	ST6235		DPlate 093	E09			C25391				24	I17
6522	g_6522	no clone										24	J17
6523	g_6523	ST6283	">AF104221_1(AF104221|pid:g4039152) Arabidopsis thaliana low   temperature and salt responsive protein LTI6B (lti6b)   and low temperature and salt responsive protein LTI6A   (lti6a) genes, complete cds.   &AF122006_1(AF122006|pid:g4325219) "	DPlate 093	F09			AU066298				24	K17
6524	g_6524	no clone										24	L17
6525	g_6525	ST6236	">ATAC007017_27(AC007017|pid:g4510387) Arabidopsis thaliana   chromosome II BAC F11F19 genomic sequence, complete   sequence; unknown protein. "	DPlate 093	G09			AU070633				24	M17
6526	g_6526	no clone										24	N17
6527	g_6527	ST6284		DPlate 093	H09			AU161904				24	O17
6528	g_6528	no clone										24	P17
6529	g_6529	EG0542	">AF081922_1(AF081922|pid:g3421413) Oryza sativa protein phosphatase   2A 55 kDa B regulatory subunit gene, complete cds.   &AF081923_1(AF081923|pid:g3421415) "	DPlate 050	A03			AU030041	AU101474			13	A06
6530	g_6530	EG1252	">ATF17L22_4(AL035527|pid:g4455266) Arabidopsis thaliana DNA   chromosome 4, BAC clone F17L22 (ESSAII project);   similarity to Pig3 Homo sapiens, PID:g2754812; contains   EST gb:T04375, T20767, AA712527, AA712507.   &ATF18E5_20(AL022603|pid:g3080402) "	DPlate 052	A03			AU172981	AU058444			13	B06
6531	g_6531	EG0550	">AF034948_1(AF034948|pid:g2668748) Zea mays ribosomal protein L17   (rpl17) mRNA, complete cds. "	DPlate 050	B03			AU030043	AU030044			13	C06
6532	g_6532	EG1260	">ATF20B18_21(AL049483|pid:g4538939) Arabidopsis thaliana DNA   chromosome 4, BAC clone F20B18 (ESSA project); several   discrepancies between PID:g549973 and this protein;   Contains Protein kinases signatures and profile,   Protein_Kinase_Atp [IGSGSFGEIYLGTNIHTNEELAIK],   Protein_Kinase_St [FLHRDLKPDNFLM]. "	DPlate 052	B03			AU030574	AU030575			13	D06
6533	g_6533	EG0566		DPlate 050	C03			AU030055				13	E06
6534	g_6534	EG1292		DPlate 052	C03			AU065751	AU030601			13	F06
6535	g_6535	EG0582		DPlate 050	D03			AU058349	AU164448			13	G06
6536	g_6536	EG1237	">AF020193_1(AF020193|pid:g2895198) Glycine max DNA polymerase delta   (Pol delta) mRNA, complete cds; DNA-dependent DNA   polymerase. "	DPlate 052	D03			AU030559	AU101484			13	H06
6537	g_6537	EG0590	>HVJ001161_1(AJ001161|pid:g2739219) Hordeum vulgare S28 ribosomal   protein. 	DPlate 050	E03			AU030070				13	I06
6538	g_6538	EG1253	">AB017876_1(AB017876|pid:g4519792) Arabidopsis thaliana mRNA for   Asp1, complete cds.   &ATAC004684_5(AC004684|pid:g3236238) "	DPlate 052	E03			AU176493	AU176494			13	J06
6539	g_6539	EG0535	">ATAC006532_4(AC006532|pid:g4406780) Arabidopsis thaliana chromosome   II BAC F14H20 genomic sequence, complete sequence; "	DPlate 050	F03			AU065608	AU030040			13	K06
6540	g_6540	EG1261	">AE001491_6(AE001491|pid:g4155128) Helicobacter pylori, strain J99   section 52 of 132 of the complete genome; "	DPlate 052	F03			AU065743	AU030576			13	L06
6541	g_6541	EG0575		DPlate 050	G03			AU065613	AU030061			13	M06
6542	g_6542	EG1277	">AB001375_1(AB001375|pid:g1854386) Vitis vinifera mRNA for soluble   NSF attachment protein homologue, complete cds; similar   to soluble NSF attachment protein. "	DPlate 052	G03			AU030590	AU095110			13	N06
6543	g_6543	EG0504		DPlate 050	H03			AU076188	AU076189			13	O06
6544	g_6544	EG1206		DPlate 052	H03			AU162302	AU058436			13	P06
6545	g_6545	EG0614	>(P17473) TRANS-ACTING TRANSCRIPTIONAL PROTEIN ICP4 (155 KD   IMMEDIATE-EARLY PROTEIN). &EDBEE1(A33764)   &HSEIEP_1(J04366|pid:g330911) 	DPlate 050	A09			AU030091	AU030092			13	A18
6546	g_6546	EH0161	">(P30792) 2,3-BISPHOSPHOGLYCERATE-INDEPENDENT PHOSPHOGLYCERATE   MUTASE (EC 5.4.2.1) (PHOSPHOGLYCEROMUTASE)   (BPG-INDEPENDENT PGAM). &A42807(A42807;JC2540)   &MZEPPGM_1(M80912|pid:g168588) "	DPlate 052	A09			AU172989	AU030731			13	B18
6547	g_6547	EG0622	">ATAC002387_2(AC002387|pid:g2583108) Arabidopsis thaliana chromosome   II BAC F4L23 genomic sequence, complete sequence; "	DPlate 050	B09			AU172961	AU172962			13	C18
6548	g_6548	EH0177		DPlate 052	B09			AU030745	AU101492			13	D18
6549	g_6549	EG0631		DPlate 050	C09			AU058356	AU075771			13	E18
6550	g_6550	EH0185	">SPAC4F10_15(Z98980|pid:g2388986) S.pombe chromosome I cosmid c4F10;   SPAC4F10.15c, probable actin associated protein,   len:574aa, similar eg. to YOR181W, LA17_YEAST, Q12446,   component of actin cortical patches; proline rich,   (633aa), fasta scores, opt:839, E():6.8e-22, (35.1%   identity in 650 aa overlap). "	DPlate 052	C09			AU065166	AU095133			13	F18
6551	g_6551	EG0647	>(P46294) 40S RIBOSOMAL PROTEIN S16.   &RICRPSAAA_1(L36313|pid:g538428) 	DPlate 050	D09			AU030117	AU030118			13	G18
6552	g_6552	EH0106	">ATF7J7_8(AL021960|pid:g2911071) Arabidopsis thaliana DNA chromosome   4, BAC clone F7J7 (ESSAII project); "	DPlate 052	D09			AU030680	AU030681			13	H18
6553	g_6553	EG0679	>MSPROTSM_1(Z71998|pid:g1524178) M.sativa mRNA for proteasome   subunit; plant homolog of the yeast Y13 proteasome   subunit. 	DPlate 050	E09			AU058365	AU030138			13	I18
6554	g_6554	EH0130		DPlate 052	E09			AU172988	AU030703			13	J18
6555	g_6555	EG0640		DPlate 050	F09			AU030110	AU030111			13	K18
6556	g_6556	EH0138		DPlate 052	F09			AU165869	AU030712			13	L18
6557	g_6557	EG0648	">D89053_1(D89053|pid:g4165018) Homo sapiens mRNA for Acyl-CoA   synthetase 3, complete cds. "	DPlate 050	G09			AU065623	AU030119			13	M18
6558	g_6558	EH0194	">AF033535_1(AF033535|pid:g3252866) Arabidopsis thaliana putative   zinc transporter (ZIP1) mRNA, complete cds. "	DPlate 052	G09			AU030756	AU030757			13	N18
6559	g_6559	EG0688		DPlate 050	H09			AU030150	AU030151			13	O18
6560	g_6560	EH0139	">ATAC006921_10(AC006921|pid:g4510348) Arabidopsis thaliana   chromosome II BAC F2H17 genomic sequence, complete   sequence; unknown protein. "	DPlate 052	H09			AU030713	AU030714			13	P18
6561	g_6561	EH0795		DPlate 054	A03			AU173025	AU075500			14	A06
6562	g_6562	EH1432		DPlate 056	A03			AU031368	AU095340			14	B06
6563	g_6563	EH0748		DPlate 054	B03			AU173016	AU173017			14	C06
6564	g_6564	EH1496		DPlate 056	B03			AU162354				14	D06
6565	g_6565	EH0764	">ATAC004521_11(AC004521|pid:g3128176) Arabidopsis thaliana   chromosome II BAC F4I1 genomic sequence, complete   sequence; unknown protein. "	DPlate 054	C03			AU075478	AU075479			14	E06
6566	g_6566	EH1549		DPlate 056	C03			AU173054	AU082151			14	F06
6567	g_6567	EH0772	">AF085276_1(AF085276|pid:g3599483) Drosophila melanogaster MEI-W68   (mei-W68) mRNA, complete cds; similar to spo11. "	DPlate 054	D03			AU075487	AU075488			14	G06
6568	g_6568	EH1565	>STPRORICH_1(AJ000997|pid:g3402282) Solanum tuberosum mRNA for guard   cell proline-rich protein. 	DPlate 056	D03			AU173055				14	H06
6569	g_6569	EH0780	>S39045(S39045) probable finger protein WZF1 - wheat   &WHTWZF1A_1(D16415|pid:g485814)   &WHTWZF1B_1(D16416|pid:g485816) 	DPlate 054	E03			AU075492	AU031093			14	I06
6570	g_6570	EH1550		DPlate 056	E03			C91883				14	J06
6571	g_6571	EH0788	">AF016713_1(AF016713|pid:g4102839) Lycopersicon esculentum   oligopeptide transporter (LeOPT1) mRNA, complete cds;   oligopeptide transporter. "	DPlate 054	F03			AU075497	AU075496			14	K06
6572	g_6572	EH1519	">F17O7_16(AC003671|pid:g3176685) Arabidopsis thaliana chromosome 1   BAC F17O7 complete sequence; Strong similarity to   spermidine synthase 1, gb|Y08252 and possibly closer   similarity to spermidine synthase 2 gb|Y08253 from   Datura stramonium. ESTs gb|N38155, gb|T41738,   gb|AA597626, gb|AA712967 and gb|AA712346 come from this   gene.. "	DPlate 056	F03			AU162356	AU031412			14	L06
6573	g_6573	EH0796	">ATAC006201_5(AC006201|pid:g4406810) Arabidopsis thaliana chromosome   II BAC T27K22 genomic sequence, complete sequence;   unknown protein. "	DPlate 054	G03			AU075501	AU031096			14	M06
6574	g_6574	EH1543	">D63166_1(D63166|pid:g1418127) Brassica napus mRNA for   CTP:phosphocholine cytidylyltransferase, complete cds. "	DPlate 056	G03			AU070161	AU173053			14	N06
6575	g_6575	EH0801		DPlate 054	H03			AU031097				14	O06
6576	g_6576	EH1567	>T15F16_13(AF076275|pid:g3377813) Arabidopsis thaliana BAC T15F16;   coded for by A. thaliana cDNA N97271. 	DPlate 056	H03			AU162358	AU031434			14	P06
6577	g_6577	EH0989	">ATAC006403_9(AC006403|pid:g4337195) Arabidopsis thaliana chromosome   II BAC T28I24 genomic sequence, complete sequence; "	DPlate 054	A09			AU031147	AU095267			14	A18
6578	g_6578	EH1741		DPlate 056	A09			AU162367				14	B18
6579	g_6579	EH0918	>(Q40634) 1-AMINOCYCLOPROPANE-1-CARBOXYLATE OXIDASE (ACC OXIDASE)   (ETHYLENE- FORMING ENZYME) (EFE).   &OS1A1COX_1(X85747|pid:g755773) &S52712(S52712) 	DPlate 054	B09			AU031123	AU101524			14	C18
6580	g_6580	EH1765	">ATF1N20_2(AL022140|pid:g2961337) Arabidopsis thaliana DNA   chromosome 4, BAC clone F1N20 (ESSAII project);   predicted. &ATT8O5_13(AL021890|pid:g2894570) "	DPlate 056	B09			AU101579	AU101580			14	D18
6581	g_6581	EH0942	">TAU91981_1(U91981|pid:g4099919) Triticum aestivum pollen allergen   homolog mRNA, complete cds; ps93. "	DPlate 054	C09			AU101525	AU101526			14	E18
6582	g_6582	EH1718		DPlate 056	C09			AU164891	AU065322			14	F18
6583	g_6583	EH0958	">ATFCA6_29(Z97341|pid:g2245020) Arabidopsis thaliana DNA chromosome   4, ESSA I contig fragment No. 6; similarity to   auxin-independent growth promoter - Nicotiana tabacum.   &F71433(F71433) "	DPlate 054	D09			AU031134	AU031135			14	G18
6584	g_6584	EH1742	>CELF46F11_2(U88173|pid:g1825645) Caenorhabditis elegans cosmid   F46F11; weak similarity to Arabidopsis thaliana   ubiquitin-like protein 8. 	DPlate 056	D09			AU164903	AU164904			14	H18
6585	g_6585	EH0928	">ATF18F4_17(AL021637|pid:g2827661) Arabidopsis thaliana DNA   chromosome 4, BAC clone F18F4 (ESSAII project); Protein   sequence is in conflict with the conceptual translation;   5-substituted hydantoins to the corresponding L-amino   acids, Pseudomonas sp., PIR2:D42594; contains EST   gb:T45208. "	DPlate 054	E09			AU065261	AU095249			14	I18
6586	g_6586	EH1782	">ATAC002332_14(AC002332|pid:g2459420) Arabidopsis thaliana   chromosome II BAC F4P9 genomic sequence, complete   sequence; "	DPlate 056	E09			AU164921	AU164922			14	J18
6587	g_6587	EH0952	">ATAC002391_19(AC002391|pid:g2642443) Arabidopsis thaliana   chromosome II BAC T20D16 genomic sequence, complete   sequence; "	DPlate 054	F09			AU031131				14	K18
6588	g_6588	EH1711		DPlate 056	F09			AU101576	AU101575			14	L18
6589	g_6589	EH0921	">GMU51191_1(U51191|pid:g4204759) Glycine max peroxidase precursor   (sEPa1) mRNA, partial cds. "	DPlate 054	G09			AU173033	AU173034			14	M18
6590	g_6590	EH1775	>(P20346) PROBABLE PROTEASE INHIBITOR P322 PRECURSOR.   &S05594(S05594;S45659) &ST322R_1(X13180|pid:g21394) 	DPlate 056	G09			AU078248	AU078249			14	N18
6591	g_6591	EH0961		DPlate 054	H09			AU031136	AU101527			14	O18
6592	g_6592	EH1720		DPlate 056	H09			AU164892				14	P18
6593	g_6593	FE0146	>HVACYLCOA_1(AJ001341|pid:g2370232) Hordeum vulgare mRNA for   putative acyl-CoA oxidase. 	DPlate 058	A03			AU181005				15	A06
6594	g_6594	FL0189		DPlate 060	A03			AU175041				15	B06
6595	g_6595	FE0162	">D87042_1(D87042|pid:g1504052) Zea mays mRNA for Calcium-dependent   protein kinase, complete cds. "	DPlate 058	B03			AU174641	AU174640			15	C06
6596	g_6596	FL0134	">RICTPI2A_1(L04967|pid:g553107) Oryza sativa triosephosphate   isomerase (Rictipi2) gene, exons 1-9. "	DPlate 060	B03			AU174988	AU174989			15	D06
6597	g_6597	FE0170	">ATF10M6_2(AL021811|pid:g2864609) Arabidopsis thaliana DNA   chromosome 4, BAC clone F10M6 (ESSAII project);   similarity to trichohyalin, Homo sapiens, PIR1:A45973.   &ATF8B4_5(AL034567|pid:g4049337) "	DPlate 058	C03			AU174650	AU174651			15	E06
6598	g_6598	FL0142	">ATF4B14_8(AL031986|pid:g3805847) Arabidopsis thaliana DNA   chromosome 4, BAC clone F4B14 (ESSAII project);   similarity to prolyl 4-hydroxylase alpha (II) subunit,   Homo sapiens, gb:U90441. "	DPlate 060	C03			AU174995	AU174996			15	F06
6599	g_6599	FE0178	">ATAC002341_6(AC002341|pid:g2342723) Arabidopsis thaliana chromosome   II BAC T14G11 genomic sequence, complete sequence;   unknown protein. "	DPlate 058	D03			AU174656	AU174655			15	G06
6600	g_6600	FL0166	">ATU64906_1(U64906|pid:g4097547) Arabidopsis thaliana farnesylated   protein ATFP3 mRNA, partial cds; farnesylated protein. "	DPlate 060	D03			AU175014	AU175013			15	H06
6601	g_6601	FE0186	>(P76093) HYPOTHETICAL 49.6 KD PROTEIN IN MAOC-ACPD INTERGENIC   REGION. &AE000238_6(AE000238|pid:g1787679)   &F64892(F64892) 	DPlate 058	E03			AU174666	AU174665			15	I06
6602	g_6602	FL0182	>(P42673) PYRROLIDONE-CARBOXYLATE PEPTIDASE (EC 3.4.19.3)   (5-OXOPROLYL- PEPTIDASE) (PYROGLUTAMYL-PEPTIDASE I).   &A55583(A55583;S38638) &PFPCP_1(X75919|pid:g415891) 	DPlate 060	E03			AU175036	AU175035			15	J06
6603	g_6603	FE0115		DPlate 058	F03			AU174612				15	K06
6604	g_6604	FL0103	">ATAC004261_25(AC004261|pid:g3402719) Arabidopsis thaliana   chromosome II BAC T3K9 genomic sequence, complete   sequence; unknown protein. "	DPlate 060	F03			AU174967	AU174966			15	L06
6605	g_6605	FE0139	>(P20973) UBIQUITIN-ACTIVATING ENZYME E1 1. &A38373(A38373;A42873)   &WHTUBA1_1(M55604|pid:g170780) 	DPlate 058	G03			AU174629	AU174628			15	M06
6606	g_6606	FL0111		DPlate 060	G03			AU174971	AU174970			15	N06
6607	g_6607	FE0155	>(P12331) CHLOROPHYLL A-B BINDING PROTEIN OF LHCII TYPE I PRECURSOR   (CAB-2)D (LHCP). &OSCABR2_1(X13909|pid:g20182)   &S03706(S03706) 	DPlate 058	H03			AU174637	AU174636			15	O06
6608	g_6608	FL0119	">OLRKLP2_1(U72725|pid:g2586083) Oryza longistaminata receptor   kinase-like protein gene, family member A1, complete cds;   Xa21 gene family member A1; downstream of microsatellite   region; disease resistance gene family member. "	DPlate 060	H03			AU174977	AU174976			15	P06
6609	g_6609	FE0207	>ATABI2DNA_1(Y08966|pid:g1945140) A.thaliana gene encoding ABI2   protein. &ATABI2RNA_1(Y08965|pid:g1945142)   &ATABI2_1(Y11840|pid:g2564213) 	DPlate 058	A09			AU174682	AU174683			15	A18
6610	g_6610	RA0011		DPlate 060	A09			D23728	AU101590			15	B18
6611	g_6611	FE0224	">ATT9A14_6(AL035656|pid:g4490330) Arabidopsis thaliana DNA chromosome   4, BAC clone T9A14 (ESSA project); strong similarity to   splicing factor Prp8, Homo sapiens, AF092565; contains   EST gb:T14115. "	DPlate 058	B09			AU174695	AU174696			15	C18
6612	g_6612	RA0051		DPlate 060	B09			D23744	AU070168			15	D18
6613	g_6613	FE0248		DPlate 058	C09			AU174710	AU174709			15	E18
6614	g_6614	RA0091		DPlate 060	C09			AU164491	AU164492			15	F18
6615	g_6615	FE0264	">ATF4I10_10(AL035525|pid:g4455331) Arabidopsis thaliana DNA chromosome   4, BAC clone F4I10 (ESSAII project); similarity to   various predicted proteins, Arabidopsis thaliana;   Contains KDPG and KHG aldolases active site signatures,   Aldolase_Kdpg_Khg_1 [GLNPNEITLR], Cytochrome c family   heme-binding site signature, Cytochrome_C [CGDCHN]. "	DPlate 058	D09			AU174722				15	G18
6616	g_6616	RA0044		DPlate 060	D09			D23739	AU031630			15	H18
6617	g_6617	FE0288	>NTHIN1_1(Y07563|pid:g1619321) N.tabacum mRNA for hin1 gene. 	DPlate 058	E09			AU174736	AU174735			15	I18
6618	g_6618	RA0076		DPlate 060	E09			AU075823	D23755			15	J18
6619	g_6619	FE0296	>(P12091) DNA-DIRECTED RNA POLYMERASE BETA CHAIN (EC 2.7.7.6).   &CHOSXX_14(X15901|pid:g11971) &RNRZB(JQ0213;S05093) 	DPlate 058	F09			AU174743	AU174742			15	K18
6620	g_6620	RA0084	">AF027173_1(AF027173|pid:g2827141) Arabidopsis thaliana cellulose   synthase catalytic subunit (Ath-A) mRNA, complete cds;   RSW1-like. "	DPlate 060	F09			D23761	AU173060			15	L18
6621	g_6621	FE0325		DPlate 058	G09			AU174760	AU174759			15	M18
6622	g_6622	RA0045	">ATF28A23_2(AL021961|pid:g2911040) Arabidopsis thaliana DNA chromosome   4, BAC clone F28A23 (ESSAII project); similarity to   protein kinase TMKL1, Arabidopsis thaliana,   PATCHX:E353150; contains EST gb:N38144, AA395810, N38554,   N38553, N38550, N38543, T45570, AA394573. "	DPlate 060	G09			D23740	AU164487			15	N18
6623	g_6623	FE0357		DPlate 058	H09			AU174781	AU174780			15	O18
6624	g_6624	RA0078	">RICAD79A_1(D25236|pid:g2160314) Rice mRNA for   1-3,1-4-beta-glucanase (gene name AD79), partial cds;   possible 1-3,1-4-beta-glucanase coding sequence. "	DPlate 060	H09			D23757	AU164490			15	P18
6625	g_6625	RA0606	>CELT04B8_4(AF040650|pid:g2746850) Caenorhabditis elegans cosmid   T04B8; coded for by C. elegans cDNA CEESN87F. 	DPlate 062	A03			D23934	AU162385			16	A06
6626	g_6626	RA1609		DPlate 064	A03			D24265	C20487			16	B06
6627	g_6627	RA0622	">AF001634_1(AF001634|pid:g2226329) Zea mays physical impedance   induced protein (IIG1) mRNA, complete cds; the mRNA was   detected in root tips after 10-minutes of external   pressure. "	DPlate 062	B03			D23942	AU082154			16	C06
6628	g_6628	RA1642		DPlate 064	B03			AU173184				16	D06
6629	g_6629	RA0646	">AF063866_230(AF063866|pid:g4049753) Melanoplus sanguinipes   entomopoxvirus, complete genome. "	DPlate 062	C03			AU031701	AU031702			16	E06
6630	g_6630	RA1650	">ZMU89341_1(U89341|pid:g3294467) Zea mays phosphoglucomutase 1 mRNA,   complete cds. "	DPlate 064	C03			AU173193	AU173194			16	F06
6631	g_6631	RA0654	">ATT16L1_13(AL031394|pid:g3549666) Arabidopsis thaliana DNA   chromosome 4, BAC clone T16L1 (ESSAII project); contains   EST gb:T22045, T45605, AA712902, AA394605, AA042433. "	DPlate 062	D03			D23956	AU101628			16	G06
6632	g_6632	RA1682		DPlate 064	D03			AU176520				16	H06
6633	g_6633	RA0670		DPlate 062	E03			AU173101	AU081356			16	I06
6634	g_6634	RA1635		DPlate 064	E03			D24285	AU173181			16	J06
6635	g_6635	RA0631		DPlate 062	F03			AU164590				16	K06
6636	g_6636	RA1667	">D78173_1(D78173|pid:g2285802) Spinacia oleracea mRNA for 26S   proteasome alpha subunit, complete cds. "	DPlate 064	F03			AU173201	AU173202			16	L06
6637	g_6637	RA0639	">ATT4L20_2(AL023094|pid:g3641836) Arabidopsis thaliana DNA   chromosome 4, BAC clone T4L20 (ESSAII project);   similarity to Daucus carota somatic embryogenesis   receptor-like kinase; Contains Protein kinases   signatures and profile, Protein_Kinase_Atp   [LGQGGFGYVHKGVLPSGKEVAVK], Protein_Kinase_St   [IIHRDIKAANILL]. "	DPlate 062	G03			D23945	C22580			16	M06
6638	g_6638	RA1612		DPlate 064	G03			D24268				16	N06
6639	g_6639	RA0647		DPlate 062	H03			D23952				16	O06
6640	g_6640	RA1620		DPlate 064	H03			D24274	AU173177			16	P06
6641	g_6641	RA0822		DPlate 062	A09			D24004				16	A18
6642	g_6642	RA1775	">AF059288_1(AF059288|pid:g4415992) Eleusine indica beta-tubulin 2   (TUB2) mRNA, complete cds. "	DPlate 064	A09			D24351	AU173227			16	B18
6643	g_6643	RA0830		DPlate 062	B09			D28291	AU031720			16	C18
6644	g_6644	RA1712	>ATATP20A_1(X98806|pid:g1546694) A.thaliana mRNA for peroxidase   ATP20a; peroxidase ATP20a. 	DPlate 064	B09			D24310	C20489			16	D18
6645	g_6645	RA0862		DPlate 062	C09			D24015	AU164640			16	E18
6646	g_6646	RA1736	">AF111029_1(AF111029|pid:g4038471) Zea mays 40S ribosomal protein   S27 homolog mRNA, complete cds. "	DPlate 064	C09			D24325	AU095457			16	F18
6647	g_6647	RA0870		DPlate 062	D09			D24017	AU164641			16	G18
6648	g_6648	RA1744	>(P37834) PEROXIDASE PRECURSOR (EC 1.11.1.7).   &RICPEROX_1(D14997|pid:g287401) 	DPlate 064	D09			D24331	AU083492			16	H18
6649	g_6649	RA0887	">AB015431_1(AB015431|pid:g3288883) Oryza sativa mRNA for SAR DNA   binding protein, partial cds; 3' portion of this coding   sequence contains an A-rich stretch; homologous to SAR   DNA binding protein from pea: GenBank accession number   AF061962 and AF061963. "	DPlate 062	E09			D24026	AU031724			16	I18
6650	g_6650	RA1752	">ATF24G24_16(AL049488|pid:g4538965) Arabidopsis thaliana DNA   chromosome 4, BAC clone F24G24 (ESSA project); contains   EST gb:AA597424, AA597522, T04526, AA585961. "	DPlate 064	E09							16	J18
6651	g_6651	RA0933	">AF012896_1(AF012896|pid:g2293566) Oryza sativa ADP-ribosylation   factor 1 (Os-ARF1) mRNA, complete cds. "	DPlate 062	F09			D39042	AU081578			16	K18
6652	g_6652	RA1792	>(P22198) SERINE/THREONINE PROTEIN PHOSPHATASE PP1 (EC 3.1.3.16).   &MZEZMPP1_1(M60215|pid:g168723) &S29317(S29317) 	DPlate 064	F09			D24366	AU031798			16	L18
6653	g_6653	RA0965	>(P46290) 60S RIBOSOMAL PROTEIN L31.   &NGU23784_1(U23784|pid:g915313) 	DPlate 062	G09			AU070178	AU164653			16	M18
6654	g_6654	RA1737	">AF022735_1(AF022735|pid:g2570505) Oryza sativa proteasome component   mRNA, complete cds. "	DPlate 064	G09			D24326	AU031787			16	N18
6655	g_6655	RA0981		DPlate 062	H09			AU070182	AU095441			16	O18
6656	g_6656	RA1745		DPlate 064	H09			AU173216				16	P18
6657	g_6657	RA2170	">ATAC006232_4(AC006232|pid:g4314378) Arabidopsis thaliana chromosome   II BAC F10A12 genomic sequence, complete sequence; "	DPlate 066	A03			D28315	AU031852			17	A06
6658	g_6658	RA3027	>PRSTARPA_1(Z30339|pid:g535260) P.reichenowi STARP gene for STARP   antigen. 	DPlate 068	A03			D39206				17	B06
6659	g_6659	RA2178	">AF042332_1(AF042332|pid:g3560531) Oryza sativa subsp. japonica   cycloartenol-C24-methyltransferase mRNA, complete cds. "	DPlate 066	B03			D24567	AU173325			17	C06
6660	g_6660	RA3051	">ATAP22_8(Z99708|pid:g2464901) Arabidopsis thaliana DNA chromosome   4, ESSA I AP2 contig fragment No. 2; similar to   hypothetical protein, Synechocystis sp., PIR2:S76669. "	DPlate 068	B03			D39215	AU070190			17	D06
6661	g_6661	RA2194	">ATAC005896_25(AC005896|pid:g4056506) Arabidopsis thaliana   chromosome II BAC F3G5 genomic sequence, complete   sequence; "	DPlate 066	C03			D24576	AU031856			17	E06
6662	g_6662	RA3059	>(P46465) PROBABLE 26S PROTEASE SUBUNIT TBP-1 (TAT-BINDING PROTEIN   HOMOLOG 1). &RICHTNP1_1(D17788|pid:g556560) 	DPlate 068	C03			D39221	AU162453			17	F06
6663	g_6663	RA2115		DPlate 066	D03			AU173309	AU173310			17	G06
6664	g_6664	RA3075		DPlate 068	D03			D39233	AU173432			17	H06
6665	g_6665	RA2123	>(Q55511) TRIGGER FACTOR (TF). &S76021(S76021)   &SYCSLLLH_90(D64006|pid:g1001378) 	DPlate 066	E03			D24535	AU031846			17	I06
6666	g_6666	RA3091		DPlate 068	E03			D39244	AU031999			17	J06
6667	g_6667	RA2147	>(P24120) SALT-STRESS INDUCED PROTEIN (SALT PROTEIN). 	DPlate 066	F03			D24547	AU095460			17	K06
6668	g_6668	RA3044	">S68015_1(S68015|pid:g461033) c6.1A [human, mRNA, 1020 nt]; This   sequence comes from Fig. 2; Author's stop to stop   translation. "	DPlate 068	F03			AU173426	AU173427			17	L06
6669	g_6669	RA2163		DPlate 066	G03			D24557	AU173321			17	M06
6670	g_6670	RA3060	">AF097182_1(AF097182|pid:g3859548) Oryza sativa protein phosphatase   2A catalytic subunit (Pp2a) gene, complete cds. "	DPlate 068	G03			D39222	AU173430			17	N06
6671	g_6671	RA2171	">CEF52H3_1(Z66512|pid:g3877395) Caenorhabditis elegans cosmid F52H3,   complete sequence; similar to galactoside-binding lectin;   cDNA EST EMBL:M89116 comes from this gene; cDNA EST   EMBL:M89121 comes from this gene; cDNA EST EMBL:D27141   comes from this gene; cDNA EST EMBL:D27143 comes from   this gene; cDNA EST EMBL:D27142 comes from this gene;   cDNA EST EMBL:D27140 comes from this gene; cDNA EST   EMBL:D34308 comes from this gene; cDNA EST EMBL:D34466   comes from this gene; cDNA EST EMBL:D74665 comes from   this gene; cDNA EST EMBL:D74498 comes from this gene;   cDNA EST EMBL:D76119 comes from this gene; cDNA EST   EMBL:T00726 comes from this gene; cDNA EST EMBL:T02432   comes from this gene; cDNA EST EMBL:D33051 comes from   this gene; cDNA EST EMBL:D34359 comes from this gene;   cDNA EST EMBL:D34491 comes from this gene; cDNA EST   EMBL:D37595 comes from this gene; cDNA EST EMBL:D35785   comes from this gene; cDNA EST EMBL:D37401 comes from   this gene; cDNA EST EMBL:D37534 comes from this gene;   cDNA EST EMBL:D37560 comes from this gene; cDNA EST   EMBL:C10212 comes from this gene; cDNA EST EMBL:C11728   comes from this gene; cDNA EST EMBL:C11999 comes from   this gene. "	DPlate 066	H03			D24562	AU031853			17	O06
6672	g_6672	RA3068	">AF034387_1(AF034387|pid:g3478700) Arabidopsis thaliana AFT protein   (AFT) mRNA, complete cds. "	DPlate 068	H03			D39227	AU031990			17	P06
6673	g_6673	RA2349	">D83970_1(D83970|pid:g1854443) Vigna unguiculata mRNA for CPRD8   protein, complete cds. "	DPlate 066	A09			D24670	AU031877			17	A18
6674	g_6674	RA3131	">STPT1_1(X98890|pid:g1420871) S.tuberosum mRNA for inorganic   phosphate transporter, StPT1. "	DPlate 068	A09			D25087	AU032009			17	B18
6675	g_6675	RA2366		DPlate 066	B09			D24679	AU162432			17	C18
6676	g_6676	RA3139	>T12H20_3(AF080119|pid:g3600039) Arabidopsis thaliana BAC T12H20;   similar to Schizosaccharomyces pombe isp4 protein   (GB:D14061). 	DPlate 068	B09			D25093	AU082160			17	D18
6677	g_6677	RA2374	">CTRP450B_1(L19075|pid:g404690) Catharanthus roseus Cp3 cytochrome   450 (CYP72C) mRNA, 3' end; putative. "	DPlate 066	C09			D24685	AU031882			17	E18
6678	g_6678	RA3163		DPlate 068	C09			AU173446	AU173447			17	F18
6679	g_6679	RA2382	">ATAC002505_23(AC002505|pid:g2739381) Arabidopsis thaliana   chromosome II BAC T9J22 genomic sequence, complete   sequence; "	DPlate 066	D09			AU031883	AU031884			17	G18
6680	g_6680	RA3179		DPlate 068	D09			AU173452	AU173453			17	H18
6681	g_6681	RA2311		DPlate 066	E09			D28318				17	I18
6682	g_6682	RA3108	">RICOSH45S2_2(D49704|pid:g1805618) Rice OSH45 gene for OSH42, OSH44   and OSH45 transcripts, exon 2, 3, 4, 5, 6 and 7,   complete cds; OSH45 transcript. "	DPlate 068	E09			AU173437	AU173438			17	J18
6683	g_6683	RA2327		DPlate 066	F09			D39133	AU173349			17	K18
6684	g_6684	RA3124	">NTAJ3330_1(AJ223330|pid:g2894308) Nicotiana tabacum TUQG4 gene,   complete CDS. "	DPlate 068	F09			D25081	AU101669			17	L18
6685	g_6685	RA2367	">ATF18E5_11(AL022603|pid:g3080393) Arabidopsis thaliana DNA   chromosome 4, BAC clone F18E5 (ESSAII project); strong   similarity to NADH dehydrogenase (ubiquinone) (EC   1.6.5.3)chain NDI1 yeast, Pir2:S26704 and other NADH   dehydrogenases; contains EST gb:T41616, AA586068. "	DPlate 066	G09			D24680	AU031879			17	M18
6686	g_6686	RA3156	">SBPPSTK2_1(Y12465|pid:g2632254) S.bicolor mRNA for putative protein   serine/threonine kinase, clone cSNFL2. "	DPlate 068	G09			D25101	C22607			17	N18
6687	g_6687	RA2383	>ATCTRPPRO_1(Z49859|pid:g1082054) A.thaliana mRNA for copper   transporter protein. 	DPlate 066	H09			D24691	AU173351			17	O18
6688	g_6688	RA3188	">DMC62D9_17(AL009171|pid:g2655888) Drosophila melanogaster cosmid   62D9, WORKING DRAFT SEQUENCE; predicted using Genefinder;   preliminary prediction. "	DPlate 068	H09			D25108	AU032015			17	P18
6689	g_6689	RA3638	">ATAC006836_15(AC006836|pid:g4406764) Arabidopsis thaliana   chromosome II BAC F19B11 genomic sequence, complete   sequence; "	DPlate 070	A03			AU032155	AU101684			18	A06
6690	g_6690	RB0395	">ATAC001645_18(AC001645|pid:g2062170) Arabidopsis thaliana   chromosome III BAC T02O04 genomic sequence, complete   sequence; unknown protein. "	DPlate 072	A03			AU070870				18	B06
6691	g_6691	RA3670	>CELF02E8_3(U53340|pid:g1255862) Caenorhabditis elegans cosmid   F02E8; weak similarities to beta transducin family. 	DPlate 070	B03			AU032187	AU032188			18	C06
6692	g_6692	RB0340		DPlate 072	B03			AU078362	AU102210			18	D06
6693	g_6693	RA3678	">(P21411) GAG POLYPROTEIN (CONTAINS: CORE PROTEINS P19, P16;   PROBABLE CORE PROTEIN P35, P10). &FOLJHD(A31827)   &PCSLTRA_1(M23385|pid:g807672) "	DPlate 070	C03			AU162511	AU032194			18	E06
6694	g_6694	RB0372	">D88617_1(D88617|pid:g2605617) Oryza sativa mRNA for OSMYB1,   complete cds. "	DPlate 072	C03			AU070855	AU082166			18	F06
6695	g_6695	RA3655	">ATU38916_1(U38916|pid:g1145627) Arabidopsis thaliana lipase mRNA,   complete cds. &S68410(S68410) "	DPlate 070	D03			AU075835	AU032172			18	G06
6696	g_6696	RB0402		DPlate 072	D03			AU070873				18	H06
6697	g_6697	RA3679		DPlate 070	E03			AU032195				18	I06
6698	g_6698	RB0426		DPlate 072	E03			AU162593				18	J06
6699	g_6699	RA3687	>(Q43007) PHOSPHOLIPASE D PRECURSOR (EC 3.1.4.4) (PLD) (CHOLINE   PHOSPHATASE) (PHOSPHATIDYLCHOLINE-HYDROLYZING   PHOSPHOLIPASE D). &AB001920_1(AB001920|pid:g1902903)   &RICPHD2_1(D73411|pid:g1020415) 	DPlate 070	F03			AU032201	AU032202			18	K06
6700	g_6700	RB0435	">HVJ222784_1(AJ222784|pid:g2695941) Hordeum vulgare mRNA for   ribosomal like-protein, clone RG131; homology to 60S   ribosomal protein L13. "	DPlate 072	F03			AU070899				18	L06
6701	g_6701	RA3695	">AF001505_1(AF001505|pid:g2160782) Oryza sativa putative ammonium   transporter OsAMT1p (OsAMT1) mRNA, complete cds. "	DPlate 070	G03			AU162515	AU032209			18	M06
6702	g_6702	RB0404		DPlate 072	G03			AU070875	AU095576			18	N06
6703	g_6703	RA3608		DPlate 070	H03			AU065410	AU173523			18	O06
6704	g_6704	RB0428	>A47234(A47234)homeobox protein H6 - human 	DPlate 072	H03			AU070893				18	P06
6705	g_6705	RA3852		DPlate 070	A09			AU032294	AU032295			18	A18
6706	g_6706	RB0611	">ATAC006223_10(AC006223|pid:g4263704) Arabidopsis thaliana   chromosome II BAC F22D22 genomic sequence, complete   sequence; "	DPlate 072	A09			AU071014	AU101702			18	B18
6707	g_6707	RA3884	">AE000857_4(AE000857|pid:g2621880) Methanobacterium   thermoautotrophicum from bases 714254 to 725965 (section   63 of 148) of the complete genome; Function Code:14.00 -   Unknown, ; similar to, gp:GI:g1666503 LN:DMU55321,   p()=0.13, pid=14%. &D69205(D69205) "	DPlate 070	B09			AU070226	AU173813			18	C18
6708	g_6708	RB0619	>AFABF1_1(Z48429|pid:g1159877) A.fatua mRNA for DNA-binding protein   (clone ABF1). &S61413(S61413) 	DPlate 072	B09			AU093472	AU071021			18	D18
6709	g_6709	RA3869	>(P17070) PROLIFERATING CELL NUCLEAR ANTIGEN (PCNA) (CYCLIN).   &OSPCNAGEN_1(X54046|pid:g20284) &S14415(S14415) 	DPlate 070	C09			AU032312	AU032313			18	E18
6710	g_6710	RB0635	">ATAC005970_14(AC005970|pid:g4006829) Arabidopsis thaliana   chromosome II BAC T6P5 genomic sequence, complete   sequence; "	DPlate 072	C09			AU071036	AU078036			18	F18
6711	g_6711	RA3877	">ATPEROX2_1(X98774|pid:g1429215) A.thaliana mRNA for peroxidase   ATP6a, EST clone 157A5T7.   &ATPRXR8GE_1(X98320|pid:g1402918) "	DPlate 070	D09			AU032316	AU173811			18	G18
6712	g_6712	RB0643		DPlate 072	D09			AU071041	AU082264			18	H18
6713	g_6713	RA3806		DPlate 070	E09			AU181018				18	I18
6714	g_6714	RB0651	">ATAC006284_1(AC006284|pid:g4335745) Arabidopsis thaliana chromosome   II BAC T4M8 genomic sequence, complete sequence. "	DPlate 072	E09			AU071048	AU163480			18	J18
6715	g_6715	RA3838		DPlate 070	F09			AU089716	AU032278			18	K18
6716	g_6716	RB0691	">ATAC002392_1(AC002392|pid:g3176702) Arabidopsis thaliana chromosome   II BAC T20K24 genomic sequence, complete sequence;   hypothetical protein.   &ATAC003673_20(AC003673|pid:g3004561) "	DPlate 072	F09			AU071072	AU101706			18	L18
6717	g_6717	RA3878		DPlate 070	G09			AU032317	AU032318			18	M18
6718	g_6718	RB0620		DPlate 072	G09			AU071022	AU163478			18	N18
6719	g_6719	RA3886	">ATF23E13_13(AL022141|pid:g2961383) Arabidopsis thaliana DNA   chromosome 4, BAC clone F23E13 (ESSAII project);   similarity to NTL1 protein, curled-leaved tobacco,   PIR2:S46419. "	DPlate 070	H09			AU083498	AU032323			18	O18
6720	g_6720	RB0636	>B38919(B38919)hypothetical protein 2 - human (fragment) 	DPlate 072	H09			AU071037	AU101703			18	P18
6721	g_6721	SA0056		DPlate 074	A03			AU055790	AU055791			19	A06
6722	g_6722	SA1027	">AF014930_1(AF014930|pid:g3282394) Oryza sativa aie2 mRNA, partial   cds; anaerobically inducible early gene 2. "	DPlate 078	A03			AU056970	AU056971			19	B06
6723	g_6723	SA0064	">AF097668_1(AF097668|pid:g4206124) Mesembryanthemum crystallinum   T-complex protein 1 epsilon subunit (TCP-1-EPSILON)   mRNA, partial cds; TCP-1 chaperonin. "	DPlate 074	B03			AU055805	AU055806			19	C06
6724	g_6724	SA1051		DPlate 078	B03			AU056996				19	D06
6725	g_6725	SA0080	">ATAC002561_17(AC002561|pid:g2673917) Arabidopsis thaliana chromosome   II BAC T24P15 genomic sequence, complete sequence; "	DPlate 074	C03			AU055824	AU055825			19	E06
6726	g_6726	SA1059	>I48188(I48188) gene NKx6.1 protein - golden hamster   &MANKX6_1(X81409|pid:g587467) 	DPlate 078	C03			AU057005	AU057006			19	F06
6727	g_6727	SA0109		DPlate 074	D03			AU055866				19	G06
6728	g_6728	SA1084	">CSU62622_1(U62622|pid:g1805254) Cucumis sativus   monogalactosyldiacylglycerol synthase mRNA, complete   cds. "	DPlate 078	D03			AU057036	AU057037			19	H06
6729	g_6729	SA0141	>ATH224982_1(AJ224982|pid:g3549652) Arabidopsis thaliana MAP3K epsilon   gene. 	DPlate 074	E03			AU055907	AU055908			19	I06
6730	g_6730	SA1092		DPlate 078	E03			AU057048	AU057049			19	J06
6731	g_6731	SA0149	>MTY15367_1(Y15367|pid:g2598589) Medicago truncatula mRNA for MtN19   gene. 	DPlate 074	F03			AU055916	AU055917			19	K06
6732	g_6732	SA1005	">ATF13M23_27(AL035523|pid:g4455256) Arabidopsis thaliana DNA   chromosome 4, BAC clone F13M23 (ESSAII project);   contains EST gb:AA712385, F13739, N37941, N96968,   H36504, N65094, H37471. "	DPlate 078	F03			AU056942	AU056943			19	L06
6733	g_6733	SA0173	">ATF10M10_12(AL035521|pid:g4455180) Arabidopsis thaliana DNA   chromosome 4, BAC clone F10M10 (ESSAII project); strong   similarity to hypothetical protein, Synechocystis sp.,   PIR2:S76307; contains EST gb:Z34640, AA605545, Z30476,   Z34228, H76883, Z26425. "	DPlate 074	G03			AU173867	AU055947			19	M06
6734	g_6734	SA1013		DPlate 078	G03			AU095642	AU056952			19	N06
6735	g_6735	SA0181	">F20D22_2(AC002411|pid:g3142291) Arabidopsis thaliana chromosome 1 BAC   F20D22 sequence, complete sequence; Contains similarity   to adenylate cyclase gb|AF012921 from Magnaporthe grisae.   EST gb|Z24512 comes from this gene.. "	DPlate 074	H03			AU055962	AU055963			19	O06
6736	g_6736	SA1069	>(P33278) PROTEIN TRANSLATION FACTOR SUI1 HOMOLOG (GOS2 PROTEIN).   &AF094774_1(AF094774|pid:g3789950)   &OSGOS2G_1(X51910|pid:g20238) &S21636(S21636) 	DPlate 078	H03			AU077773	AU077774			19	P06
6737	g_6737	SA0163	">AF060942_1(AF060942|pid:g3201682) Arabidopsis thaliana cultivar   Landsberg extra-large G-protein (XLG) gene, complete cds.   "	DPlate 074	A09			AU055935	AU055936			19	A18
6738	g_6738	SA1186	">D90907_31(D90907|pid:g1652649) Synechocystis sp. PCC6803 complete   genome, 9/27, 1056467-1188885; ORF_ID:sll1280.   &S77235(S77235) "	DPlate 078	A09			AU057138	AU057139			19	B18
6739	g_6739	SA0171	">ATAC006569_3(AC006569|pid:g4512693) Arabidopsis thaliana chromosome   II BAC F11A3 genomic sequence, complete sequence;   &ATSCLBS_1(AJ001808|pid:g3660469) "	DPlate 074	B09			AU055945	AU088651			19	C18
6740	g_6740	SA1131		DPlate 078	B09			AU057079				19	D18
6741	g_6741	SA0179		DPlate 074	C09			AU055958	AU055959			19	E18
6742	g_6742	SA1171	">D64038_1(D64038|pid:g1841320) Rice mRNA for EL2 gene, complete cds.   "	DPlate 078	C09			AU070278				19	F18
6743	g_6743	SA0132		DPlate 074	D09			AU055893	AU055894			19	G18
6744	g_6744	SA1179		DPlate 078	D09			AU057132				19	H18
6745	g_6745	SA0140	">MCU80071_1(U80071|pid:g1773330) Mesembryanthemum crystallinum   glycolate oxidase (GOX) mRNA, complete cds. "	DPlate 074	E09			AU055906	AU091712			19	I18
6746	g_6746	SA1187	">AF093635_1(AF093635|pid:g3885894) Oryza sativa photosystem-1 H   subunit GOS5 (PSI-H) mRNA, complete cds. "	DPlate 078	E09			AU057140	AU057141			19	J18
6747	g_6747	SA0156	">ATF28M20_6(AL031004|pid:g3281853) Arabidopsis thaliana DNA   chromosome 4, BAC clone F28M20 (ESSAII project);   similarity to protein phosphatase 2C, Medicago sativa,   PID:g2582800; Contains Mitochondrial energy transfer   proteins signature [PEEGAKRLMM], Protein phosphatase 2C   signature [LFGVFDGHG]. "	DPlate 074	F09			AU055925				19	K18
6748	g_6748	SA1108		DPlate 078	F09			AU057062				19	L18
6749	g_6749	SA0164	">ATAC006260_19(AC006260|pid:g4371296) Arabidopsis thaliana   chromosome II BAC T2N18 genomic sequence, complete   sequence; "	DPlate 074	G09			AU173865	AU173866			19	M18
6750	g_6750	SA1164	">AB001885_1(AB001885|pid:g3618314) Oryza sativa mRNA for zinc finger   protein, complete cds, clone:R1577. "	DPlate 078	G09			AU077780	AU077781			19	N18
6751	g_6751	SA0172		DPlate 074	H09			AU089719	AU055946			19	O18
6752	g_6752	SA1241	">AF081282_1(AF081282|pid:g4336325) Homo sapiens small membrane   protein 1 (SMP1) mRNA, complete cds. "	DPlate 078	H09			AU173944	AU173945			19	P18
6753	g_6753	SA0747	">AF076253_1(AF076253|pid:g3309086) Arabidopsis thaliana calcineurin   B-like protein 3 (CBL3) mRNA, complete cds; calcium   binding protein. "	DPlate 077	A03			AU165961	AU056635			20	A06
6754	g_6754	SA1608		DPlate 080	A03			AU057600	AU057601			20	B06
6755	g_6755	SA0787	>ATU95973_14(U95973|pid:g1931644) Arabidopsis thaliana BAC T19D16   genomic sequence; 	DPlate 077	B03			AU056684	AU056685			20	C06
6756	g_6756	SA1656	>G02068(G02068) white homolog - human   &HSU34919_1(U34919|pid:g1314277) 	DPlate 080	B03			AU162766	AU057660			20	D06
6757	g_6757	SA0708	">AC002328_16(AC002328|pid:g3953471) Genomic sequence for Arabidopsis   thaliana BAC F20N2, complete sequence; similar to beta   transducin isolog (AC002333); similar to ESTs gb|H37054   and gb|W43523. "	DPlate 077	C03			AU173911	AU056582			20	E06
6758	g_6758	SA1765	">HSU49188_1(U49188|pid:g1293563) Human placenta (Diff33) mRNA,   complete cds. "	DPlate 080	C03			AU057764	AU057765			20	F06
6759	g_6759	SA0740	>STY15269_1(Y15269|pid:g2598049) Solanum tuberosum mRNA for CDSP34   protein. 	DPlate 077	D03			AU173912	AU056627			20	G06
6760	g_6760	SA1718	">AC000103_5(AC000103|pid:g2213611) Genomic sequence for Arabidopsis   thaliana BAC F21J9, complete sequence; unknown. "	DPlate 080	D03			AU057717	AU101720			20	H06
6761	g_6761	SA0748	">ATAP22_40(Z99708|pid:g4006915) Arabidopsis thaliana DNA chromosome   4, ESSA I AP2 contig fragment No. 2; "	DPlate 077	E03			AU167017	AU056636			20	I06
6762	g_6762	SA1726	>(P35200) MSF1 PROTEIN. &S37758(S37758;S51415)   &SCMSF1Y19_3(X70279|pid:g406603)   &YSCL9470_3(U17246|pid:g577207) 	DPlate 080	E03			AU057724	AU101721			20	J06
6763	g_6763	SA0756	">ATAC004697_15(AC004697|pid:g3402684) Arabidopsis thaliana   chromosome II BAC T16B24 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 077	F03			AU056644	AU162705			20	K06
6764	g_6764	SA1734	>OSCYSPRO_1(X80876|pid:g530335) O.sativa mRNA for cysteine protease.   &S47434(S47434) 	DPlate 080	F03			AU057730	AU057731			20	L06
6765	g_6765	SA0780		DPlate 077	G03			AU056679	AU056680			20	M06
6766	g_6766	SA1742		DPlate 080	G03			AU057738	AU162778			20	N06
6767	g_6767	SA0796		DPlate 077	H03			AU162708	AU056694			20	O06
6768	g_6768	SA1750	">T22H22_2(AC005388|pid:g3776557) Sequence of BAC T22H22 from   Arabidopsis thaliana chromosome 1, complete sequence;   Contains similarity to gi|2924495 hypothetical protein   Rv1920 from Mycobacterium tuberculosis genome   gb|AL022020.. "	DPlate 080	H03			AU057745	AU057746			20	P06
6769	g_6769	SA0957		DPlate 077	A09			AU082426	AU056888			20	A18
6770	g_6770	SA1892	">AF129931_1(AF129931|pid:g4427065) Mus musculus hypoxia associated   factor (Haf) mRNA, complete cds. "	DPlate 080	A09			AU057904	AU057905			20	B18
6771	g_6771	SA0965	">ATF24A6_6(AL035396|pid:g4454010) Arabidopsis thaliana DNA   chromosome 4, BAC clone F24A6 (ESSAII project);   similarity to putative glycerol-3-phosphate permease   -Arabidopsis thaliana, PID:g2245113; contains EST   gb:R64989, AA651060. "	DPlate 077	B09			AU056901	AU056902			20	C18
6772	g_6772	SA1821	>CELZC13_1(U67953|pid:g1519680) Caenorhabditis elegans cosmid ZC13;   contains similarity to C3HC4-class zinc finger   (PS:PS00518). 	DPlate 080	B09			AU057822				20	D18
6773	g_6773	SA0902	>H70982(H70982) probable fadD7 protein - Mycobacterium tuberculosis   (strain H37RV) &MTCI418B_1(Z96071|pid:g3242255) 	DPlate 077	C09			AU076256	AU076257			20	E18
6774	g_6774	SA1837	>(P44004) HYPOTHETICAL PROTEIN HI0488. &D64008(D64008)   &U32731_3(U32731|pid:g1573468) 	DPlate 080	C09			AU057842	AU057843			20	F18
6775	g_6775	SA0910	>A44956(A44956;JQ2213;JQ2234) chlorophyll a/b-binding protein I   precursor - rice &RICLHCP1_1(D00641|pid:g218172) 	DPlate 077	D09			AU056825	AU056826			20	G18
6776	g_6776	SA1853		DPlate 080	D09			AU057862				20	H18
6777	g_6777	SA0926		DPlate 077	E09			AU076258	AU076259			20	I18
6778	g_6778	SA1861		DPlate 080	E09			AU057870				20	J18
6779	g_6779	SA0934	">MSCDC2MSE_1(X97316|pid:g1806144) M.sativa mRNA for cdc2 kinase   homologue, cdc2MsE. "	DPlate 077	F09			AU056862	AU056863			20	K18
6780	g_6780	SA1869		DPlate 080	F09			AU057881				20	L18
6781	g_6781	SA0958	">OSAF001396_1(AF001396|pid:g2072555) Oryza sativa   metallothionein-like protein mRNA, complete cds. "	DPlate 077	G09			AU176531				20	M18
6782	g_6782	SA1885	">AF030320_1(AF030320|pid:g2739139) Thermus filiformis thermostable   DNA polymerase (pol) gene, complete cds. "	DPlate 080	G09			AU057895	AU057896			20	N18
6783	g_6783	SA0966	">HVSCOAT_1(L37299|pid:g609504) Helicoverpa armigera Stunt Virus RNA2   coat protein (p71) and p17 gene, complete cds; has PEST   characteristics, makes tube-like structures when   expressed in bacteria, unstable when expressed in   baculovirus, start codon in poor context so is poorly   expressed if at all; putative. "	DPlate 077	H09			AU078263	AU056903			20	O18
6784	g_6784	SA1806	>JX0343(JX0343;PC2378) triacylglycerol lipase (EC 3.1.1.3) -   Fusarium heterosporum &S77816_1(S77816|pid:g1000397) 	DPlate 080	H09			AU101723	AU101724			20	P18
6785	g_6785	SS3119	>AE001295_2(AE001295|pid:g3328619) Chlamydia trachomatis section 22   of 87 of the complete genome. &B71542(B71542) 	DPlate 082	A03			D47549	AU032660			21	A06
6786	g_6786	SS5160	">ATACDPK6_1(U20623|pid:g836940) Arabidopsis thaliana   calcium-dependent protein kinase (CDPK6) mRNA, complete   cds. &ATF9D16_12(AL035394|pid:g4454034)   &ATU20625_1(U20625|pid:g836944) "	DPlate 084	A03			D48767	C22643			21	B06
6787	g_6787	SS3143	">AF004358_1(AF004358|pid:g2190992) Aegilops squarrosa glutathione   S-transferase TSI-1 mRNA, complete cds; GST isozyme. "	DPlate 082	B03			D47564	AU108293			21	C06
6788	g_6788	SS5105	">AC004557_30(AC004557|pid:g3935187) Genomic sequence for Arabidopsis   thaliana BAC F17L21, complete sequence; similar to   kinesin light chain (Z25664); similar to EST gb|R90451.   "	DPlate 084	B03			D48718	AU174072			21	D06
6789	g_6789	SS3175	>ZMHMGD1_1(Y08807|pid:g2196672) Z.mays mRNA for HMG protein. 	DPlate 082	C03			D47590	AU082750			21	E06
6790	g_6790	SS5129		DPlate 084	C03			D48739	AU032836			21	F06
6791	g_6791	SS3184	>(P49104) RAS-RELATED PROTEIN RAB-2-B.   &ZMU22433_1(U22433|pid:g722328) 	DPlate 082	D03			D47597	AU176541			21	G06
6792	g_6792	SS5185	>(P25927) HYPOTHETICAL 43.1 KD PROTEIN IN CYSG 3'REGION (ORF3).   &C39200(C39200) &STYCYSAA_3(M64606|pid:g153923) 	DPlate 084	D03			D48789	AU174081			21	H06
6793	g_6793	SS3121	>CAAJ6984_1(AJ006984|pid:g3242079) Capsicum annuum mRNA for   proline-rich protein; PEKPK motif repeated 11 times. 	DPlate 082	E03			D47551	AU174011			21	I06
6794	g_6794	SS5122	>(Q43272) NADP-DEPENDENT GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE   (EC 1.2.1.9) (NON-PHOSPHORYLATING GLYCERALDEHYDE   3-PHOSPHATE DEHYDROGENASE) (GLYCERALDEHYDE-3-PHOSPHATE   DEHYDROGENASE (NADP+)) (TRIOSEPHOSPHATE DEHYDROGENASE).    &S43833(S43833) &ZMRNAGAPN_1(X75326|pid:g474408) 	DPlate 084	E03			D48732	AU032835			21	J06
6795	g_6795	SS3161	">ATAC006248_28(AC006248|pid:g4335739) Arabidopsis thaliana   chromosome II BAC F9O13 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 082	F03			D47579	AU032667			21	K06
6796	g_6796	SS5138	">ATFCA7_5(Z97342|pid:g2245036) Arabidopsis thaliana DNA chromosome   4, ESSA I contig fragment No. 7; similarity to   triacylglycerol lipase (EC 3.1.1.3) - Rhizopus niveus.   &E71435(E71435) "	DPlate 084	F03			D48747	AU174078			21	L06
6797	g_6797	SS3177	">ATAC004681_8(AC004681|pid:g3298540) Arabidopsis thaliana chromosome   II BAC T26B15 genomic sequence, complete sequence;   unknown protein. "	DPlate 082	G03			D47592	AU162926			21	M06
6798	g_6798	SS5154		DPlate 084	G03			D48762	AU163081			21	N06
6799	g_6799	SS3114	>(Q42577) NADH-UBIQUINONE OXIDOREDUCTASE 20 KD SUBUNIT PRECURSOR (EC   1.6.5.3) (EC 1.6.99.3) (COMPLEX I-20KD) (CI-20KD) (PSST   SUBUNIT). &ATNADHUO_1(X84078|pid:g643090)   &S52286(S52286) 	DPlate 082	H03			D47544	AU032658			21	O06
6800	g_6800	SS5115		DPlate 084	H03			AU181029				21	P06
6801	g_6801	SS3875	>(P33126) HEAT SHOCK PROTEIN 82. &OSHSP82A_1(Z11920|pid:g20256)   &S25541(S25541;S25542) 	DPlate 082	A09			AU082436	AU032738			21	A18
6802	g_6802	SS5605		DPlate 084	A09			D48999	AU162052			21	B18
6803	g_6803	SS3891		DPlate 082	B09			C24775	AU096477			21	C18
6804	g_6804	SS5645	">ATF19F18_4(AL035605|pid:g4468980) Arabidopsis thaliana DNA   chromosome 4, BAC clone F19F18 (ESSA project); strong   similarity to formamidase, Methylophilus methylotrophus,   PIR2:S74213; contains EST gb:T46402, AA404801, T22522. "	DPlate 084	B09			D49028	AU174084			21	D18
6805	g_6805	SS3804	">SCU15300_1(U15300|pid:g557484) Saccharomyces cerevisiae Hal5p   (HAL5) mRNA, complete cds; protein kinase homolog; salt   and pH sensitivity. "	DPlate 082	C09			D47973	AU162964			21	E18
6806	g_6806	SS5622	">ATFCA2_6(Z97337|pid:g2244835) Arabidopsis thaliana DNA chromosome   4, ESSA I contig fragment No. 2; similarity to protein   kinase 6 (EC 2.7.1.-) - soybean. &G71410(G71410) "	DPlate 084	C09			D49013	C22649			21	F18
6807	g_6807	SS3813	">AC004557_24(AC004557|pid:g3935181) Genomic sequence for Arabidopsis   thaliana BAC F17L21, complete sequence; similar to   multiple exostoses type II protein EXT2.I (U72263);   similar to ESTs dbj|D39982, gb|L37635, and dbj|C28418. "	DPlate 082	D09			AU175144	AU032716			21	G18
6808	g_6808	SS5630		DPlate 084	D09			AU065895				21	H18
6809	g_6809	SS3821	">AF094775_1(AF094775|pid:g3789952) Oryza sativa chlorophyll   a/b-binding protein presursor (Cab27) mRNA, nuclear gene   encoding chloroplast protein, complete cds; 27 KDa. "	DPlate 082	E09			D47986	AU162965			21	I18
6810	g_6810	SS5671		DPlate 084	E09			D49049				21	J18
6811	g_6811	SS3829	>SCPPAG_1(X13253|pid:g4199) Yeast PPA gene for inorganic   pyrophosphatase (EC 3.6.1.1); pyrophosphatase (AA 1 -   287). 	DPlate 082	F09			D47991	AU032722			21	K18
6812	g_6812	SS5695	>OSCALMOD2_1(Z12828|pid:g20190) O.sativa gene encoding calmodulin.   &RICCALMODL_1(L18914|pid:g310313) &S22860(S22860) 	DPlate 084	F09			AU081377	AU081378			21	L18
6813	g_6813	SS3837	>(P31542) ATP-DEPENDENT CLP PROTEASE ATP-BINDING SUBUNIT CLPA HOMOLOG   CD4B PRECURSOR. &B35905(B35905)   &TOMCD4B_1(M32604|pid:g170435) 	DPlate 082	G09			AU162968	AU032727			21	M18
6814	g_6814	SS5656	>(P12148) CHLOROPLAST 30S RIBOSOMAL PROTEIN S8.   &CHOSXX_62(X15901|pid:g12022) &R3RZ8(JQ0262;S05142) 	DPlate 084	G09			AU070441	AU174085			21	N18
6815	g_6815	SS3861		DPlate 082	H09			AU065833	AU032734			21	O18
6816	g_6816	SS5672	">ATAC005169_28(AC005169|pid:g3687248) Arabidopsis thaliana   chromosome II BAC F6F22 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 084	H09			D49050	AU174087			21	P18
6817	g_6817	ST0073	">ATM3E9_10(AL022223|pid:g2982459) Arabidopsis thaliana DNA   chromosome 4, BAC clone M3E9 (ESSA project); similarity   to probable calcium-dependent protein kinase, Oryza   sativa, PIR2:S56652; Contains EF-hand calcium-binding   domain, [DEDSNGSIDHTEL], [DENKDGYVSREEM],   [DWDKNGMVNFKEF]; contains EST gb:H77175. "	DPlate 086	A03			AU101894	AU101895			22	A06
6818	g_6818	ST1241		DPlate 088	A03			AU181041				22	B06
6819	g_6819	ST0081		DPlate 086	B03			AU032968	AU032969			22	C06
6820	g_6820	ST1242	>(P54968) IAA-AMINO ACID HYDROLASE (EC 3.5.1.-).   &ATU23794_1(U23794|pid:g887785) 	DPlate 088	B03			AU174211				22	D06
6821	g_6821	ST0089	">ATAC004481_9(AC004481|pid:g3337356) Arabidopsis thaliana chromosome   II BAC F13P17 genomic sequence, complete sequence; "	DPlate 086	C03			AU066049	AU161511			22	E06
6822	g_6822	ST1258	">AF097667_1(AF097667|pid:g4206122) Mesembryanthemum crystallinum   protein phosphatase 2C homolog (PP2C) mRNA, complete   cds. "	DPlate 088	C03			D39691	AU174214			22	F06
6823	g_6823	ST0002		DPlate 086	D03			AU066030	AU032945			22	G06
6824	g_6824	ST1274		DPlate 088	D03			AU175155				22	H06
6825	g_6825	ST0010	>ZMCCR2_1(Y15069|pid:g3668115) Zea mays mRNA for cinnamoyl-CoA   reductase. 	DPlate 086	E03			AU174135				22	I06
6826	g_6826	ST1275		DPlate 088	E03			D39704	AU174215			22	J06
6827	g_6827	ST0050		DPlate 086	F03			AU078160	AU078159			22	K06
6828	g_6828	ST1220		DPlate 088	F03			AU058090				22	L06
6829	g_6829	ST0066	">AF077372_1(AF077372|pid:g4336205) Zea mays cytochrome b5 reductase   (NFR) mRNA, complete cds. "	DPlate 086	G03			AU161508	AU161509			22	M06
6830	g_6830	ST1252	>S30145(S30145;S34040;S36884)ketol-acid reductoisomerase (EC   1.1.1.86) precursor - Arabidopsis thaliana 	DPlate 088	G03			D39686	AU161610			22	N06
6831	g_6831	ST0082	>(P54072) HYPOTHETICAL 64.0 KD PROTEIN IN ACS2-MPT4 INTERGENIC   REGION. &S65001(S65001)   &SCYLR152C_1(Z73324|pid:g1360584)   &YSCL9634_9(U53879|pid:g1262312) 	DPlate 086	H03			AU032970	AU101897			22	O06
6832	g_6832	ST1276		DPlate 088	H03			D39705	AU174216			22	P06
6833	g_6833	ST0545	">ATAC002332_35(AC002332|pid:g2459440) Arabidopsis thaliana   chromosome II BAC F4P9 genomic sequence, complete   sequence; "	DPlate 086	A09			AU174143	AU090620			22	A18
6834	g_6834	ST1716	">AF007219_1(AF007219|pid:g2253411) Tetraodon fluviatilis PP2A   inhibitor (set) gene, complete cds; SET. "	DPlate 088	A09			D40004	AU161618			22	B18
6835	g_6835	ST0586	>CPHYPOTHE_1(AJ001304|pid:g2369766) Citrus paradisi mRNA for   hypothetical protein; similar to protein B2 from Daucus   carota. 	DPlate 086	B09			AU032987	AU075550			22	C18
6836	g_6836	ST1756	">ATAC006580_4(AC006580|pid:g4544465) Arabidopsis thaliana chromosome   II BAC F23E6 genomic sequence, complete sequence.   &ATAC006931_3(AC006931|pid:g4512659) "	DPlate 088	B09			D40033	C22674			22	D18
6837	g_6837	ST0594		DPlate 086	C09			AU075551	AU032989			22	E18
6838	g_6838	ST1764	">ATAC002505_24(AC002505|pid:g2739382) Arabidopsis thaliana   chromosome II BAC T9J22 genomic sequence, complete   sequence; "	DPlate 088	C09			D40039	AU161623			22	F18
6839	g_6839	ST0515	">D67042_1(D67042|pid:g2696238) Oryza sativa mRNA for aspartate   aminotransferase, partial cds. "	DPlate 086	D09			AU174142				22	G18
6840	g_6840	ST1957	>A52566_1(A52566|pid:g2851884) Sequence 2 from Patent EP0727487;   unnamed protein product.   &HSLPP11_1(U49968|pid:g1537030)   &HSU49957_1(U49957|pid:g1537017) 	DPlate 088	D09			D40173	AU174236			22	H18
6841	g_6841	ST0587		DPlate 086	E09			AU174145				22	I18
6842	g_6842	ST1965		DPlate 088	E09			AU174238				22	J18
6843	g_6843	ST0548	">AF128407_1(AF128407|pid:g4454567) Arabidopsis thaliana lipase   homolog (EDS1) gene, complete cds. "	DPlate 086	F09			AU066063	AU161532			22	K18
6844	g_6844	ST1989	">AF012864_1(AF012864|pid:g2352925) Petroselinum crispum plastidic   3-deoxy-D-arabino-heptulosonate 7-phosphate synthase 2   (pDAHPS2) mRNA, nuclear gene encoding plastid protein,   complete cds. "	DPlate 088	F09			AU174243	AU174244			22	L18
6845	g_6845	ST0564		DPlate 086	G09			AU174144	AU032983			22	M18
6846	g_6846	ST1902		DPlate 088	G09			D40132	AU174224			22	N18
6847	g_6847	ST0596	">AF045286_1(AF045286|pid:g2865623) Arabidopsis thaliana   GDP-4-keto-6-deoxy-D-mannose-3,5-epimerase-4-reductase   (GER1) gene, complete cds; enzyme in pathway for de novo   synthesis of GDP-L-fucose. "	DPlate 086	H09			AU091494				22	O18
6848	g_6848	ST1910		DPlate 088	H09			D40138	AU174228			22	P18
6849	g_6849	ST3590		DPlate 090	A03			D41234	AU101975			23	A06
6850	g_6850	ST5282	">AB012605_1(AB012605|pid:g3021713) Oryza sativa gene for MRL,   complete cds. "	DPlate 092	A03			AU066156	AU161751			23	B06
6851	g_6851	ST3511	">(P05100) DNA-3-METHYLADENINE GLYCOSIDASE I (EC 3.2.2.20)   (3-METHYLADENINE-DNA GLYCOSYLASE I, CONSTITUTIVE) (TAG   I). &AE000432_4(AE000432|pid:g1789971)   &DGECM1(A24604;S47770;I58249;G65153)   &ECOTAG_1(J02606|pid:g147920)   &ECOUW76_105(U00039|pid:g466687)   &ECTAG_1(X03845|pid:g43030) "	DPlate 090	B03			AU175161				23	C06
6852	g_6852	ST5290		DPlate 092	B03			AU058128				23	D06
6853	g_6853	ST3535	">T8F5_20(AC004512|pid:g3335348) Arabidopsis thaliana chromosome 1   BAC T8F5 sequence, complete sequence; "	DPlate 090	C03			AU033120				23	E06
6854	g_6854	ST5211		DPlate 092	C03			C25085				23	F06
6855	g_6855	ST3567	">ATF28J12_22(AL021710|pid:g2832661) Arabidopsis thaliana DNA   chromosome 4, BAC clone F28J12 (ESSAII project);   similarity to pherophorin-S, Volvox carteri,   PATCHX:E265434. "	DPlate 090	D03			AU070551				23	G06
6856	g_6856	ST5243	>(P52914) NUCLEOSIDE-TRIPHOSPHATASE (EC 3.6.1.15) (NUCLEOSIDE   TRIPHOSPHATE PHOSPHOHYDROLASE) (NTPASE).   &AB022319_1(AB022319|pid:g4519173)   &PSNTPASE_1(Z32743|pid:g563612) &S48859(S65147;S48859) 	DPlate 092	D03			C25097	AU097482			23	H06
6857	g_6857	ST3512		DPlate 090	E03			D41185	AU174292			23	I06
6858	g_6858	ST5251	>(P41098) 60S RIBOSOMAL PROTEIN L34. &S48027(S48027;S48028)   &TOB6RPLA_1(L27107|pid:g436032)   &TOB6RPL_1(L27089|pid:g436030) 	DPlate 092	E03			AU161742	AU161743			23	J06
6859	g_6859	ST3520	">AF004358_1(AF004358|pid:g2190992) Aegilops squarrosa glutathione   S-transferase TSI-1 mRNA, complete cds; GST isozyme. "	DPlate 090	F03			D41191	AU101971			23	K06
6860	g_6860	ST5259		DPlate 092	F03			C25102	AU102022			23	L06
6861	g_6861	ST3505	">OSU95968_1(U95968|pid:g2224915) Oryza sativa beta-expansin mRNA,   complete cds; cell wall loosening protein. "	DPlate 090	G03			D41180	AU108370			23	M06
6862	g_6862	ST5283	">ATT4L20_28(AL023094|pid:g3096939) Arabidopsis thaliana DNA   chromosome 4, BAC clone T4L20 (ESSAII project); contains   EST gb:H36271, AA040992, Z35607, T04342, T13747, Z33673,   T43941, T43433. "	DPlate 092	G03			AU161752	AU161753			23	N06
6863	g_6863	ST3529	">ATFCA1_38(Z97336|pid:g2244826) Arabidopsis thaliana DNA chromosome   4, ESSA I contig fragment No. 1; similarity to   replication control protein 1 - Homo sapiens.   &G71409(G71409) "	DPlate 090	H03			D41200	AU174293			23	O06
6864	g_6864	ST5252		DPlate 092	H03			C25100	AU176548			23	P06
6865	g_6865	ST3868	">AF087483_1(AF087483|pid:g4163997) Arabidopsis thaliana   alpha-xylosidase precursor (XYL1) mRNA, partial cds;   glycosyl hydrolase family 31 member. "	DPlate 090	A09			D41389	AU093440			23	A18
6866	g_6866	ST5424		DPlate 092	A09			AU066175	AU102026			23	B18
6867	g_6867	ST3813	">ATU64906_1(U64906|pid:g4097547) Arabidopsis thaliana farnesylated   protein ATFP3 mRNA, partial cds; farnesylated protein. "	DPlate 090	B09			D41346	AU077902			23	C18
6868	g_6868	ST5633	">ATAC005397_2(AC005397|pid:g3702317) Arabidopsis thaliana chromosome   II BAC T3F17 genomic sequence, complete sequence;   unknown protein. "	DPlate 092	B09			AU066210				23	D18
6869	g_6869	ST3861	>AF058825_3(AF058825|pid:g3047065) Arabidopsis thaliana BAC F7N22;   contains similarity to human OS-9 precurosor   (GB:U41635). 	DPlate 090	C09			D41382	AU174300			23	E18
6870	g_6870	ST5626	>OSTA111_1(X91806|pid:g1136120) O.sativa mRNA for alpha-tubulin   (clone OSTA-111). 	DPlate 092	C09			AU161800	AU174363			23	F18
6871	g_6871	ST3885		DPlate 090	D09			D41405				23	G18
6872	g_6872	ST5674	">S81497_1(S81497|pid:g1336726) lysosomal acid lipase=intracellular   hydrolase [rats, Wolman, liver, mRNA, 3144 nt];   intracellular hydrolase; This sequence comes from Fig.   2. Protein sequence is in conflict with the conceptual   translation; mismatches(82[G- &W],83[E- &R]); LAL. "	DPlate 092	D09			AU161807	AU174368			23	H18
6873	g_6873	ST3893	">AC004255_16(AC004255|pid:g3056595) Arabidopsis thaliana BAC T1F9   chromosome 1, complete sequence; unknown. "	DPlate 090	E09			D41411				23	I18
6874	g_6874	ST5603	>AMA005586_1(AJ005586|pid:g3183617) Antirrhinum majus mRNA for   MYB-related transcription factor. 	DPlate 092	E09			AU161797	AU174360			23	J18
6875	g_6875	ST3806	">ATAC006836_11(AC006836|pid:g4406772) Arabidopsis thaliana   chromosome II BAC F19B11 genomic sequence, complete   sequence; "	DPlate 090	F09			D41341	AU097319			23	K18
6876	g_6876	ST5611		DPlate 092	F09			C25212				23	L18
6877	g_6877	ST3823	>(Q43209) PROTEIN-L-ISOASPARTATE O-METHYLTRANSFERASE (EC 2.1.1.77)   (PROTEIN- BETA-ASPARTATE METHYLTRANSFERASE) (PIMT)   (PROTEIN L-ISOASPARTYL METHYLTRANSFERASE) (L-ISOASPARTYL   PROTEIN CARBOXYL METHYLTRANSFERASE).   &WHTISMT_1(L07941|pid:g414332) 	DPlate 090	G09			D41351	AU101984			23	M18
6878	g_6878	ST5643		DPlate 092	G09			C25223	AU174365			23	N18
6879	g_6879	ST3863		DPlate 090	H09			D41384	AU174301			23	O18
6880	g_6880	ST5651	">ATAP21_27(Z99707|pid:g2464872) Arabidopsis thaliana DNA chromosome   4, ESSA I AP2 contig fragment No. 1; "	DPlate 092	H09			AU066213	AU174366			23	P18
6881	g_6881	ST6412		DPlate 094	A03			AU181064				24	A06
6882	g_6882	EE0993		DPlate 044	A12			AU101426	AU172815			24	B06
6883	g_6883	ST6460		DPlate 094	B03			AU181065				24	C06
6884	g_6884	EE0906		DPlate 044	B12			C74333	AU172787			24	D06
6885	g_6885	ST6468	">AF062242_1(AF062242|pid:g3170951) Homo sapiens clone 23u-46   immunoglobulin heavy chain variable region (IGH) mRNA,   partial cds. "	DPlate 094	C03			AU070641	AU174418			24	E06
6886	g_6886	EE0914	">ATAC006135_5(AC006135|pid:g4217999) Arabidopsis thaliana chromosome   II BAC F24H14 genomic sequence, complete sequence; "	DPlate 044	C12			C74337	AU172791			24	F06
6887	g_6887	ST6477	">AF062242_1(AF062242|pid:g3170951) Homo sapiens clone 23u-46   immunoglobulin heavy chain variable region (IGH) mRNA,   partial cds. "	DPlate 094	D03			AU102068	AU102069			24	G06
6888	g_6888	EE0922	">ATFCA3_2(Z97338|pid:g2244872) Arabidopsis thaliana DNA chromosome   4, ESSA I contig fragment No. 3; similar to 40.9K   protein - Autographa californica. &C71415(C71415) "	DPlate 044	D12			C74341	AU172794			24	H06
6889	g_6889	ST6406		DPlate 094	E03			AU174416				24	I06
6890	g_6890	EE0930	>HVCOXVCMR_1(Z68091|pid:g1070356) H.vulgare mRNA for cytochrome c   (Vc subunit); this protein is one of the nuclear-encoded   subunits of mitochondrial cytochrome c oxidase. 	DPlate 044	E12			C74346	AU172797			24	J06
6891	g_6891	ST6414		DPlate 094	F03			C25439	AU161928			24	K06
6892	g_6892	EE0938	">AC004221_1(AC004221|pid:g2911259) Homo sapiens DNA from chromosome   19, cosmid R29144, complete sequence; Hypothetical 75.8   kDa human protein. "	DPlate 044	F12			AU064437	AU172801			24	L06
6893	g_6893	ST6446		DPlate 094	G03			C25450	AU102066			24	M06
6894	g_6894	EE0946	">PCU14009_1(U14009|pid:g559557) Pyrus communis   arabinogalactan-protein (AGP) mRNA, complete cds. "	DPlate 044	G12			C74354	AU172802			24	N06
6895	g_6895	ST6486	">RICRPOLYP_1(D12629|pid:g303857) Rice mRNA for ubiquitin protein   fused to a ribosomal protein, complete cds.   &S33633(S33633) "	DPlate 094	H03			AU066327	AU161963			24	O06
6896	g_6896	EE0978		DPlate 044	H12			AU166069	AU172809			24	P06
6897	g_6897	D94Water+D		DPlate 094	A09							24	A18
6898	g_6898	no clone										24	B18
6899	g_6899	D94Water+D		DPlate 094	B09							24	C18
6900	g_6900	no clone										24	D18
6901	g_6901	D94Water+D		DPlate 094	C09							24	E18
6902	g_6902	no clone										24	F18
6903	g_6903	D94Water+D		DPlate 094	D09							24	G18
6904	g_6904	no clone										24	H18
6905	g_6905	D94Water+D		DPlate 094	E09							24	I18
6906	g_6906	no clone										24	J18
6907	g_6907	D94Water+D		DPlate 094	F09							24	K18
6908	g_6908	no clone										24	L18
6909	g_6909	D94Water+D		DPlate 094	G09							24	M18
6910	g_6910	no clone										24	N18
6911	g_6911	D94Water+D		DPlate 094	H09							24	O18
6912	g_6912	no clone										24	P18
6913	g_6913	EG0137		DPlate 049	A04			AU029892				13	A07
6914	g_6914	EG0828		DPlate 051	A04			AU095041	AU030263			13	B07
6915	g_6915	EG0153		DPlate 049	B04			AU029896	AU101469			13	C07
6916	g_6916	EG0844	">(P15719) MALATE DEHYDROGENASE (NADP), CHLOROPLAST PRECURSOR (EC   1.1.1.82) (NADP-MDH). &DEMZMC(S04859;A31071;S32512)   &ZMMDH_1(X16084|pid:g22368) "	DPlate 051	B04			AU030277	AU030278			13	D07
6917	g_6917	EG0185		DPlate 049	C04			AU029913	AU095015			13	E07
6918	g_6918	EG0852	">F21M12_13(AC000132|pid:g2160166) Sequence of BAC F21M12 from   Arabidopsis thaliana chromosome 1, complete sequence; "	DPlate 051	C04			AU172968	AU166209			13	F07
6919	g_6919	EG0114	">AF049928_1(AF049928|pid:g4105794) Petunia x hybrida PGP224 (PGP224)   mRNA, complete cds. "	DPlate 049	D04			AU058193	AU166157			13	G07
6920	g_6920	EG0876		DPlate 051	D04			AU065665	AU030301			13	H07
6921	g_6921	EG0130	>(P20346) PROBABLE PROTEASE INHIBITOR P322 PRECURSOR.   &S05594(S05594;S45659) &ST322R_1(X13180|pid:g21394) 	DPlate 049	E04			AU029891	AU078238			13	I07
6922	g_6922	EG0884	">AF007785_1(AF007785|pid:g2198851) Zea mays cystathionine   gamma-synthase (CGS1) mRNA, complete cds. "	DPlate 051	E04			AU172970	AU058396			13	J07
6923	g_6923	EG0147	">AF082556_1(AF082556|pid:g3929219) Homo sapiens TRF1-interacting   ankyrin-related ADP-ribose polymerase mRNA, complete   cds; tankyrase. "	DPlate 049	F04			AU058204	AU095010			13	K07
6924	g_6924	EG0892		DPlate 051	F04			C74756				13	L07
6925	g_6925	EG0163	">AF042839_1(AF042839|pid:g2809481) Oryza sativa calmodulin (CaM2)   mRNA, complete cds. "	DPlate 049	G04			AU058211	AU081338			13	M07
6926	g_6926	EG0813		DPlate 051	G04			AU065654	AU030247			13	N07
6927	g_6927	EG0171	>S56685(S56685) histone H2B-8 - wheat   &WHTPH2B8B_1(D37943|pid:g531058) 	DPlate 049	H04			AU029901	AU095013			13	O07
6928	g_6928	EG0853	">T1J1_6(AF128393|pid:g4325345) Arabidopsis thaliana BAC T1J1;   similar to thioredoxin-like proteins (Pfam: PF00085,   Score=42.9, E=1.4e-11, N=1); contains similarity to   dihydroorotases (Pfam: PF00744, Score=154.9, E=1.4e-42,   N=1); coded for by A. thaliana cDNA W43503; coded for by   A. thaliana cDNA W43504. "	DPlate 051	H04			AU166210	AU030285			13	P07
6929	g_6929	EG0339	">VFU96925_1(U96925|pid:g2104959) Vicia faba immunophilin (FKBP12)   mRNA, complete cds; similar to human FKBP12 encoded by   GenBank Accession Number S69815. "	DPlate 049	A10			AU058279	AU166171			13	A19
6930	g_6930	EG0948	">D63581_1(D63581|pid:g2662343) Oryza sativa mRNA for EF-1 alpha,   complete cds. "	DPlate 051	A10			AU166218	AU030361			13	B19
6931	g_6931	EG0379	>(P40590) 60S RIBOSOMAL PROTEIN L34.   &PSU10047_1(U10047|pid:g498908) &S60476(S60476) 	DPlate 049	B10			AU172951	AU058296			13	C19
6932	g_6932	EG0964		DPlate 051	B10			AU065681	AU030368			13	D19
6933	g_6933	EG0316	">AF010579_1(AF010579|pid:g2331131) Oryza sativa glycine-rich protein   (OSGRP1) mRNA, complete cds. "	DPlate 049	C10			AU181003				13	E19
6934	g_6934	EG1073	">ATT13J8_17(AL035524|pid:g4455365) Arabidopsis thaliana DNA   chromosome 4, BAC clone T13J8 (ESSAII project);   similarity to cytochrome-c oxidase oxidase chain VIb,   Homo sapiens, PIR1:OGHU6B. "	DPlate 051	C10			AU030446				13	F19
6935	g_6935	EG0332		DPlate 049	D10			AU029953	AU091383			13	G19
6936	g_6936	EG1058		DPlate 051	D10			C74786	AU172977			13	H19
6937	g_6937	EG0396		DPlate 049	E10			AU029971	AU091396			13	I19
6938	g_6938	EG1090		DPlate 051	E10			AU095062	AU030458			13	J19
6939	g_6939	EG0401	>(P34091) 60S RIBOSOMAL PROTEIN L6 (YL16-LIKE).   &MCYL16_1(X69378|pid:g19539) &S28586(S28586) 	DPlate 049	F10			AU173786				13	K19
6940	g_6940	EG1051	">AF102823_1(AF102823|pid:g4185513) Arabidopsis thaliana actin   depolymerizing factor 5 (ADF5) mRNA, complete cds.   &AF102825_1(AF102825|pid:g4185517) "	DPlate 051	F10			AU162298	AU030434			13	L19
6941	g_6941	EG0409	>(P47198) 60S RIBOSOMAL PROTEIN L22. 	DPlate 049	G10			AU172953	AU058306			13	M19
6942	g_6942	EG1067		DPlate 051	G10			AU030439	AU030440			13	N19
6943	g_6943	EG0425		DPlate 049	H10			AU162289	AU058312			13	O19
6944	g_6944	EG1060	">ATM4I22_3(AL030978|pid:g3269283) Arabidopsis thaliana DNA chromosome   4, P1 clone M4I22 (ESSAII project); similarity to disease   resistance protein RPS2, Arabidopsis thaliana,   PIR2:A54809; Contains Eukaryotic thiol (cysteine)   proteases active sites. "	DPlate 051	H10			AU172978				13	P19
6945	g_6945	EH0352	">ATAC006234_5(AC006234|pid:g4454452) Arabidopsis thaliana chromosome   II BAC F5H14 genomic sequence, complete sequence;   unknown protein. "	DPlate 053	A04			AU030858	AU101494			14	A07
6946	g_6946	EH1150		DPlate 055	A04			AU095295	AU031210			14	B07
6947	g_6947	EH0360		DPlate 053	B04			AU165888	AU030866			14	C07
6948	g_6948	EH1174		DPlate 055	B04			AU031230	AU031231			14	D07
6949	g_6949	EH0392	">ATF22K18_1(AL035356|pid:g4220511) Arabidopsis thaliana DNA   chromosome 4, BAC clone F22K18 (ESSAII project);   similarity to DNA polymerase III gamma subunit . "	DPlate 053	C04			AU173005	AU030885			14	E07
6950	g_6950	EH1103	>(P22357) ANTHER-SPECIFIC PROTEIN SF18 PRECURSOR (FRAGMENT).   &HASF18_1(X53375|pid:g18813) &S12246(S12246) 	DPlate 055	C04			AU031176				14	F07
6951	g_6951	EH0329	">ATAC003105_10(AC003105|pid:g2760839) Arabidopsis thaliana   chromosome II BAC F18A8 genomic sequence, complete   sequence; "	DPlate 053	D04			AU065181	AU091437			14	G07
6952	g_6952	EH1111		DPlate 055	D04			AU031178	AU031179			14	H07
6953	g_6953	EH0353		DPlate 053	E04			AU030859	AU030860			14	I07
6954	g_6954	EH1119		DPlate 055	E04			AU031188	AU031189			14	J07
6955	g_6955	EH0369		DPlate 053	F04			AU091448	AU030873			14	K07
6956	g_6956	EH1127	">ATT6K21_8(AL021889|pid:g2894599) Arabidopsis thaliana DNA   chromosome 4, BAC clone T6K21 (ESSAII project); contains   EST gb:T43356, AA042469. "	DPlate 055	F04			AU031193	AU031194			14	L07
6957	g_6957	EH0377	">AF021257_1(AF021257|pid:g2465428) Hordeum vulgare 32 kDa protein   (JRG1.2) gene, complete cds; similar to jacalin;   regulated by jasmonate.   &HVU43497_1(U43497|pid:g1167955) "	DPlate 053	G04			AU162320	AU030877			14	M07
6958	g_6958	EH1143		DPlate 055	G04			AU095292	AU031205			14	N07
6959	g_6959	EH0338	">ATAC004165_6(AC004165|pid:g3150402) Arabidopsis thaliana chromosome   II BAC T27E13 genomic sequence, complete sequence; "	DPlate 053	H04			AU030844	AU101493			14	O07
6960	g_6960	EH1167	">AF095707_1(AF095707|pid:g3777598) Oryza sativa clone LS273 30S   ribosomal protein S17 (rps17) mRNA, nuclear gene   encoding chloroplast protein, complete cds. "	DPlate 055	H04			AU031227				14	P07
6961	g_6961	EH0552		DPlate 053	A10			AU078709	AU031005			14	A19
6962	g_6962	EH1304		DPlate 055	A10			AU162341				14	B19
6963	g_6963	EH0560		DPlate 053	B10			AU078761	AU078762			14	C19
6964	g_6964	EH1312	">AC002292_28(AC002292|pid:g2462744) Genomic sequence of Arabidopsis   BAC F8A5, complete sequence; Hypothetical protein. "	DPlate 055	B10			AU031301	AU031302			14	D19
6965	g_6965	EH0553	">AB013853_1(AB013853|pid:g3868853) Vigna radiata ARG8 mRNA for   GPI-anchored protein, complete cds; putative. "	DPlate 053	C10			AU162327	AU031006			14	E19
6966	g_6966	EH1352		DPlate 055	C10			AU162345				14	F19
6967	g_6967	EH0577		DPlate 053	D10			AU031019	AU031020			14	G19
6968	g_6968	EH1360	>MMY17393_1(Y17393|pid:g3212116) Mus musculus mRNA for prefoldin   subunit 2. 	DPlate 055	D10			AU162349	AU031334			14	H19
6969	g_6969	EH0585	">AB000130_1(AB000130|pid:g2055230) Soybean mRNA for SRC2, complete   cds. "	DPlate 053	E10			AU065201				14	I19
6970	g_6970	EH1329		DPlate 055	E10			AU164798				14	J19
6971	g_6971	EH0514	">CAR012687_1(AJ012687|pid:g3860321) Cicer arietinum mRNA for   beta-galactosidase, clone CanBGal-5. "	DPlate 053	F10			AU030976	AU165913			14	K19
6972	g_6972	EH1345	">AC002330_23(AC002330|pid:g3892054) Arabidopsis thaliana BAC T10P11   from chromosome IV, near 15 cM, complete sequence;   similar to A. thaliana protein T20K9.11, GenBank   accession number 3445207; similar to A. thaliana   hypothetical protein MBK20.13, GenBank accession number   AB010070; functional catalog ID=06.07; identical to   protein T14P8.23. "	DPlate 055	F10			AU162344				14	L19
6973	g_6973	EH0594	">ASU11693_1(U11693|pid:g710308) Avena sativa victorin binding   protein mRNA, complete cds; 100 kDa. "	DPlate 053	G10			AU031030	AU031031			14	M19
6974	g_6974	EH1353	">AF047699_1(AF047699|pid:g3264590) Mus musculus fragile histidine   triad protein (Fhit) mRNA, complete cds; corresponding   genomic sequence deposited in GenBank Accession Numbers   AF047700-AF047702. &AF055573_1(AF055573|pid:g3249577) "	DPlate 055	G10			AU162346	AU031331			14	N19
6975	g_6975	EH0507	">ATAC006218_10(AC006218|pid:g4263771) Arabidopsis thaliana   chromosome II BAC F17L24 genomic sequence, complete   sequence; "	DPlate 053	H10			AU030973	AU030974			14	O19
6976	g_6976	EH1377		DPlate 055	H10			AU031344	AU031345			14	P19
6977	g_6977	EH1990		DPlate 057	A04			AU101589				15	A07
6978	g_6978	FE0489		DPlate 059	A04			AU181007				15	B07
6979	g_6979	EH1927	">ATT5J17_4(AL035708|pid:g4490738) Arabidopsis thaliana DNA   chromosome 4, BAC clone (ESSA project); similarity to   hypothetical protein, Schizosaccharomyces cerevisae,   Z99168. "	DPlate 057	B04			AU031597	AU031598			15	C07
6980	g_6980	FE0410		DPlate 059	B04			AU174811	AU174810			15	D07
6981	g_6981	EH1904	>SSY10787_1(Y10787|pid:g1808694) S.stapfianus pSD.34 mRNA. 	DPlate 057	C04			AU031586				15	E07
6982	g_6982	FE0426	>(P46783) 40S RIBOSOMAL PROTEIN S10.   &HSU14972_1(U14972|pid:g550025) &S55918(S55918;S68927) 	DPlate 059	C04			AU174824	AU174823			15	F07
6983	g_6983	EH1952		DPlate 057	D04			AU164467	AU031604			15	G07
6984	g_6984	FE0434		DPlate 059	D04			AU174829	AU174828			15	H07
6985	g_6985	EH1976	>(P29766) 60S RIBOSOMAL PROTEIN L2 (L8) (RIBOSOMAL PROTEIN TL2).   &LERPL2MR_1(X64562|pid:g19343) &R5TOL8(JQ2231;S19893) 	DPlate 057	E04			AU095410	AU031615			15	I07
6986	g_6986	FE0450	">AF055355_1(AF055355|pid:g3242785) Arabidopsis thaliana respiratory   burst oxidase protein C (RbohC) gene, complete cds;   similar to gp91phox. "	DPlate 059	E04			AU174843	AU174842			15	J07
6987	g_6987	EH1984		DPlate 057	F04			AU031621				15	K07
6988	g_6988	FE0458		DPlate 059	F04			AU174850				15	L07
6989	g_6989	EH1921	>PME131732_1(AJ131732|pid:g4090257) Pseudotsuga menziesii mRNA for   ribosomal protein L37A. 	DPlate 057	G04			AU031592				15	M07
6990	g_6990	FE0466	>(Q42978) NONSPECIFIC LIPID-TRANSFER PROTEIN 2 PRECURSOR (LTP 2).   &OSU31766_1(U31766|pid:g951334) 	DPlate 059	G04			AU174855	AU174854			15	N07
6991	g_6991	EH1937	>(Q09020) WOUND-INDUCED BASIC PROTEIN. &JS0731(JS0731)   &PHVPVPR4A_1(L00625|pid:g169365)   &PHVPVPR4_1(D12914|pid:g217989) 	DPlate 057	H04			AU164460				15	O07
6992	g_6992	FE0474	">ATAC004165_7(AC004165|pid:g3150403) Arabidopsis thaliana chromosome   II BAC T27E13 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 059	H04			AU174860	AU174859			15	P07
6993	g_6993	FE0078		DPlate 057	A10			AU174589				15	A19
6994	g_6994	FL0027	">AF069507_1(AF069507|pid:g3202020) Medicago sativa DnaJ-like protein   MsJ1 gene, complete cds.   &MSDNAJ_1(AJ000995|pid:g2370312) "	DPlate 059	A10			AU174901	AU174900			15	B19
6995	g_6995	FE0094		DPlate 057	B10			AU174603				15	C19
6996	g_6996	FL0035	">AF022731_1(AF022731|pid:g2570497) Oryza sativa H protein subunit of   glycine decarboxylase mRNA, complete cds. "	DPlate 059	B10			AU174906	AU174905			15	D19
6997	g_6997	FE0007	">ATAC006068_13(AC006068|pid:g4263787) Arabidopsis thaliana   chromosome II BAC T20F21 genomic sequence, complete   sequence; unknown protein. "	DPlate 057	C10			AU174546	AU174547			15	E19
6998	g_6998	FL0067	">ATAC006955_4(AC006955|pid:g4544409) Arabidopsis thaliana chromosome   II BAC F28I8 genomic sequence, complete sequence; "	DPlate 059	C10			AU174931				15	F19
6999	g_6999	FE0015	>CELW03D2_10(AF000298|pid:g1947160) Caenorhabditis elegans cosmid   W03D2; weak similarity to collagens; glycine- and   proline-rich. 	DPlate 057	D10			AU174554				15	G19
7000	g_7000	FL0075	">ATU84968_1(U84968|pid:g2760347) Arabidopsis thaliana ubiquitin   (UBQ11) gene, complete cds. "	DPlate 059	D10			AU174943	AU174944			15	H19
7001	g_7001	FE0031	>AT81KBGEN_4(X98130|pid:g1402878) A.thaliana 81kb genomic sequence. 	DPlate 057	E10			AU174560	AU174559			15	I19
7002	g_7002	FL0083	">ATM4I22_19(AL030978|pid:g3269299) Arabidopsis thaliana DNA   chromosome 4, P1 clone M4I22 (ESSAII project); contains   EST gb:T44967. "	DPlate 059	E10			AU174954	AU174953			15	J19
7003	g_7003	FE0055		DPlate 057	F10			AU174571				15	K19
7004	g_7004	FL0020	">AB015438_1(AB015438|pid:g4140029) Cynops pyrrhogaster mRNA for alpha   1 type I collagen, complete cds. "	DPlate 059	F10			AU176498				15	L19
7005	g_7005	FE0079	>E70806(E70806) hypothetical glycine-rich protein Rv3507 -   Mycobacterium tuberculosis (strain H37RV)   &MTV023_14(AL022022|pid:g2924444) 	DPlate 057	G10			AU174590				15	M19
7006	g_7006	FL0036	">OLRKLP2_1(U72725|pid:g2586083) Oryza longistaminata receptor   kinase-like protein gene, family member A1, complete   cds; Xa21 gene family member A1; downstream of   microsatellite region; disease resistance gene family   member. "	DPlate 059	G10			AU174907	AU174908			15	N19
7007	g_7007	FE0095	>(P91850) MACROPHAGE MIGRATION INHIBITORY FACTOR HOMOLOG (BMMIF). 	DPlate 057	H10			AU174605	AU174604			15	O19
7008	g_7008	FL0044		DPlate 059	H10			AU174913	AU174912			15	P19
7009	g_7009	RA0317	>(P37834) PEROXIDASE PRECURSOR (EC 1.11.1.7).   &RICPEROX_1(D14997|pid:g287401) 	DPlate 061	A04			D23835	AU090601			16	A07
7010	g_7010	RA1171		DPlate 063	A04			AU175069	AU176508			16	B07
7011	g_7011	RA0318		DPlate 061	B04			AU173078				16	C07
7012	g_7012	RA1179	">ATAC006260_15(AC006260|pid:g4371292) Arabidopsis thaliana   chromosome II BAC T2N18 genomic sequence, complete   sequence; unknown protein. "	DPlate 063	B04			AU173132	AU173133			16	D07
7013	g_7013	RA0326	">AB004537_5(AB004537|pid:g2257524) Schizosaccharomyces pombe 37 kb   genomic DNA, clone c213; similar to S.cerevisiae   HYPOTHETICAL 47.4KD PROTEIN: SWISS_PROT ACC# P34220. "	DPlate 061	C04			AU173079	AU173080			16	E07
7014	g_7014	RA1187	">ATAC007017_1(AC007017|pid:g4510361) Arabidopsis thaliana chromosome   II BAC F11F19 genomic sequence, complete sequence. "	DPlate 063	C04			D24087	AU173134			16	F07
7015	g_7015	RA0358		DPlate 061	D04			AU173082	AU173083			16	G07
7016	g_7016	RA1164		DPlate 063	D04			D24081	AU101649			16	H07
7017	g_7017	RA0366	">RICRCC3_1(L27208|pid:g786132) Oryza sativa root-specific RCc3 mRNA,   complete cds. &S53012(S53012) "	DPlate 061	E04			AU173085				16	I07
7018	g_7018	RA1233	">ATT10I14_14(AL021712|pid:g2832681) Arabidopsis thaliana DNA   chromosome 4, BAC clone T10I14 (ESSAII project);   similarity to light induced protein homolog, Arabidopsis   thaliana, PATCHX:E326816; contains EST gb:T45053,   R86992. "	DPlate 063	E04			D24093	AU031734			16	J07
7019	g_7019	RA0382	">ATU93845_1(U93845|pid:g1943751) Arabidopsis thaliana ER-type calcium   pump (ACA3) mRNA, complete cds.   &ATU96455_1(U96455|pid:g2078292) "	DPlate 061	F04			AU173088	AU173089			16	K07
7020	g_7020	RA1281		DPlate 063	F04			AU173137	AU173138			16	L07
7021	g_7021	RA0321	">F8K4_21(AC004392|pid:g3367534) Arabidopsis thaliana chromosome 1 BAC   F8K4 sequence, complete sequence; Strong similarity to   coatamer alpha subunit (HEPCOP) homolog gb|U24105 from   Homo sapiens.. "	DPlate 061	G04			D23837	AU031660			16	M07
7022	g_7022	RA1275	>HSP63_1(X69910|pid:g297408) H.sapiens p63 mRNA for transmembrane   protein. &S33377(S33377) 	DPlate 063	G04			AU176510				16	N07
7023	g_7023	RA0369	">ATF18F4_17(AL021637|pid:g2827661) Arabidopsis thaliana DNA   chromosome 4, BAC clone F18F4 (ESSAII project); Protein   sequence is in conflict with the conceptual translation;   5-substituted hydantoins to the corresponding L-amino   acids, Pseudomonas sp., PIR2:D42594; contains EST   gb:T45208. "	DPlate 061	H04			AU173086	AU173087			16	O07
7024	g_7024	RA1268	">ATAC002510_10(AC002510|pid:g2618693) Arabidopsis thaliana   chromosome II BAC T32G6 genomic sequence, complete   sequence; "	DPlate 063	H04			AU176509				16	P07
7025	g_7025	RA0557	">ATF9D16_16(AL035394|pid:g4454038) Arabidopsis thaliana DNA   chromosome 4, BAC clone F9D16 (ESSAII project); strong   similarity to disease resistance response protein 206-d   -Pisum sativum (pea), gb:M18250; contains EST   gb:AA067466, AI100528. "	DPlate 061	A10			D23909	AU164576			16	A19
7026	g_7026	RA1415	">AF056316_1(AF056316|pid:g4128206) Avicennia marina 40S ribosome   protein S7 mRNA, complete cds.   &AF098519_1(AF098519|pid:g3851636) "	DPlate 063	A10			D39054	AU173148			16	B19
7027	g_7027	RA0565		DPlate 061	B10			D23912	AU031690			16	C19
7028	g_7028	RA1439	>(P50249) ADENOSYLHOMOCYSTEINASE (EC 3.3.1.1)   (S-ADENOSYL-L-HOMOCYSTEINE HYDROLASE) (ADOHCYASE).   &PSSADHY_1(X79905|pid:g758247) &S71621(S71621) 	DPlate 063	B10			D24155	AU173149			16	D19
7029	g_7029	RA0511		DPlate 061	C10			AU173099	AU173100			16	E19
7030	g_7030	RA1447	>(P25776) ORYZAIN ALPHA CHAIN PRECURSOR (EC 3.4.22.-).   &KHRZOA(JU0388;A40053) &RICOZA_1(D90406|pid:g218181) 	DPlate 063	C10			AU175070				16	F19
7031	g_7031	RA0559	>MDPPMD1_1(Z47076|pid:g1143511) M.domestica Borkh mRNA for   serine/threonine protein phosphatase (PPX). 	DPlate 061	D10			D23910	AU031687			16	G19
7032	g_7032	RA1479	">AB001884_1(AB001884|pid:g3618312) Oryza sativa mRNA for zinc finger   protein, complete cds, clone:R1479. "	DPlate 063	D10			D24180	AU101653			16	H19
7033	g_7033	RA0560	">ATT9A14_8(AL035656|pid:g4490332) Arabidopsis thaliana DNA   chromosome 4, BAC clone T9A14 (ESSA project); contains   EST gb:T42864, R89995, Z17942, AA712680, N96390, F15327.   "	DPlate 061	E10			AU031688	AU031689			16	I19
7034	g_7034	RA1487		DPlate 063	E10			AU173159				16	J19
7035	g_7035	RA0505	">ATAC007019_24(AC007019|pid:g4417286) Arabidopsis thaliana   chromosome II BAC F7D8 genomic sequence, complete   sequence; "	DPlate 061	F10			D23883	AU101616			16	K19
7036	g_7036	RA1424	>(P51957) SERINE/THREONINE-PROTEIN KINASE NRK2 (EC 2.7.1.-)   (SERINE/THREONINE KINASE 2).   &HUMSTK2A_1(L20321|pid:g348245) &I78885(I78885) 	DPlate 063	F10			D24144	AU031745			16	L19
7037	g_7037	RA0521	>CELW03D2_10(AF000298|pid:g1947160) Caenorhabditis elegans cosmid   W03D2; weak similarity to collagens; glycine- and   proline-rich. 	DPlate 061	G10			D23888	AU031684			16	M19
7038	g_7038	RA1440	>YSCH9205_8(U10556|pid:g500837) Saccharomyces cerevisiae chromosome   VIII cosmid 9205; YHR079C. 	DPlate 063	G10			D24156	C22584			16	N19
7039	g_7039	RA0569	">PNI2OMTC_1(D45075|pid:g1100743) Panicum miliaceum mRNA for   2-oxoglutarate/malate translocator, complete cds;   mitochondrial 2-oxoglutarate/malate translocator.   &S65042(S65042) "	DPlate 061	H10			D23915	AU031691			16	O19
7040	g_7040	RA1464	>PHI13INT_1(X82312|pid:g758229) Bacteriophage phi-13 integrase gene.   &S77632(S77632;S52761) 	DPlate 063	H10			D24170	AU031749			16	P19
7041	g_7041	RA1872	">AB012766_1(AB012766|pid:g3298476) Oryza sativa gene for ovp2,   complete cds. &D45384_1(D45384|pid:g1747296)   &S72527(S72527) "	DPlate 065	A04			AU173250				17	A07
7042	g_7042	RA2424	>F9D12_3(AF077407|pid:g3319340) Arabidopsis thaliana BAC F9D12;   contains similarity to E. coli cation transport protein   ChaC (GB:D90756); coded for by A. thaliana cDNA R30560. 	DPlate 067	A04			D24715	AU173362			17	B07
7043	g_7043	RA1888	">OSU82833_1(U82833|pid:g1778821) Oryza sativa   S-adenosyl-L-methionine synthetase (pOS-SAMS2) mRNA,   complete cds. "	DPlate 065	B04			D24436	AU090503			17	C07
7044	g_7044	RA2432	">ATT24A18_5(AL035680|pid:g4490706) Arabidopsis thaliana DNA   chromosome 4, BAC clone T24A18 (ESSA project);   similarity to GTPase activating protein - Yarrowi. "	DPlate 067	B04			D24719	AU162437			17	D07
7045	g_7045	RA1896		DPlate 065	C04			D24442	AU173253			17	E07
7046	g_7046	RA2440		DPlate 067	C04			AU173366	AU173367			17	F07
7047	g_7047	RA1901	>OSRBOHA_1(X93301|pid:g1235569) O.sativa mRNA for NAD(P)H oxidase. 	DPlate 065	D04			D39082	AU173254			17	G07
7048	g_7048	RA2464	">AC004557_27(AC004557|pid:g3935184) Genomic sequence for Arabidopsis   thaliana BAC F17L21, complete sequence; hypothetical   protein. "	DPlate 067	D04			AU173370	AU173371			17	H07
7049	g_7049	RA1925	>(Q09217) HYPOTHETICAL 37.0 KD PROTEIN B0495.8 IN CHROMOSOME II.   &CELB0495_6(U21317|pid:g687823) 	DPlate 065	E04			D28304	AU031815			17	I07
7050	g_7050	RA2480	">AF093537_1(AF093537|pid:g3747044) Zea mays blue copper protein   mRNA, partial cds; similar to pea blue copper protein in   GenBank Accession Number Z25471. "	DPlate 067	E04			D24745	AU173380			17	J07
7051	g_7051	RA1933		DPlate 065	F04			D24445	AU031817			17	K07
7052	g_7052	RA2488	">MCU79765_1(U79765|pid:g1724100) Mesembryanthemum crystallinum   voltage-dependent anion-selective channel protein porin   (VDAC) mRNA, complete cds. "	DPlate 067	F04			AU173384	AU173385			17	L07
7053	g_7053	RA1957	>A18812_1(A18812|pid:g512381) extensin gene. &S12022(S12022) 	DPlate 065	G04			D28307	AU031823			17	M07
7054	g_7054	RA2701		DPlate 067	G04			AU181016				17	N07
7055	g_7055	RA1973	>EDKCHBETA_1(AJ225806|pid:g2832783) Egeria densa mRNA for potassium   channel beta subunit; highly homologous to the family of   potassium channel beta subunits in plants and animals.. 	DPlate 065	H04			D39105	AU173272			17	O07
7056	g_7056	RA2741	>BVRNAEF2_1(Z97178|pid:g2369714) Beta vulgaris cDNA for elongation   factor 2. 	DPlate 067	H04			D24902	AU031941			17	P07
7057	g_7057	RA2090	">ATF17L22_25(AL035527|pid:g4455287) Arabidopsis thaliana DNA   chromosome 4, BAC clone F17L22 (ESSAII project);   contains EST gb:T43509, T43917, T88633. "	DPlate 065	A10			AU173304	AU173305			17	A19
7058	g_7058	RA2942	>OSPANC_1(Y10253|pid:g2292978) O.sativa panC gene. 	DPlate 067	A10			D25017	AU173408			17	B19
7059	g_7059	RA2011	>H70708(H70708) probable ptrBb protein - Mycobacterium tuberculosis   (strain H37RV) &MTCY369_26(Z80226|pid:g1550659) 	DPlate 065	B10			D24471	AU173286			17	C19
7060	g_7060	RA2966	">ATF20D10_32(AL035538|pid:g4467126) Arabidopsis thaliana DNA   chromosome 4, BAC clone F20D10 (ESSA project); strong   similarity to guanine nucleotide-exchange protein -Bos   taurus, PID:g2674107. "	DPlate 067	B10			D25038	AU095499			17	D19
7061	g_7061	RA2019	">AF037220_1(AF037220|pid:g2708322) Mesembryanthemum crystallinum   inositol monophosphatase (IMP1) mRNA, complete cds. "	DPlate 065	C10			D24476	AU173289			17	E19
7062	g_7062	RA2974		DPlate 067	C10			D25045	AU173414			17	F19
7063	g_7063	RA2043	">AF098636_1(AF098636|pid:g3851640) Nicotiana tabacum chaperone GrpE   type 2 (GrpE2) mRNA, nuclear gene encoding mitochondrial   protein, complete cds. "	DPlate 065	D10			D24489	AU173293			17	G19
7064	g_7064	RA2903	">ATU38916_1(U38916|pid:g1145627) Arabidopsis thaliana lipase mRNA,   complete cds. &S68410(S68410) "	DPlate 067	D10			D24987	AU173401			17	H19
7065	g_7065	RA2059	>HVCH4H_2(Y14573|pid:g2894378) Hordeum vulgare DNA for chromosome   4H; 3' not yet predicted. 	DPlate 065	E10			D24495	AU031839			17	I19
7066	g_7066	RA2927	>(P22277) 40S RIBOSOMAL PROTEIN S27A. 	DPlate 067	E10			D25005	AU031969			17	J19
7067	g_7067	RA2067		DPlate 065	F10			AU176522				17	K19
7068	g_7068	RA2943	>ATH224306_1(AJ224306|pid:g3319884) Arabidopsis thaliana PRT1 gene.    &ATH224307_1(AJ224307|pid:g3319886) 	DPlate 067	F10			D25018				17	L19
7069	g_7069	RA2091	">ZMA132240_1(AJ132240|pid:g4160402) Zea mays eIF-5 gene, exons 1-2. "	DPlate 065	G10			D24519	AU031842			17	M19
7070	g_7070	RA2951	>BSUB0008_28(Z99111|pid:g2633727) Bacillus subtilis complete genome   (section 8 of 21): from 1394791 to 1603020;   &D69863(D69863) 	DPlate 067	G10			D25025				17	N19
7071	g_7071	RA2004	">ATAC003058_24(AC003058|pid:g3135274) Arabidopsis thaliana   chromosome II BAC F27F23 genomic sequence, complete   sequence; "	DPlate 065	H10			D24466	AU173284			17	O19
7072	g_7072	RA2967	>A34493(A34493) collagen alpha 1(IX) chain short form precursor -   chicken (fragment) &CHKCOLCOR_1(M28658|pid:g555436) 	DPlate 067	H10			D25039	AU031973			17	P19
7073	g_7073	RA3313		DPlate 069	A04			D39311	AU032045			18	A07
7074	g_7074	RB0082		DPlate 071	A04			AU070686				18	B07
7075	g_7075	RA3361	">ATAC002334_4(AC002334|pid:g2924772) Arabidopsis thaliana chromosome   II BAC F25I18 genomic sequence, complete sequence;   unknown protein. "	DPlate 069	B04			D39335	AU032051			18	C07
7076	g_7076	RB0003	>A47101_1(A47101|pid:g2301167) Sequence 7 from Patent WO9527790;   unnamed protein product. &A62308_1(A62308|pid:g3716272)   	DPlate 071	B04			AU070645	AU163452			18	D07
7077	g_7077	RA3385	">T2K10_8(AC005966|pid:g4249382) Arabidopsis thaliana chromosome 1   BAC T2K10 sequence, complete sequence; Strong similarity   to gi|3337350 F13P17.3 putative permease from   Arabidopsis thaliana BAC gb|AC004481.. "	DPlate 069	C04			D39351	AU032056			18	E07
7078	g_7078	RB0043	>AF027868_39(AF027868|pid:g2619044) Bacillus subtilis chromosome   region between terC and odhAB; similar to different   acetyltrasferases. &BSUB0011_69(Z99114|pid:g2634299)   &H69899(H69899) 	DPlate 071	C04			AU070668				18	F07
7079	g_7079	RA3393	">AF009631_1(AF009631|pid:g2271477) Arabidopsis thaliana AP47/50p   mRNA, complete cds; AtAP47/50p; similar to medium   subunits of adaptor complex 1 and 2; medium chain of CCV   associated adaptor complex. "	DPlate 069	D04			D25154	AU032057			18	G07
7080	g_7080	RB0051		DPlate 071	D04			AU176526				18	H07
7081	g_7081	RA3314	">AF022460_1(AF022460|pid:g2739002) Glycine max cytochrome P450   monooxygenase CYP83D1p (CYP83D1) mRNA, partial cds;   cytochrome P450 monooxygenase. "	DPlate 069	E04			AU173484	AU173485			18	I07
7082	g_7082	RB0059		DPlate 071	E04			AU070677	AU095569			18	J07
7083	g_7083	RA3330	">ATT5C23_17(AL049500|pid:g4539465) Arabidopsis thaliana DNA   chromosome 4, BAC clone T5C23 (ESSA project);   similarity to Fly Fas-associated factor (FFAF),   Drosophila melanogaster, AB013610; contains EST   gb:H37225, AA605382. "	DPlate 069	F04			D39322	AU101671			18	K07
7084	g_7084	RB0067	">ATU78721_12(U78721|pid:g2253579) Arabidopsis thaliana chromosome II   BAC T1B8 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 071	F04			AU076228	AU091464			18	L07
7085	g_7085	RA3346	">AF056204_1(AF056204|pid:g3063637) Gossypium hirsutum thioesterase   homolog mRNA, partial cds; A12B11-2; expressed during   water deficit. "	DPlate 069	G04			AU173490	AU173491			18	M07
7086	g_7086	RB0012		DPlate 071	G04			AU070649				18	N07
7087	g_7087	RA3354		DPlate 069	H04			D39332				18	O07
7088	g_7088	RB0020	">AB004242_1(AB004242|pid:g2190012) Raphanus sativus mRNA for din1,   complete cds. "	DPlate 071	H04			AU070656	AU162561			18	P07
7089	g_7089	RA3462		DPlate 069	A10			AU070194	AU173512			18	A19
7090	g_7090	RB0179		DPlate 071	A10			AU077749				18	B19
7091	g_7091	RA3478	>(P43729) GTP-BINDING PROTEIN LEPA. &I64042(I64042)   &U32687_5(U32687|pid:g1572960) 	DPlate 069	B10			AU032084	AU162490			18	C19
7092	g_7092	RB0195		DPlate 071	B10			AU070756				18	D19
7093	g_7093	RA3494	">MMU83902_1(U83902|pid:g4099131) Mus musculus mitotic checkpoint   component Mad2 mRNA, complete cds. "	DPlate 069	C10			AU032090	AU173518			18	E19
7094	g_7094	RB0108	">CEC18B12_4(AL031620|pid:g3642014) Caenorhabditis elegans cosmid   C18B12, complete sequence; similar to Zinc finger, C3HC4   type (RING finger). "	DPlate 071	C10			AU173840	AU173841			18	F19
7095	g_7095	RA3447	">ATF23E12_21(AL022604|pid:g3080427) Arabidopsis thaliana DNA   chromosome 4, BAC clone F23E12 (ESSAII project);   similarity to protein kinase APK1, Arabidopsis thaliana,   PIR2:S28615; contains EST gb:F13911. "	DPlate 069	D10			AU032074	AU162480			18	G19
7096	g_7096	RB0148	">OSU89895_1(U89895|pid:g1888551) Oryza sativa pathogenesis-related   protein class 1 (PR-1) gene, complete cds; induced by   pathogen attack in plants. "	DPlate 071	D10			AU070721	AU101690			18	H19
7097	g_7097	RA3455	">AB015204_1(AB015204|pid:g4063821) Oryza sativa gene for plastidic   ATP sulfurylase, complete cds. "	DPlate 069	E10			AU065356	AU162482			18	I19
7098	g_7098	RB0164	>RLORF471_1(X77198|pid:g450923) R.leguminosarum DNA for orf471;   orf471; homologous to NodT. &S41407(S41407) 	DPlate 071	E10			AU162571				18	J19
7099	g_7099	RA3463	>SPPDR5ABC_1(Z70524|pid:g1514643) S.polyrrhiza mRNA for PDR5-like ABC   transporter. 	DPlate 069	F10			AU065360	AU101680			18	K19
7100	g_7100	RB0218		DPlate 071	F10			AU070768				18	L19
7101	g_7101	RA3487	">ATAC002341_6(AC002341|pid:g2342723) Arabidopsis thaliana chromosome   II BAC T14G11 genomic sequence, complete sequence;   unknown protein. "	DPlate 069	G10			AU173517				18	M19
7102	g_7102	RB0266	>AFABF1_1(Z48429|pid:g1159877) A.fatua mRNA for DNA-binding protein   (clone ABF1). &S61413(S61413) 	DPlate 071	G10			AU093470	AU070801			18	N19
7103	g_7103	RA3495	">AF058757_1(AF058757|pid:g3170601) Zea mays zinc finger protein ID1   (id1) mRNA, complete cds. "	DPlate 069	H10			AU032091	AU173519			18	O19
7104	g_7104	RB0290		DPlate 071	H10			AU173846	AU070812			18	P19
7105	g_7105	RB0890	">AF016485_138(AF016485|pid:g2822416) Halobacterium sp. NRC-1 plasmid   pNRC100, complete plasmid sequence; ORF H1591; similar   to Schizosaccharomyces pombe orc1+p, gp:gi-1163108; %   similarity 35.0, % identity 23.8,length 548;origin   recognition protein in the CDC gene family 5'   interruption by ISH2; similar to uninterrupted version   of ORF H0761. "	DPlate 073	A04			AU162635	AU071199			19	A07
7106	g_7106	SA0325	">ATAC007019_27(AC007019|pid:g4417289) Arabidopsis thaliana   chromosome II BAC F7D8 genomic sequence, complete   sequence; unknown protein. "	DPlate 075	A04			AU162654	AU056141			19	B07
7107	g_7107	RB0803	">ATU61231_1(U61231|pid:g1432145) Arabidopsis thaliana cytochrome   P450 (CYP89A2) mRNA, complete cds. "	DPlate 073	B04			AU090603				19	C07
7108	g_7108	SA0333	>CAN012165_1(AJ012165|pid:g3808101) Capsicum annuum mRNA for   chloroplast protease (CACP)from the AAA atpase family;   AAA atpase family. 	DPlate 075	B04			AU162658	AU056152			19	D07
7109	g_7109	RB0811		DPlate 073	C04			AU071142	AU162630			19	E07
7110	g_7110	SA0349		DPlate 075	C04			AU056172	AU056173			19	F07
7111	g_7111	RB0843	">ATF8F16_19(AL021633|pid:g2827533) Arabidopsis thaliana DNA   chromosome 4, BAC clone F8F16 (ESSAII project); "	DPlate 073	D04			AU071162				19	G07
7112	g_7112	SA0357	">T12H20_7(AF080119|pid:g3600036) Arabidopsis thaliana BAC T12H20;   contains similarity to protein kinase domains (Pfam:   pkinase.hmm, score: 227.04); coded for by A. thaliana   cDNA T88185. "	DPlate 075	D04			AU162662	AU056184			19	H07
7113	g_7113	RB0851	">AC004557_12(AC004557|pid:g3935169) Genomic sequence for Arabidopsis   thaliana BAC F17L21, complete sequence; unknown;   similar to EST gb|AA650671 and gb|T20610. "	DPlate 073	E04			AU071168				19	I07
7114	g_7114	SA0365	">AF004213_1(AF004213|pid:g2224927) Arabidopsis thaliana   ethylene-insensitive3-like1 (EIL1) mRNA, complete cds. "	DPlate 075	E04			AU082743	AU056193			19	J07
7115	g_7115	RB0883		DPlate 073	F04			AU071194				19	K07
7116	g_7116	SA0373		DPlate 075	F04			AU056201	AU056202			19	L07
7117	g_7117	RB0820		DPlate 073	G04			AU071150				19	M07
7118	g_7118	SA0381		DPlate 075	G04			AU056211				19	N07
7119	g_7119	RB0892		DPlate 073	H04			AU071201				19	O07
7120	g_7120	SA0310	">ATAC006135_17(AC006135|pid:g4218010) Arabidopsis thaliana   chromosome II BAC F24H14 genomic sequence, complete   sequence; &ATAC006439_1(AC006439|pid:g4309720) "	DPlate 075	H04			AU070252	AU173878			19	P07
7121	g_7121	SA0018	">ATAC004747_9(AC004747|pid:g3413704) Arabidopsis thaliana chromosome   II BAC T19L18 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 073	A10			AU055721	AU055722			19	A19
7122	g_7122	SA0402		DPlate 075	A10			AU056227				19	B19
7123	g_7123	SA0026		DPlate 073	B10			AU055735	AU055736			19	C19
7124	g_7124	SA0418	>S51839(S51839) D13F(MYBST1) protein - potato   &S74753_1(S74753|pid:g786426) &Q]). 	DPlate 075	B10			AU091716	AU056245			19	D19
7125	g_7125	SA0042		DPlate 073	C10			AU055763	AU055764			19	E19
7126	g_7126	SA0426		DPlate 075	C10			AU056255	AU056256			19	F19
7127	g_7127	SA0058	">ATAC006569_9(AC006569|pid:g4512699) Arabidopsis thaliana chromosome   II BAC F11A3 genomic sequence, complete sequence; "	DPlate 073	D10			AU078717	AU055794			19	G19
7128	g_7128	SA0434		DPlate 075	D10			AU162667	AU056266			19	H19
7129	g_7129	SA0066	>(Q06245) EXOCYST COMPLEX COMPONENT SEC10. &S68482(S68482)   &SCSEC10_1(Y08789|pid:g1781307)   &YSCL9362_12(U51921|pid:g1234854) 	DPlate 073	E10			AU173861	AU055807			19	I19
7130	g_7130	SA0442	>(P80595) APYRASE PRECURSOR (EC 3.6.1.5) (ATP-DIPHOSPHATASE)   (ADENOSINE DIPHOSPHATASE) (ADPASE)   (ATP-DIPHOSPHOHYDROLASE). &JC4616(JC4616;PC4147)   &STU58597_1(U58597|pid:g1381633) 	DPlate 075	E10			AU056279	AU056280			19	J19
7131	g_7131	SA0090	">AC003027_17(AC003027|pid:g4204313) Arabidopsis thaliana chromosome   I BAC F21M11 genomic sequence, complete sequence;   Hypothetical protein. "	DPlate 073	F10			AU055841	AU055842			19	K19
7132	g_7132	SA0466	">ATAP21_18(Z99707|pid:g4006862) Arabidopsis thaliana DNA chromosome   4, ESSA I AP2 contig fragment No. 1; "	DPlate 075	F10			AU081017	AU056316			19	L19
7133	g_7133	SA0019		DPlate 073	G10			AU078715	AU055723			19	M19
7134	g_7134	SA0482	">AB023790_1(AB023790|pid:g4512593) Ipomoea batatas f3h III mRNA for   flavanone 3-hydroxyrase, complete cds. "	DPlate 075	G10			AU173884	AU056337			19	N19
7135	g_7135	SA0027	">T31J12_6(AC006416|pid:g4337177) Arabidopsis thaliana chromosome 1   BAC T31J12 sequence, complete sequence; Identical to   gb|Y10557 g5bf gene from Arabidopsis thaliana. ESTs   gb|R30578, gb|R90475, gb|T22384, gb|T22425, gb|N64934   and gb|T46767 come from this gene.. "	DPlate 073	H10			AU055737	AU055738			19	O19
7136	g_7136	SA0403	">AF008121_1(AF008121|pid:g2511533) Eleusine indica alpha-tubulin 2   (TUA2) mRNA, complete cds. "	DPlate 075	H10			AU056228	AU056229			19	P19
7137	g_7137	SA0528	">D90909_48(D90909|pid:g1652892) Synechocystis sp. PCC6803 complete   genome, 11/27, 1311235-1430418; ORF_ID:slr0864.   &S74849(S74849) "	DPlate 076	A04			AU173891	AU173892			20	A07
7138	g_7138	SA1329		DPlate 079	A04			AU057304				20	B07
7139	g_7139	SA0536		DPlate 076	B04			AU162681	AU056387			20	C07
7140	g_7140	SA1345		DPlate 079	B04			AU057319	AU057320			20	D07
7141	g_7141	SA0592		DPlate 076	C04			AU173899	AU173900			20	E07
7142	g_7142	SA1369	>SDTUBERPR_1(X98304|pid:g1370589) S.demissum mRNA for protein   induced upon tuberization; putative transit peptide. 	DPlate 079	C04			AU162748	AU057349			20	F07
7143	g_7143	SA0505	">AB010259_1(AB010259|pid:g3149952) Arabidopsis thaliana mRNA for   DRH1, complete cds. "	DPlate 076	D04			AU162675	AU056356			20	G07
7144	g_7144	SA1385	">AF093636_1(AF093636|pid:g3885896) Oryza sativa plastocyanin   precursor, mRNA, complete cds. "	DPlate 079	D04			AU176533				20	H07
7145	g_7145	SA0529		DPlate 076	E04			AU070258				20	I07
7146	g_7146	SA1338	">BPU04309_2(U04309|pid:g530798) Bacteriophage phi-LC3 putative holin   (lysA) gene and putative murein hydrolase (lysB) gene,   complete cds; putative murein hydrolase. "	DPlate 079	E04			AU057312	AU057313			20	J07
7147	g_7147	SA0545	">ATAC004484_11(AC004484|pid:g3075394) Arabidopsis thaliana   chromosome II BAC T1D16 genomic sequence, complete   sequence; &ATH010713_1(AJ010713|pid:g3559809) "	DPlate 076	F04			AU056396				20	K07
7148	g_7148	SA1346	">F20P5_3(AC002062|pid:g2194117) Sequence of BAC F20P5 from   Arabidopsis thaliana chromosome 1, complete sequence;   Strong similarity to Arabidopsis receptor protein kinase   PR5K (gb|ATU48698).. "	DPlate 079	F04			AU057321				20	L07
7149	g_7149	SA0593		DPlate 076	G04			AU173901	AU173902			20	M07
7150	g_7150	SA1354		DPlate 079	G04			AU057332	AU057333			20	N07
7151	g_7151	SA0507	">ATAC005312_6(AC005312|pid:g3894162) Arabidopsis thaliana chromosome   II BAC T16F16 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 076	H04			AU173888	AU056358			20	O07
7152	g_7152	SA1386		DPlate 079	H04			AU173953				20	P07
7153	g_7153	SA0671	">ATAC004261_17(AC004261|pid:g3402711) Arabidopsis thaliana   chromosome II BAC T3K9 genomic sequence, complete   sequence; "	DPlate 076	A10			AU056545	AU056546			20	A19
7154	g_7154	SA1512	">D90901_37(D90901|pid:g1651934) Synechocystis sp. PCC6803 complete   genome, 3/27, 271600-402289; ORF_ID:sll1188.   &S74709(S74709) "	DPlate 079	A10			AU057509	AU173960			20	B19
7155	g_7155	SA0679	">ATF28A23_14(AL021961|pid:g2911052) Arabidopsis thaliana DNA   chromosome 4, BAC clone F28A23 (ESSAII project);   similarity to TEB4 protein, Homo sapiens,   PATCHX:G2331104; Contains CAP protein signatures,   [VLARLDIQAARLE]. "	DPlate 076	B10			AU056554	AU056555			20	C19
7156	g_7156	SA1520	">ATAC005170_27(AC005170|pid:g3738336) Arabidopsis thaliana   chromosome II BAC T29E15 genomic sequence, complete   sequence; unknown protein. "	DPlate 079	B10			AU057515	AU057516			20	D19
7157	g_7157	SA0695	>VFZ93775_1(Z93775|pid:g1935021) V.faba mRNA for hexose transporter.   	DPlate 076	C10			AU056572	AU056573			20	E19
7158	g_7158	SA1544		DPlate 079	C10			AU057543	AU057544			20	F19
7159	g_7159	SA0608	">ATFCA5_23(Z97340|pid:g2244973) Arabidopsis thaliana DNA chromosome   4, ESSA I contig fragment No. 5; similarity to extensin   class 1 protein. &H71427(H71427) "	DPlate 076	D10			AU173904	AU056456			20	G19
7160	g_7160	SA1552		DPlate 079	D10			AU173962	AU057553			20	H19
7161	g_7161	SA0664	">CEF17C11_11(Z72507|pid:g3876064) Caenorhabditis elegans cosmid   F17C11, complete sequence; similar to Thrombospondin   type 1 domain; cDNA EST EMBL:D34389 comes from this   gene; cDNA EST EMBL:D37437 comes from this gene; cDNA   EST EMBL:D64645 comes from this gene; cDNA EST   EMBL:D65908 comes from this gene; cDNA EST EMBL:D67737   comes from this gene; cDNA EST EMBL:D69515 comes from   this gene; cDNA EST EMBL:C13585 comes from this gene;   cDNA EST EMBL:C11441 comes from this gene; cDNA EST   yk356f12.3 comes from this gene; cDNA EST yk356f12.5   comes from this gene; cDNA EST yk270f1.3 comes from this   gene; cDNA EST yk270f1.5 comes from this gene; cDNA EST   yk226b1.3 comes from this gene; cDNA EST yk226b1.5 comes   from this gene. &CEF53B7_4(Z72510|pid:g3877441) "	DPlate 076	E10			AU056533	AU056534			20	I19
7162	g_7162	SA1584	">ATAC004684_16(AC004684|pid:g3236248) Arabidopsis thaliana   chromosome II BAC F13M22 genomic sequence, complete   sequence; unknown protein. "	DPlate 079	E10			AU057581	AU173963			20	J19
7163	g_7163	SA0672	">ATAC006931_22(AC006931|pid:g4512688) Arabidopsis thaliana   chromosome II BAC F7D19 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 076	F10			AU173905	AU056547			20	K19
7164	g_7164	SA1521		DPlate 079	F10			AU057517				20	L19
7165	g_7165	SA0688	">ATFCA0_24(Z97335|pid:g2244771) Arabidopsis thaliana DNA chromosome   4, ESSA I contig fragment No. 0; similarity to X.laevis   mRNA for KLP2 (kinesin-like protein required for   centrosome separation during mitosis). &H71402(H71402) "	DPlate 076	G10			AU173906	AU056566			20	M19
7166	g_7166	SA1593		DPlate 079	G10			AU175138	AU175139			20	N19
7167	g_7167	SA0696		DPlate 076	H10			AU173910				20	O19
7168	g_7168	SA1514	">AF012897_1(AF012897|pid:g2293568) Oryza sativa HvB12D homolog mRNA,   complete cds. "	DPlate 079	H10			AU175137				20	P19
7169	g_7169	SS0053		DPlate 081	A04			AU032446	AU032447			21	A07
7170	g_7170	SS4266	>ZMCABCP29_1(Z50801|pid:g2326947) Z.mays mRNA for chlorophyll   a/b-binding protein CP29. 	DPlate 083	A04			AU174047	AU174048			21	B07
7171	g_7171	SS0077	>S51590(S51590) mitochondrial processing peptidase (EC 3.4.99.41)   alpha-II chain precursor - potato   &STAIIMPP_1(X80236|pid:g587562) 	DPlate 081	B04			AU065773	AU090574			21	C07
7172	g_7172	SS4203	">AF003347_1(AF003347|pid:g2688839) Thlaspi goesingense ATP   phosphoribosyltransferase (THG1) mRNA, complete cds;   histidine biosynthetic enzyme. "	DPlate 083	B04			AU174038	AU174039			21	D07
7173	g_7173	SS0093		DPlate 081	C04			AU181025				21	E07
7174	g_7174	SS4227	>ATLBNT1_1(X77503|pid:g510238) Arabadopsis thaliana Landsberg NT1   mRNA. &S46236(S46236) 	DPlate 083	C04			D48153	AU162998			21	F07
7175	g_7175	SS0006	">ATAC005167_10(AC005167|pid:g3757521) Arabidopsis thaliana chromosome   II BAC F12A24 genomic sequence, complete sequence;   unknown protein. "	DPlate 081	D04			AU032430	AU032431			21	G07
7176	g_7176	SS4235	>HVLHCA2_1(X84308|pid:g666054) H.vulgare mRNA for photosysteme I   antenna protein. &S52341(S52341) 	DPlate 083	D04			D48161	AU174041			21	H07
7177	g_7177	SS0022	>(P03706) ENDOLYSIN (EC 3.2.1.-) (LYSIS PROTEIN) (LYSOZYME).   &EYBPL(B04333;H43012;A93400;A04328)   &LAMCG_66(J02459|pid:g215164) 	DPlate 081	E04			AU175141				21	I07
7178	g_7178	SS4275	">ITU51740_1(U51740|pid:g1272349) Ipomoea trifida secreted   glycoprotein 3 (ISG3) mRNA, complete cds. "	DPlate 083	E04			D48189	C22635			21	J07
7179	g_7179	SS0030		DPlate 081	F04			C23567	AU032440			21	K07
7180	g_7180	SS4283	">OSH3593_1(Y09809|pid:g1773004) O.sativa L. putative   disease-resistance gene, clone pH359-3, partial;   putative disease resistance gene.   &OSH3595_1(Y09810|pid:g1773006) "	DPlate 083	F04			D48195	AU174051			21	L07
7181	g_7181	SS0038	">AB012912_1(AB012912|pid:g3327868) Arabidopsis thaliana CIP7 mRNA   for COP1-Interacting Protein 7, complete cds. "	DPlate 081	G04			AU173979	C23568			21	M07
7182	g_7182	SS4212	">D90899_4(D90899|pid:g1651654) Synechocystis sp. PCC6803 complete   genome, 1/27, 1-133859; ORF_ID:sll0558. &S74430(S74430)   "	DPlate 083	G04			D48144	AU162993			21	N07
7183	g_7183	SS0054	">AF055898_1(AF055898|pid:g3694807) Zea mays alanine aminotransferase   (alt) gene, complete cds; AlaAT. "	DPlate 081	H04			AU173982				21	O07
7184	g_7184	SS4228	>S39394(S39394;S39395) protochlorophyllide reductase (EC 1.3.1.33)   precursor - wheat &TAPWR5PI_1(X76532|pid:g510677) 	DPlate 083	H04			D48154	AU032801			21	P07
7185	g_7185	SS2610		DPlate 081	A10			D47313	AU173989			21	A19
7186	g_7186	SS4979	>PSCP12_1(Z72489|pid:g1617206) P.sativum mRNA for CP12. 	DPlate 083	A10			D48646	AU075526			21	B19
7187	g_7187	SS2618	">AF064732_1(AF064732|pid:g3769472) Dianthus caryophyllus clone   cfpi-3 putative phospholipase A2 mRNA, complete cds. "	DPlate 081	B10			D47320	AU101749			21	C19
7188	g_7188	SS4940	">ATAC004669_22(AC004669|pid:g3201627) Arabidopsis thaliana   chromosome II BAC F7F1 genomic sequence, complete   sequence; "	DPlate 083	B10			AU174054	AU075513			21	D19
7189	g_7189	SS2626	">(P30352) SPLICING FACTOR SC35 (SC-35) (SPLICING COMPONENT, 35 KD)   (PR264 PROTEIN) (SPLICING FACTOR, ARGININE/SERINE-RICH,   2). &B42701(B42701;S17327)   &GGPR264_1(X62446|pid:g63752) "	DPlate 081	C10			D47324	AU173992			21	E19
7190	g_7190	SS4964	>STPRORICH_1(AJ000997|pid:g3402282) Solanum tuberosum mRNA for guard   cell proline-rich protein. 	DPlate 083	C10			D48635	AU075522			21	F19
7191	g_7191	SS2658	>(P38076) CYSTEINE SYNTHASE (EC 4.2.99.8) (O-ACETYLSERINE   SULFHYDRYLASE) (O-ACETYLSERINE (THIOL)-LYASE) (CSASE).   &JS0762(JS0762) &WHTCYS1_1(D13153|pid:g218335) 	DPlate 081	D10			D47342	AU101752			21	G19
7192	g_7192	SS4972	">MMU66887_1(U66887|pid:g1575575) Mus musculus DNA repair protein   RAD50 (RAD50) mRNA, complete cds. "	DPlate 083	D10			D48642	AU174057			21	H19
7193	g_7193	SS2674	">PAU97530_1(U97530|pid:g2688828) Prunus armeniaca   ethylene-forming-enzyme-like dioxygenase mRNA, complete   cds. "	DPlate 081	E10			D47356	AU032637			21	I19
7194	g_7194	SS4980	>LELRPGENE_1(X95269|pid:g1619300) L.esculentum LRP gene. 	DPlate 083	E10			D48647	AU174058			21	J19
7195	g_7195	SS2611		DPlate 081	F10			D47314	AU176540			21	K19
7196	g_7196	SS5001	>ATH9695_1(AJ009695|pid:g3355308) Arabidopsis thaliana wak4 gene. 	DPlate 083	F10			D48660	C22642			21	L19
7197	g_7197	SS2619		DPlate 081	G10			D47321	AU096224			21	M19
7198	g_7198	SS5009		DPlate 083	G10			D48666	AU174061			21	N19
7199	g_7199	SS2635	">ATAC005309_10(AC005309|pid:g3738285) Arabidopsis thaliana   chromosome II BAC F17A22 genomic sequence, complete   sequence; unknown protein. "	DPlate 081	H10			D47329	AU173997			21	O19
7200	g_7200	SS5041		DPlate 083	H10			AU174065				21	P19
7201	g_7201	SS6049		DPlate 085	A04			C24875	AU174107			22	A07
7202	g_7202	ST0837	">ATAC005851_14(AC005851|pid:g4063751) Arabidopsis thaliana chromosome   II BAC F24D13 genomic sequence, complete sequence;   &ATAC006929_1(AC006929|pid:g4510409) "	DPlate 087	A04			AU174164	AU174165			22	B07
7203	g_7203	SS6002		DPlate 085	B04			AU162097				22	C07
7204	g_7204	ST0853	">T22H22_19(AC005388|pid:g3776572) Sequence of BAC T22H22 from   Arabidopsis thaliana chromosome 1, complete sequence;   ESTs gb|R65052, gb|AA712146, gb|H76533, gb|H76282,   gb|AA650771, gb|H76287, gb|AA650887, gb|N37383,   gb|Z29721 and gb|Z29722 come from this gene.. "	DPlate 087	B04			AU174166	AU174167			22	D07
7205	g_7205	SS6018	">ATAC006283_6(AC006283|pid:g4432835) Arabidopsis thaliana chromosome   II BAC T1B3 genomic sequence, complete sequence; unknown   protein. "	DPlate 085	C04			AU175149	AU175150			22	E07
7206	g_7206	ST0861	>(P33077) AUXIN-INDUCED PROTEIN AUX2-11.   &ATAUX211_1(X53435|pid:g16197)   &ATHIAA4A_1(L15450|pid:g454285) 	DPlate 087	C04			D39491	AU097008			22	F07
7207	g_7207	SS6003	">ITU51741_1(U51741|pid:g1272351) Ipomoea trifida receptor protein   kinase 2 (IRK2) mRNA, partial cds; it is unknown whether   kinase domain is translated; gene contains a stop codon   in the putative receptor domain sequence. "	DPlate 085	D04			C24862	AU101846			22	G07
7208	g_7208	ST0877	">AF004830_1(AF004830|pid:g2688842) Cricetulus griseus serine   palmitoyltransferase LCB2 subunit mRNA, complete cds. "	DPlate 087	D04			D39499	AU033000			22	H07
7209	g_7209	SS6035	">AB012265_1(AB012265|pid:g3551182) Mus musculus mRNA for wizL,   complete cds. "	DPlate 085	E04			AU065940	AU091729			22	I07
7210	g_7210	ST0806		DPlate 087	E04			D39463	AU174158			22	J07
7211	g_7211	SS6059		DPlate 085	F04			AU075887				22	K07
7212	g_7212	ST0830	>(P33174) KINESIN-LIKE PROTEIN KIF4. &A54803(A54803;D44259)   &MUSKIF4_1(D12646|pid:g563773) 	DPlate 087	F04			AU174161	AU174162			22	L07
7213	g_7213	SS6004	">AF053565_1(AF053565|pid:g2995953) Mesembryanthemum crystallinum   glutaredoxin I mRNA, complete cds; thioltransferase. "	DPlate 085	G04			C24863	AU101847			22	M07
7214	g_7214	ST0870		DPlate 087	G04			AU181036				22	N07
7215	g_7215	SS6052		DPlate 085	H04			C24877	AU174108			22	O07
7216	g_7216	ST0878	">ATAC006931_19(AC006931|pid:g4512674) Arabidopsis thaliana   chromosome II BAC F7D19 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 087	H04			AU174170	AU174171			22	P07
7217	g_7217	SS6325	>S76982(S76982) hypothetical protein - Synechocystis sp. (strain PCC   6803) &SYCSLRG_16(D64005|pid:g1001794) 	DPlate 085	A10			D49209	AU162147			22	A19
7218	g_7218	ST1046	">OSU88068_1(U88068|pid:g2286121) Oryza sativa sec14 like protein   mRNA, complete cds. "	DPlate 087	A10			D39575	AU033014			22	B19
7219	g_7219	SS6310	>HVH224324_1(AJ224324|pid:g3550483) Hordeum vulgare cv. Haisa mRNA   for cp31BHv protein. 	DPlate 085	B10			AU175151				22	C19
7220	g_7220	ST1054	">ATU18409_1(U18409|pid:g972917) Arabidopsis thaliana IAA7 (IAA7)   gene, complete cds; member of a multigene family of   primary auxin-responsive genes; homologous gene products   from pea are short-lived nuclear proteins.   &S58494(S58494) "	DPlate 087	B10			D39580				22	D19
7221	g_7221	SS6303	">ATAC004667_7(AC004667|pid:g3668080) Arabidopsis thaliana chromosome   II BAC T4C15 genomic sequence, complete sequence;   unknown protein. "	DPlate 085	C10			AU174121	AU174122			22	E19
7222	g_7222	ST1070	">XLU37373_1(U37373|pid:g1234787) Xenopus laevis tail-specific   thyroid hormone up-regulated (gene 5) mRNA, complete   cds; up-regulated by thyroid hormone in tadpoles;   expressed specifically in the tail and only at   metamorphosis; membrane bound or extracellular protein;   C-terminal basic region. "	DPlate 087	C10			AU174190	AU174191			22	F19
7223	g_7223	SS6327		DPlate 085	D10			AU174126	AU174127			22	G19
7224	g_7224	ST1078		DPlate 087	D10			AU174192				22	H19
7225	g_7225	SS6383		DPlate 085	E10			C24962	AU101866			22	I19
7226	g_7226	ST1094	">ATAF002109_22(AF002109|pid:g2088658) Arabidopsis thaliana   chromosome II BAC T28M21 genomic sequence, complete   sequence; unknown protein. "	DPlate 087	E10			AU174196	AU174197			22	J19
7227	g_7227	SS6391		DPlate 085	F10			D49246	AU096856			22	K19
7228	g_7228	ST1007	">AF004947_1(AF004947|pid:g2246625) Oryza sativa protein kinase mRNA,   complete cds. "	DPlate 087	F10			AU174184	AU174185			22	L19
7229	g_7229	SS6306		DPlate 085	G10			D49197	AU174123			22	M19
7230	g_7230	ST1047		DPlate 087	G10			AU181038				22	N19
7231	g_7231	SS6314	">ZMU32579_1(U32579|pid:g987267) Zea mays DWARF3 (dwarf3) mRNA,   complete cds; involved in an early step in gibberellin   biosythesis. "	DPlate 085	H10			AU174124				22	O19
7232	g_7232	ST1095		DPlate 087	H10			AU181039				22	P19
7233	g_7233	ST2196	>(P54774) CELL DIVISION CYCLE PROTEIN 48 HOMOLOG (VALOSIN CONTAINING   PROTEIN HOMOLOG) (VCP). &GMU20213_1(U20213|pid:g862480) 	DPlate 089	A04			D40314	AU097105			23	A07
7234	g_7234	ST4327		DPlate 091	A04			AU174318				23	B07
7235	g_7235	ST2573	">(P29344) 30S RIBOSOMAL PROTEIN S1, CHLOROPLAST PRECURSOR (CS1).   &A44121(A44121;S26494) &CLSORPS1G_1(X66135|pid:g18060)   &SPIRPS1X_1(M82923|pid:g170143) "	DPlate 089	B04			AU174262	AU174263			23	C07
7236	g_7236	ST4375		DPlate 091	B04			D41703	AU174333			23	D07
7237	g_7237	ST2510	>PTPXP4PER_1(X97351|pid:g1279654) P.trichocarpa mRNA for anionic   peroxidase Pxp1. 	DPlate 089	C04			D40488	C20510			23	E07
7238	g_7238	ST4383	">AB014542_1(AB014542|pid:g3327098) Homo sapiens mRNA for KIAA0642   protein, partial cds. "	DPlate 091	C04			D41709	AU163234			23	F07
7239	g_7239	ST2526	">ATF23E12_12(AL022604|pid:g3080418) Arabidopsis thaliana DNA   chromosome 4, BAC clone F23E12 (ESSAII project);   similarity to predicted protein, Arabidopsis thaliana. "	DPlate 089	D04			D40501	AU174258			23	G07
7240	g_7240	ST4320		DPlate 091	D04			D41667	AU033165			23	H07
7241	g_7241	ST2550	">ATAC005967_9(AC005967|pid:g4115379) Arabidopsis thaliana chromosome   II BAC F27D4 genomic sequence, complete sequence; "	DPlate 089	E04			D40517	AU174260			23	I07
7242	g_7242	ST4328	">AC004493_2(AC004493|pid:g2996650) Homo sapiens chromosome 16, cosmid   clone 373C8 (LANL), complete sequence. "	DPlate 091	E04			D41672	AU174319			23	J07
7243	g_7243	ST2558	">AF005370_67(AF005370|pid:g2338034) Alcelaphine herpesvirus 1 L-DNA,   complete sequence; ORF73; similar to H. saimiri and KSHV   ORF73. "	DPlate 089	F04			AU181044				23	K07
7244	g_7244	ST4336	>PSGTP6_1(Z49900|pid:g871510) P.sativum mRNA for small GTP-binding   protein (clone pGTP6). &S57471(S57471) 	DPlate 091	F04			D41679	AU174320			23	L07
7245	g_7245	ST2543		DPlate 089	G04			D40514				23	M07
7246	g_7246	ST4344	">ATAC006931_20(AC006931|pid:g4512675) Arabidopsis thaliana   chromosome II BAC F7D19 genomic sequence, complete   sequence; "	DPlate 091	G04			AU058121				23	N07
7247	g_7247	ST2583	">PTU09556_1(U09556|pid:g607774) Pinus taeda clone p14A9   arabinogalactan-like protein mRNA, complete cds.   &S52995(S52995) "	DPlate 089	H04			AU174266	AU174267			23	O07
7248	g_7248	ST4360	">ATAC005700_10(AC005700|pid:g3831458) Arabidopsis thaliana   chromosome II BAC T32F6 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 091	H04			AU163233	AU174326			23	P07
7249	g_7249	ST2913	">AB006809_1(AB006809|pid:g2943792) Cucurbita sp. mRNA for PV72,   complete cds. "	DPlate 089	A10			D40769	AU174272			23	A19
7250	g_7250	ST4896	">ATAC005824_31(AC005824|pid:g3860274) Arabidopsis thaliana   chromosome II BAC F15K20 genomic sequence, complete   sequence; unknown protein.   &ATAC006232_24(AC006232|pid:g4314397) "	DPlate 091	A10			AU161692	AU161693			23	B19
7251	g_7251	ST2922		DPlate 089	B10			AU108341				23	C19
7252	g_7252	ST5157		DPlate 091	B10			C25072				23	D19
7253	g_7253	ST2938		DPlate 089	C10			D40788	AU108342			23	E19
7254	g_7254	ST5173		DPlate 091	C10			AU097478				23	F19
7255	g_7255	ST2947	">AF012896_1(AF012896|pid:g2293566) Oryza sativa ADP-ribosylation   factor 1 (Os-ARF1) mRNA, complete cds. "	DPlate 089	D10			D40795	AU081605			23	G19
7256	g_7256	ST5110	">AB004932_1(AB004932|pid:g2224731) Vigna radiata mRNA for Aux22d,   complete cds. "	DPlate 091	D10			AU066128	AU097662			23	H19
7257	g_7257	ST2955	">ATAC003673_6(AC003673|pid:g3004549) Arabidopsis thaliana chromosome   II BAC F19F24 genomic sequence, complete sequence;   unknown protein. &ATAC005724_24(AC005724|pid:g4185152) "	DPlate 089	E10			D40801	AU174275			23	I19
7258	g_7258	ST5142		DPlate 091	E10			AU033202				23	J19
7259	g_7259	ST2971	">ATU38916_1(U38916|pid:g1145627) Arabidopsis thaliana lipase mRNA,   complete cds. &S68410(S68410) "	DPlate 089	F10			D40815	AU033098			23	K19
7260	g_7260	ST5158		DPlate 091	F10			AU161719	AU161720			23	L19
7261	g_7261	ST3009	">D79992_1(D79992|pid:g1136400) Human mRNA for KIAA0170 gene,   complete cds; similar to Drosophila photoreceptor   cell-specific protein, calphotin.. "	DPlate 089	G10			D40840	AU174276			23	M19
7262	g_7262	ST5103		DPlate 091	G10			AU066125	AU097586			23	N19
7263	g_7263	ST3017	">AF022655_1(AF022655|pid:g2832237) Homo sapiens cep250 centrosome   associated protein mRNA, complete cds. "	DPlate 089	H10			D40845	AU174277			23	O19
7264	g_7264	ST5127	">GMC450CP5_1(Y10492|pid:g3334665) G.max mRNA for putative cytochrome   P450, clone CP5. "	DPlate 091	H10			AU066130				23	P19
7265	g_7265	ST6055		DPlate 093	A04			C25363	AU174384			24	A07
7266	g_7266	EF0635		DPlate 048	A06			AU164393				24	B07
7267	g_7267	ST6071		DPlate 093	B04			AU058145				24	C07
7268	g_7268	EF0659	">ATAC006955_4(AC006955|pid:g4544409) Arabidopsis thaliana chromosome   II BAC F28I8 genomic sequence, complete sequence; "	DPlate 048	B06			AU172904				24	D07
7269	g_7269	ST6087		DPlate 093	C04			AU058147				24	E07
7270	g_7270	EF0620	">AF023164_1(AF023164|pid:g3360289) Zea mays leucine-rich repeat   transmembrane protein kinase 1 (ltk1) mRNA, partial cds.   "	DPlate 048	C06			C22572	C22573			24	F07
7271	g_7271	ST6040	">OSU28047_1(U28047|pid:g1143864) Oryza sativa beta-glucosidase mRNA,   nuclear gene encoding chloroplast protein, complete cds;   beta-D-glucoside glucohydrolase; dimer of 60 kDa   monomers; localized in the plastid. "	DPlate 093	D04			C25358	AU174381			24	G07
7272	g_7272	EF0644		DPlate 048	D06			AU064839	AU172903			24	H07
7273	g_7273	ST6064		DPlate 093	E04			AU097543				24	I07
7274	g_7274	EF0605		DPlate 048	E06			AU162283				24	J07
7275	g_7275	ST6080	">D88461_1(D88461|pid:g2274845) Rat mRNA for N-WASP, complete cds. "	DPlate 093	F04			AU181059				24	K07
7276	g_7276	EF0613	>LELEUZIP_1(Z12127|pid:g19275) L.esculentum mRNA for protein with   leucine zipper; protein of unknown function.   &S21495(S21495) 	DPlate 048	F06			AU164389				24	L07
7277	g_7277	ST6157	">STU76611_1(U76611|pid:g4098250) Solanum tuberosum ci21B gene,   complete cds; similar to Solanum tuberosum ci21A gene   product encoded by the sequence presented in GenBank   Accession Number U76610. "	DPlate 093	G04			AU161877	AU161878			24	M07
7278	g_7278	EF0629	>HVLTP7A2B_1(X96979|pid:g1261917) H.vulgare mRNA for lipid transfer   protein 7a2b; non-specific. 	DPlate 048	G06			C74616	AU172902			24	N07
7279	g_7279	ST6173	">SCFMEMPRO_1(L13655|pid:g294845) Sugarcane membrane protein mRNA,   complete cds; putative. "	DPlate 093	H04			AU102056	AU102057			24	O07
7280	g_7280	EF0637		DPlate 048	H06			AU064836				24	P07
7281	g_7281	ST6205		DPlate 093	A10			AU066286	AU102061			24	A19
7282	g_7282	no clone										24	B19
7283	g_7283	ST6245		DPlate 093	B10			C25394				24	C19
7284	g_7284	no clone										24	D19
7285	g_7285	ST6293	">PAU82330_1(U82330|pid:g2351578) Prunus armeniaca adenylate kinase   homolog mRNA, complete cds. "	DPlate 093	C10			AU066302	AU161906			24	E19
7286	g_7286	no clone										24	F19
7287	g_7287	ST6246	">ATAC002510_16(AC002510|pid:g2618699) Arabidopsis thaliana   chromosome II BAC T32G6 genomic sequence, complete   sequence; unknown protein. "	DPlate 093	D10			AU033282				24	G19
7288	g_7288	no clone										24	H19
7289	g_7289	ST6254		DPlate 093	E10			AU102062	AU102063			24	I19
7290	g_7290	no clone										24	J19
7291	g_7291	ST6223	">ATAC006955_29(AC006955|pid:g4544434) Arabidopsis thaliana   chromosome II BAC F28I8 genomic sequence, complete   sequence; "	DPlate 093	F10			AU174393	AU174394			24	K19
7292	g_7292	no clone										24	L19
7293	g_7293	ST6248		DPlate 093	G10			C25396	AU174397			24	M19
7294	g_7294	no clone										24	N19
7295	g_7295	ST6256	">ATFCA7_32(Z97342|pid:g2245061) Arabidopsis thaliana DNA chromosome   4, ESSA I contig fragment No. 7; similarity to   ATP-dependent Clp proteinase (EC 3.4.21.-) chain P   precursor - Escherichia coli. &G71438(G71438) "	DPlate 093	H10			C25399	AU174399			24	O19
7296	g_7296	no clone										24	P19
7297	g_7297	EG0520		DPlate 050	A04			AU030027	AU030028			13	A08
7298	g_7298	EG1222		DPlate 052	A04			AU030543				13	B08
7299	g_7299	EG0528	>HVSTRPR_1(X80265|pid:g520943) H.vulgare mRNA for putative   structural protein; putative. &S47036(S47036) 	DPlate 050	B04			AU077697	AU077698			13	C08
7300	g_7300	EG1230	>(P70315) WISKOTT-ALDRICH SYNDROME PROTEIN HOMOLOG (WASP).   &MMU29673_1(U29673|pid:g4096355)   &MMU54788_1(U54788|pid:g1314755) 	DPlate 052	B04			AU065739	AU030550			13	D08
7301	g_7301	EG0536	">RPXX03_156(AJ235272|pid:g3861189) Rickettsia prowazekii strain   Madrid E, complete genome; segment 3/4; "	DPlate 050	C04			AU058339	AU166192			13	E08
7302	g_7302	EG1254	>HVY14200_1(Y14200|pid:g2266662) Hordeum vulgare mRNA for 14-3-3   protein (Hv1433c). 	DPlate 052	C04			AU030568	AU030569			13	F08
7303	g_7303	EG0560	">(P11893) 50S RIBOSOMAL PROTEIN L24, CHLOROPLAST PRECURSOR (CL24).   &PSRPCL24_1(X14020|pid:g20873) &R5PM24(S04685) "	DPlate 050	D04			AU030053	AU101476			13	G08
7304	g_7304	EG1231		DPlate 052	D04			AU030551	AU101483			13	H08
7305	g_7305	EG0576	">AF027819_1(AF027819|pid:g2625015) Schizosaccharomyces pombe RNA   polymerases I, II and III subunit Rpc10 (rpc10+) gene,   complete cds; Zn-binding protein; smallest common   subunit. &D89634_1(D89634|pid:g2529253) "	DPlate 050	E04			AU030062				13	I08
7306	g_7306	EG1255		DPlate 052	E04			AU065742	AU030570			13	J08
7307	g_7307	EG0505	>S72349(S72349) nonstructural polyprotein - eastern equine   encephalomyelitis virus &U01034_1(U01034|pid:g393007) 	DPlate 050	F04			AU030018	AU030019			13	K08
7308	g_7308	EG1279	">ATF18F4_11(AL021637|pid:g2827655) Arabidopsis thaliana DNA   chromosome 4, BAC clone F18F4 (ESSAII project); "	DPlate 052	F04			AU030592	AU030593			13	L08
7309	g_7309	EG0545	">ATU63815_6(U63815|pid:g1532168) Arabidopsis thaliana AT.I.24-1,   AT.I.24-2, AT.I.24-3, AT.I.24-4, AT.I.24-5, AT.I.24-6,   AT.I.24-9 and AT.I.24-14 genes, partial cds, AT.I.24-7,   ascorbate peroxidase (ATHAPX1), EF-1alpha-A1, -A2 and   -A3 (EF-1alpha) and AT.I.24-13 genes, complete cds;   localized according to blastn similarity to EST   sequences; therefore, the coding span corresponds only   to an area of similarity since the initation codon and   stop codon could not be precisely determined. "	DPlate 050	G04			AU058342	AU172960			13	M08
7310	g_7310	EH0017	">T12M4_19(AC003114|pid:g3249109) Arabidopsis thaliana chromosome 1   BAC T12M4 sequence, complete sequence; Contains   similarity to pre-mRNA splicing factor (SF2), P33   subunit gb|M72709 from Homo sapiens. ESTs gb|T42588 and   gb|R65514 come from this gene.. "	DPlate 052	G04			AU165851	AU030617			13	N08
7311	g_7311	EG0553	>(P40937) ACTIVATOR 1 36 KD SUBUNIT (REPLICATION FACTOR C 36 KD   SUBUNIT) (A1 36 KD SUBUNIT) (RF-C 36 KD SUBUNIT)   (RFC36). &HUMPOLACCA_1(L07540|pid:g1498257) 	DPlate 050	H04			AU030045	AU030046			13	O08
7312	g_7312	EH0025	">ATAC003974_19(AC003974|pid:g2914706) Arabidopsis thaliana   chromosome II BAC F24L7 genomic sequence, complete   sequence; "	DPlate 052	H04			AU030622	AU030623			13	P08
7313	g_7313	EG0696		DPlate 050	A10			AU058367				13	A20
7314	g_7314	EH0155	">ATAC005310_8(AC005310|pid:g3510254) Arabidopsis thaliana chromosome   II BAC F19D11 genomic sequence, complete sequence; "	DPlate 052	A10			AU030725				13	B20
7315	g_7315	EG0701		DPlate 050	B10			AU065629	AU030158			13	C20
7316	g_7316	EH0163		DPlate 052	B10			AU089714	AU030733			13	D20
7317	g_7317	EG0725		DPlate 050	C10			AU058370	AU095027			13	E20
7318	g_7318	EH0171	">PTU27116_1(U27116|pid:g857578) Populus tremuloides caffeoyl-CoA   3-O-methyltransferase mRNA, complete cds;   S-adenyosyl-methionine caffeoyl-CoA   3-O-methyltransferase; similar to Swiss-Prot Accession   Number P28034; similar to proteins encoded by GenBank   accession Numbers U20736, U13151, and L22203; Mr = 27.9   kDa and pI = 5.16.. "	DPlate 052	C10			AU030739	AU030740			13	F20
7319	g_7319	EG0733	>CELW03D2_10(AF000298|pid:g1947160) Caenorhabditis elegans cosmid   W03D2; weak similarity to collagens; glycine- and   proline-rich. 	DPlate 050	D10			AU030187	AU030188			13	G20
7320	g_7320	EH0179		DPlate 052	D10			AU078707	AU030746			13	H20
7321	g_7321	EG0741	">F12F1_9(AC002131|pid:g3157926) Arabidopsis thaliana chromosome 1   BAC F12F1 sequence, complete sequence; Strong similarity   to extensin-like protein gb|Z34465 from Zea mays.. "	DPlate 050	E10			AU058375	AU095028			13	I20
7322	g_7322	EH0140	">ATAC004238_8(AC004238|pid:g3033381) Arabidopsis thaliana chromosome   II BAC F19I3 genomic sequence, complete sequence; "	DPlate 052	E10			AU162313	AU030715			13	J20
7323	g_7323	EG0749	">AF004849_1(AF004849|pid:g2627331) Homo sapiens PKY protein kinase   mRNA, complete cds. "	DPlate 050	F10			AU058377	AU095030			13	K20
7324	g_7324	EH0148	">ATFCA1_9(Z97336|pid:g2244797) Arabidopsis thaliana DNA chromosome   4, ESSA I contig fragment No. 1; similarity to phaseolin   G-box binding protein PG2 - Phaseolus vulgaris.   &B71406(B71406) "	DPlate 052	F10			AU162316	AU030721			13	L20
7325	g_7325	EG0781	">(P22778) ATP SYNTHASE DELTA CHAIN, MITOCHONDRIAL PRECURSOR (EC   3.6.1.34) (OLIGOMYCIN SENSITIVITY CONFERRAL PROTEIN)   (OSCP). &A35227(A35227;B33306)   &IPBFATPD_1(J05397|pid:g168270) "	DPlate 050	G10			AU065647	AU030223			13	M20
7326	g_7326	EH0164	">CER03A10_3(Z69793|pid:g3878874) Caenorhabditis elegans cosmid   R03A10, complete sequence; "	DPlate 052	G10			AU030734	AU030735			13	N20
7327	g_7327	EG0789		DPlate 050	H10			AU058386	AU095035			13	O20
7328	g_7328	EH0172	>HSWT41(A24967) histone H4 (TH091) - wheat   &WHTH4091_1(M12277|pid:g170747) 	DPlate 052	H10			AU108192	AU065164			13	P20
7329	g_7329	EH0833	">ATAC007047_10(AC007047|pid:g4544390) Arabidopsis thaliana chromosome   II BAC F16F14 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 054	A04			AU065228	AU101505			14	A08
7330	g_7330	EH1583	">ATF28A23_14(AL021961|pid:g2911052) Arabidopsis thaliana DNA   chromosome 4, BAC clone F28A23 (ESSAII project);   similarity to TEB4 protein, Homo sapiens,   PATCHX:G2331104; Contains CAP protein signatures,   [VLARLDIQAARLE]. "	DPlate 056	A04			AU031447	AU031448			14	B08
7331	g_7331	EH0849		DPlate 054	B04			C74914				14	C08
7332	g_7332	EH1512	>NTPMG14_1(Z14015|pid:g19927) N.tabacum mRNA for pistil extensin   like protein (partial). &PQ0479(PQ0479;S24620) 	DPlate 056	B04			AU095352	AU031408			14	D08
7333	g_7333	EH0857		DPlate 054	C04			AU065234	AU095237			14	E08
7334	g_7334	EH1552		DPlate 056	C04			AU095366	AU031426			14	F08
7335	g_7335	EH0865	">ATAC002340_3(AC002340|pid:g2880040) Arabidopsis thaliana chromosome   II BAC T11J7 genomic sequence, complete sequence;   &ATU93215_1(U93215|pid:g1946355) "	DPlate 054	D04			AU101514	AU101515			14	G08
7336	g_7336	EH1505	">ATAC004681_16(AC004681|pid:g3298548) Arabidopsis thaliana   chromosome II BAC T26B15 genomic sequence, complete   sequence; "	DPlate 056	D04			AU173051	AU173052			14	H08
7337	g_7337	EH0873	">ATAC004218_21(AC004218|pid:g3355484) Arabidopsis thaliana   chromosome II BAC F12L6 genomic sequence, complete   sequence; "	DPlate 054	E04			AU173029	AU173030			14	I08
7338	g_7338	EH1521		DPlate 056	E04			AU095356	AU095357			14	J08
7339	g_7339	EH0881	>OSHMGGN_1(Z68504|pid:g1154889) O.sativa   3-hydroxy-3-methylglutaryl-CoA reductase gene.   &OSU43961_1(U43961|pid:g1171364) 	DPlate 054	F04			AU101521	AU101522			14	K08
7340	g_7340	EH1529	>(P41836) 26S PROTEASE REGULATORY SUBUNIT 8 HOMOLOG (LET1 PROTEIN).    &S45176(S45176) &SPBC23G7_12(AL035065|pid:g4106689)   &SPU02280_1(U02280|pid:g406051) 	DPlate 056	F04			AU162357	AU031417			14	L08
7341	g_7341	EH0802	">D87686_1(D87686|pid:g3540219) Homo sapiens mRNA for KIAA0017 protein,   complete cds; similar to human xeroderma pigmentosum   groupE UV-damaged DNA binding f actor(U32986). "	DPlate 054	G04			AU162328	AU031098			14	M08
7342	g_7342	EH1506		DPlate 056	G04			AU162355	AU031404			14	N08
7343	g_7343	EH0810	">ATF17L22_25(AL035527|pid:g4455287) Arabidopsis thaliana DNA   chromosome 4, BAC clone F17L22 (ESSAII project);   contains EST gb:T43509, T43917, T88633. "	DPlate 054	H04			AU101500	AU101501			14	O08
7344	g_7344	EH1570	>HSNUMAMR_1(Z11583|pid:g35119) H.sapiens mRNA for NuMA protein.   &S23647(S23647) 	DPlate 056	H04			AU078245	AU031435			14	P08
7345	g_7345	EH0969	">AC004044_9(AC004044|pid:g4263510) Arabidopsis thaliana BAC T5J8   from chromosome IV, top arm, complete sequence; similar   to A. thaliana hypothetical protein T6B20.12 (1946366);   functional catalog ID=99. "	DPlate 054	A10			AU164719	AU031137			14	A20
7346	g_7346	EH1744	">ATU20347_1(U20347|pid:g790583) Arabidopsis thaliana putative   pathogenesis-related protein (ATOZI1) mRNA, complete   cds; mRNA corresponding to this gene accumulates in   response to ozone stress and pathogen (bacterial)   infection; putative pathogenesis-related protein.   &S59544(S59544) &TM018A10_12(AF013294|pid:g2252869) "	DPlate 056	A10			AU031498	AU082419			14	B20
7347	g_7347	EH0954	">AF061807_1(AF061807|pid:g3126967) Elaeagnus umbellata polyubiquitin   mRNA, complete cds. "	DPlate 054	B10			C74930				14	C20
7348	g_7348	EH1760		DPlate 056	B10			AU031508				14	D20
7349	g_7349	EH0978	">ATAC006418_1(AC006418|pid:g4415929) Arabidopsis thaliana chromosome   II BAC F13A10 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 054	C10			C74939	AU173036			14	E20
7350	g_7350	EH1768		DPlate 056	C10			AU031514				14	F20
7351	g_7351	EH0994	">ATAC003028_17(AC003028|pid:g3335372) Arabidopsis thaliana   chromosome II BAC F16M14 genomic sequence, complete   sequence; "	DPlate 054	D10			AU031149	AU075813			14	G20
7352	g_7352	EH1745		DPlate 056	D10			AU162368				14	H20
7353	g_7353	EH0939	">PDBF(1YVE)I MOL_ID: 1; MOLECULE: ACETOHYDROXY ACID   ISOMEROREDUCTASE; CHAIN: I, J, K, L; SYNONYM: KETOACID   REDUCTOISOMERASE; EC: 1.1.1.86; ENGINEERED: YES   &PDBF(1YVE)J &PDBF(1YVE)K &PDBF(1YVE)L "	DPlate 054	E10			C74929				14	I20
7354	g_7354	EH1761	>(P46297) 40S RIBOSOMAL PROTEIN S23 (S12).   &FXU19940_1(U19940|pid:g643074) &S56673(S56673) 	DPlate 056	E10			AU091462	AU031509			14	J20
7355	g_7355	EH0955	>(P36183) ENDOPLASMIN HOMOLOG PRECURSOR (GRP94 HOMOLOG).   &HVGRP94HO_1(X67960|pid:g22652) &S33533(S33533;S31862) 	DPlate 054	F10			C74931				14	K20
7356	g_7356	EH1706	>AF058919_16(AF058919|pid:g3047116) Arabidopsis thaliana BAC F6N23; 	DPlate 056	F10			AU162365				14	L20
7357	g_7357	EH0963	">MCU73466_1(U73466|pid:g1657948) Mesembryanthemum crystallinum water   channel protein MipC mRNA, complete cds. "	DPlate 054	G10			AU065268	AU095262			14	M20
7358	g_7358	EH1730		DPlate 056	G10			AU162029				14	N20
7359	g_7359	EH0995		DPlate 054	H10			C74940				14	O20
7360	g_7360	EH1747		DPlate 056	H10			AU162369	AU031501			14	P20
7361	g_7361	FE0179	">ATAC006569_3(AC006569|pid:g4512693) Arabidopsis thaliana chromosome   II BAC F11A3 genomic sequence, complete sequence;   &ATSCLBS_1(AJ001808|pid:g3660469) "	DPlate 058	A04			AU174658	AU174657			15	A08
7362	g_7362	FL0135	>PCLAP_1(X99825|pid:g1483563) P.crispum mRNA for leucine   aminopeptidase; leucine aminopeptidase. 	DPlate 060	A04			AU174990				15	B08
7363	g_7363	FE0195	">ATAC005168_6(AC005168|pid:g3426051) Arabidopsis thaliana chromosome   II BAC F12C20 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 058	B04			AU174675	AU174674			15	C08
7364	g_7364	FL0167	>STA225107_1(AJ225107|pid:g3093410) Solanum tuberosum (cultivar   Bintje) chloroplastic protoporphyrinogen IX oxidase. 	DPlate 060	B04			AU175016	AU175015			15	D08
7365	g_7365	FE0108		DPlate 058	C04			AU174608	AU174609			15	E08
7366	g_7366	FL0175		DPlate 060	C04			AU175028	AU175027			15	F08
7367	g_7367	FE0124	>HSSF3A60_1(X81789|pid:g551450) H.sapiens mRNA for splicing factor   SF3a60. &S53583(S53583;S49319) 	DPlate 058	D04			AU174618	AU174617			15	G08
7368	g_7368	FL0191	">AF094773_1(AF094773|pid:g3789948) Oryza sativa translation   initiation factor 5A (eIF-5A) mRNA, complete cds. "	DPlate 060	D04			AU175042				15	H08
7369	g_7369	FE0156	">ATAC002339_7(AC002339|pid:g2335096) Arabidopsis thaliana chromosome   II BAC T11A7 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 058	E04			AU174638				15	I08
7370	g_7370	FL0120	>ATH7450_1(AJ007450|pid:g3286691) Arabidopsis thaliana mRNA for   auxilin-like protein. 	DPlate 060	E04			AU174979	AU174978			15	J08
7371	g_7371	FE0164	>LEEXTEN5_1(X55685|pid:g1345537) Tomato extensin mRNA (clone uG-18);   Protein sequence is in conflict with the conceptual   translation; ORF. &S14974(S14974) 	DPlate 058	F04			AU174642				15	K08
7372	g_7372	FL0136		DPlate 060	F04			AU174991				15	L08
7373	g_7373	FE0188	">AF080245_1(AF080245|pid:g3415009) Elaeis oleifera sesquiterpene   synthase mRNA, partial cds. "	DPlate 058	G04			AU174668	AU174667			15	M08
7374	g_7374	FL0144		DPlate 060	G04			AU174998	AU174997			15	N08
7375	g_7375	FE0196	">AF049888_1(AF049888|pid:g2952326) Oryza sativa   1-aminocyclopropane-1-carboxylate oxidase (ACO1) mRNA,   partial cds; ACC oxidase. "	DPlate 058	H04			AU174677	AU174676			15	O08
7376	g_7376	FL0152	">ATAC006068_13(AC006068|pid:g4263787) Arabidopsis thaliana   chromosome II BAC T20F21 genomic sequence, complete   sequence; unknown protein. "	DPlate 060	H04			AU175005				15	P08
7377	g_7377	FE0365	">AC000348_7(AC000348|pid:g2213587) Genomic sequence for Arabidopsis   thaliana BAC T7N9, complete sequence; similar to leucine   zipper protein; similar to ESTs gb|T21286 and gb|T04740.   "	DPlate 058	A10			AU174789	AU174788			15	A20
7378	g_7378	RA0079	>(P46274) OUTER MITOCHONDRIAL MEMBRANE PROTEIN PORIN   (VOLTAGE-DEPENDENT ANION-SELECTIVE CHANNEL PROTEIN)   (VDAC). &TAVDAC1_1(X77733|pid:g456672) 	DPlate 060	A10			D23758	AU031636			15	B20
7379	g_7379	FE0310		DPlate 058	B10			AU174751	AU174752			15	C20
7380	g_7380	RA0087	">OSU76004_1(U76004|pid:g1800227) Oryza sativa Bowman-Birk proteinase   inhibitor mRNA, complete cds. "	DPlate 060	B10			D23762	AU031638			15	D20
7381	g_7381	FE0326		DPlate 058	C10			AU174761				15	E20
7382	g_7382	RA0032	>S55877(S55877;S55876;S47976)ribosomal protein S10 - potato   mitochondrion 	DPlate 060	C10			C23559	AU031628			15	F20
7383	g_7383	FE0334	">AC002294_12(AC002294|pid:g2443886) Arabidopsis thaliana chromosome   I BAC F11P17 genomic sequence, complete sequence;   Unknown protein; location of EST emb|Z25559. "	DPlate 058	D10			AU174765	AU174764			15	G20
7384	g_7384	RA0048		DPlate 060	D10			D23743	AU081353			15	H20
7385	g_7385	FE0358		DPlate 058	E10			AU174782				15	I20
7386	g_7386	RA0072	>BSUB0008_28(Z99111|pid:g2633727) Bacillus subtilis complete genome   (section 8 of 21): from 1394791 to 1603020;   &D69863(D69863) 	DPlate 060	E10			D23753	AU173059			15	J20
7387	g_7387	FE0366	">ATU39782_1(U39782|pid:g2576361) Arabidopsis thaliana lysine and   histidine specific transporter mRNA, complete cds. "	DPlate 058	F10			AU174790	AU174791			15	K20
7388	g_7388	RA0080	">OSU72255_1(U72255|pid:g4097948) Oryza sativa beta-1,3-glucanase   precursor (Gns9) gene, complete cds. "	DPlate 060	F10			D23759	AU031637			15	L20
7389	g_7389	FE0374		DPlate 058	G10			AU174793				15	M20
7390	g_7390	RA0101	">D83726_1(D83726|pid:g3894214) Oryza sativa gene for elongation   factor 1 beta 2, complete cds.   &D83727_1(D83727|pid:g3894216) "	DPlate 060	G10			D23766	AU078250			15	N20
7391	g_7391	FE0390		DPlate 058	H10			AU174803				15	O20
7392	g_7392	RA0117		DPlate 060	H10			D23771	AU031644			15	P20
7393	g_7393	RA0655		DPlate 062	A04			D23957	AU031703			16	A08
7394	g_7394	RA1628		DPlate 064	A04			D39064	AU173179			16	B08
7395	g_7395	RA0663	>(P37216) PHOSPHO-2-DEHYDRO-3-DEOXYHEPTONATE ALDOLASE 2 PRECURSOR   (EC 4.1.2.15) (PHOSPHO-2-KETO-3-DEOXYHEPTONATE ALDOLASE   2) (DAHP SYNTHETASE 2) (3-DEOXY-D-ARABINO-HEPTULOSONATE   7-PHOSPHATE SYNTHASE 2).   &LEDAHPSNB_1(Z21793|pid:g410488) &S40412(S40412;S38473) 	DPlate 062	B04			D23962	AU162386			16	C08
7396	g_7396	RA1644		DPlate 064	B04			AU173185	AU173186			16	D08
7397	g_7397	RA0687		DPlate 062	C04			D23969	AU031707			16	E08
7398	g_7398	RA1652	">HSA012409_1(AJ012409|pid:g3881976) Homo sapiens mRNA for   hypothetical protein, clone YR-29; ORF1. "	DPlate 064	C04			AU173195	AU173196			16	F08
7399	g_7399	RA0608		DPlate 062	D04			AU078034	AU078035			16	G08
7400	g_7400	RA1668	">SPBC16E9_11(Z99759|pid:g2467274) S.pombe chromosome II cosmid   c16E9; SPBC16E9.12c, putative rna binding protein,   len:166aa, similar eg. to D. melanogaster Q27926, rna   binding protein, (224aa), fasta scores, opt:423, E():0,   (46.7% identity in 184 aa overlap). "	DPlate 064	D04			AU173203				16	H08
7401	g_7401	RA0616		DPlate 062	E04			AU101623	AU101624			16	I08
7402	g_7402	RA1692	">AC003027_3(AC003027|pid:g4204286) Arabidopsis thaliana chromosome I   BAC F21M11 genomic sequence, complete sequence; Unknown   protein; Location of ESTs 40C3TT, gb|AA728590 and40C3T7,   gb|T04573. "	DPlate 064	E04			AU173207	AU173208			16	J08
7403	g_7403	RA0664	">AB020666_1(AB020666|pid:g4240207) Homo sapiens mRNA for KIAA0859   protein, complete cds. "	DPlate 062	F04			AU101629	AU101630			16	K08
7404	g_7404	RA1613	">ATU93215_19(U93215|pid:g1946372) Arabidopsis thaliana chromosome II   BAC T06B20 genomic sequence, complete sequence; yeast   hypothetical protein YDB1_SCHPO isolog. "	DPlate 064	F04			D24269	AU031773			16	L08
7405	g_7405	RA0672		DPlate 062	G04			AU173787				16	M08
7406	g_7406	RA1621		DPlate 064	G04			D24275	AU173178			16	N08
7407	g_7407	RA0688	">ATF9D16_10(AL035394|pid:g4454032) Arabidopsis thaliana DNA   chromosome 4, BAC clone F9D16 (ESSAII project);   similarity to chS-Rex-b - Gallus gallus (chicken),   gb:L10333; contains EST gb:W43040, N65866, Aa597867,   H76040, Aa712824, T76206, Z30846. "	DPlate 062	H04			D23970	AU031708			16	O08
7408	g_7408	RA1637		DPlate 064	H04			D24286	AU173182			16	P08
7409	g_7409	RA0902	">ATFCA3_6(Z97338|pid:g2244876) Arabidopsis thaliana DNA chromosome 4,   ESSA I contig fragment No. 3; hypothetical protein.   &G71415(G71415) "	DPlate 062	A10			D24030	AU031726			16	A20
7410	g_7410	RA1793	">ATAC003974_19(AC003974|pid:g2914706) Arabidopsis thaliana   chromosome II BAC F24L7 genomic sequence, complete   sequence; "	DPlate 064	A10			AU164666	AU173231			16	B20
7411	g_7411	RA0910		DPlate 062	B10			AU101640	AU101641			16	C20
7412	g_7412	RA1738		DPlate 064	B10			D24327	AU031788			16	D20
7413	g_7413	RA0934		DPlate 062	C10			AU176506				16	E20
7414	g_7414	RA1754	">HVU89510_1(U89510|pid:g2586127) Hordeum vulgare b-keto acyl   reductase (glossy8) mRNA, complete cds. "	DPlate 064	C10			D24338	AU173217			16	F20
7415	g_7415	RA0919		DPlate 062	D10			D24034	AU101642			16	G20
7416	g_7416	RA1762		DPlate 064	D10			D39076				16	H20
7417	g_7417	RA0959	">ATF10N7_6(AL021636|pid:g2827624) Arabidopsis thaliana DNA   chromosome 4, BAC clone (ESSA project); "	DPlate 062	E10			D28295	AU101643			16	I20
7418	g_7418	RA1770	">AF035936_1(AF035936|pid:g3452263) Arabidopsis thaliana   phosphatidylinositol 4-kinase mRNA, partial cds; PI4K. "	DPlate 064	E10			D24350	AU031792			16	J20
7419	g_7419	RA0928	>(Q41344) PROFILIN 1. &SLU50195_1(U50195|pid:g1399496) 	DPlate 062	F10			AU070176	AU090570			16	K20
7420	g_7420	RA1778	">AF019743_1(AF019743|pid:g2425101) Oryza sativa cationic peroxidase   (OsCPX1) mRNA, complete cds; fungal elicitor inducible   gene. "	DPlate 064	F10			D24354	C20491			16	L20
7421	g_7421	RA0944		DPlate 062	G10			D24037				16	M20
7422	g_7422	RA1786		DPlate 064	G10			D24361	AU173229			16	N20
7423	g_7423	RA0952		DPlate 062	H10			AU173120				16	O20
7424	g_7424	RA1739	">OSU72250_1(U72250|pid:g4097938) Oryza sativa beta-1,3-glucanase   precursor (Gns4) gene, complete cds. "	DPlate 064	H10			D24328				16	P20
7425	g_7425	RA2187		DPlate 066	A04			AU173327				17	A08
7426	g_7426	RA3076	>(P37834) PEROXIDASE PRECURSOR (EC 1.11.1.7).   &RICPEROX_1(D14997|pid:g287401) 	DPlate 068	A04			D39234				17	B08
7427	g_7427	RA2140	">SOPRXR4_1(Y10465|pid:g1781328) S.oleracea mRNA for peroxidase,   clone PC44. "	DPlate 066	B04			D24542	C20494			17	C08
7428	g_7428	RA3084	">ATFCA6_9(Z97341|pid:g2245000) Arabidopsis thaliana DNA chromosome   4, ESSA I contig fragment No. 6; hypothetical protein.   &B71431(B71431) "	DPlate 068	B04			D39239	AU173436			17	D08
7429	g_7429	RA2156	">ATH6309_3(AJ006309|pid:g3413425) Arabidopsis thaliana gene encoding   protein tyrosine phosphatase, ORF1 and ORF2 genes. "	DPlate 066	C04			D24553	AU173320			17	E08
7430	g_7430	RA3021	">ATF23E12_9(AL022604|pid:g3080415) Arabidopsis thaliana DNA   chromosome 4, BAC clone F23E12 (ESSAII project); strong   similarity to cysteine proteinase, Zinnia elegans,   PIR2:S71773; Contains Eukaryotic thiol (cysteine)   proteases active sites [QGQCGSCWAFST][LDHGVAAVGYG];   contains EST gb:AA395691. "	DPlate 068	C04			D39203	AU031981			17	F08
7431	g_7431	RA2164	">XLU69669_1(U69669|pid:g1850344) Xenopus laevis nuclear pore   complex-associated protein TPR (tpr) mRNA, partial cds;   nuclear pore complex-associated protein; translocated   promotor region. "	DPlate 066	D04			AU031849	AU031850			17	G08
7432	g_7432	RA3053	">AF055850_1(AF055850|pid:g3695023) Arabidopsis thaliana AIR12 mRNA,   partial cds. "	DPlate 068	D04			D39217	AU173429			17	H08
7433	g_7433	RA2172	">ATU88711_1(U88711|pid:g3168840) Arabidopsis thaliana copper   homeostasis factor (CCH) mRNA, complete cds; similar to   yeast ATX1; copper chaperone. "	DPlate 066	E04			D39125	AU173323			17	I08
7434	g_7434	RA3069	>S20014(S20014;S21975;S36371)ubiquinol--cytochrome-c reductase (EC   1.10.2.2) cytochrome c1 precursor (clone pC(1)3II) -   potato 	DPlate 068	E04			D25064	AU031991			17	J08
7435	g_7435	RA2209	">AF074940_1(AF074940|pid:g3309269) Glycine max ferric leghemoglobin   reductase-2 precursor mRNA, complete cds; FLbR   homolog;FLbR-2; similar to the product encoded by   GenBank Accession Number S70187. "	DPlate 066	F04			D24582	AU173331			17	K08
7436	g_7436	RA3077		DPlate 068	F04			AU070191				17	L08
7437	g_7437	RA2225	>LG106_1(X14075|pid:g1929057) Lemna gibba negatively light-regulated   mRNA (Lg106); longest ORF (1). &S12411(S12411) 	DPlate 066	G04			D24594	AU173336			17	M08
7438	g_7438	RA3014	">ATAP22_39(Z99708|pid:g4006914) Arabidopsis thaliana DNA chromosome   4, ESSA I AP2 contig fragment No. 2; similarity to   serine C-palmitoyltransferase, Saccharomycescerevisiae,   PIR2:A43667; contains EST gb:R90586, AA712421. "	DPlate 068	G04			D39197	AU165960			17	N08
7439	g_7439	RA2241	">AF099082_1(AF099082|pid:g4176766) Homo sapiens xenotropic and   polytropic murine retrovirus receptor (XPR1) mRNA,   complete cds; related to yeast G-protein-coupled protein   SYG1. "	DPlate 066	H04			D24605	AU101660			17	O08
7440	g_7440	RA3030		DPlate 068	H04			D39207	AU173423			17	P08
7441	g_7441	RA2304	">AF134552_1(AF134552|pid:g4530611) Oryza sativa subsp. indica   serine/threonine protein phosphatase PP2A-2 catalytic   subunit (Pp2A) gene, complete cds. "	DPlate 066	A10			D24644	AU173343			17	A20
7442	g_7442	RA3196		DPlate 068	A10			AU173460	AU173461			17	B20
7443	g_7443	RA2320	">B56555(B56555)peroxidase (EC 1.11.1.7), anionic, precursor - wood   tobacco "	DPlate 066	B10			AU173346				17	C20
7444	g_7444	RA3225	>I47141(I47141;S55315) gastric mucin (clone PGM-2A) - pig (fragment)   &SSGMUC2_1(U10281|pid:g915208) 	DPlate 068	B10			D39273	AU173466			17	D20
7445	g_7445	RA2344	>(P24198) HYPOTHETICAL 26.5 KD PROTEIN IN TOLC-RIBB INTERGENIC   REGION (ORFB) (O265).   &AE000386_1(AE000386|pid:g1789419)   &ECOLUXH_4(M77129|pid:g146680) &S22363(S22363;F65091) 	DPlate 066	C10			D24668	AU031876			17	E20
7446	g_7446	RA3233		DPlate 068	C10			AU175072	AU176524			17	F20
7447	g_7447	RA2392	>(O04905) URIDYLATE KINASE (EC 2.7.4.-) (UK) (URIDINE MONOPHOSPHATE   KINASE) (UMP KINASE).   &ATAF000147_1(AF000147|pid:g2121275) 	DPlate 066	D10			D24696	AU173353			17	G20
7448	g_7448	RA3265		DPlate 068	D10			D25129	AU101670			17	H20
7449	g_7449	RA2313	">F12F1_14(AC002131|pid:g3157945) Arabidopsis thaliana chromosome 1   BAC F12F1 sequence, complete sequence; Contains   similarity to axi 1 gene gb|X80301 from Nicotiana   tabacum.. "	DPlate 066	E10			AU173345				17	I20
7450	g_7450	RA3281		DPlate 068	E10			AU173475	AU173476			17	J20
7451	g_7451	RA2306	>GGA6529_1(AJ006529|pid:g3218467) Gallus gallus mRNA for putative   phosphatase. 	DPlate 066	F10			D24646	AU173344			17	K20
7452	g_7452	RA3289	>CHKCM11_1(K00510|pid:g211542) Chicken cCM1 gene coding for a   calmodulin-like protein; calmodulin-like protein.   &MCCHM(A03026) 	DPlate 068	F10			D39297	AU032040			17	L20
7453	g_7453	RA2370	">ATAC002343_8(AC002343|pid:g2262105) Arabidopsis thaliana BAC T19F06   genomic sequence, complete sequence; unknown protein. "	DPlate 066	G10			D24682	AU031880			17	M20
7454	g_7454	RA3202	">ATAC006232_16(AC006232|pid:g4314390) Arabidopsis thaliana   chromosome II BAC F10A12 genomic sequence, complete   sequence; "	DPlate 068	G10			D25111	AU032017			17	N20
7455	g_7455	RA2394	">ATU31836_1(U31836|pid:g1399277) Arabidopsis thaliana   calmodulin-domain protein kinase CDPK isoform 7 (CPK7)   mRNA, complete cds; calcium-dependent protein kinase. "	DPlate 066	H10			D24697	C22592			17	O20
7456	g_7456	RA3242	">ATAC006223_28(AC006223|pid:g4263722) Arabidopsis thaliana chromosome   II BAC F22D22 genomic sequence, complete sequence; "	DPlate 068	H10			D39285	AU173469			17	P20
7457	g_7457	RA3640	">CEF57A8_2(Z70781|pid:g3877725) Caenorhabditis elegans cosmid F57A8,   complete sequence. "	DPlate 070	A04			AU032156	AU032157			18	A08
7458	g_7458	RB0436	">ATAC003028_4(AC003028|pid:g3335359) Arabidopsis thaliana chromosome   II BAC F16M14 genomic sequence, complete sequence;   unknown protein. "	DPlate 072	A04			AU070900	AU081365			18	B08
7459	g_7459	RA3680	>(P46077) 14-3-3-LIKE PROTEIN GF14 PHI.   &AF001414_1(AF001414|pid:g2232146)   &ATHGFPHI_1(L09111|pid:g1493805) 	DPlate 070	B04			AU162512	AU032196			18	C08
7460	g_7460	RB0444	">F20D22_6(AC002411|pid:g3142294) Arabidopsis thaliana chromosome 1   BAC F20D22 sequence, complete sequence; Strong   similarity to initiation factor eIF-2, gb|U37354 from S.   pombe. ESTs gb|T41979, gb|N37284 and gb|N37529 come   from this gene.. "	DPlate 072	B04			AU070907	AU101698			18	D08
7461	g_7461	RA3725	>(P52711) SERINE CARBOXYPEPTIDASE II-3 PRECURSOR (EC 3.4.16.6)   (CP-MII.3). &HVACXPII3_1(X78877|pid:g474392)   &S44191(S44191) 	DPlate 070	C04			AU032221	AU173535			18	E08
7462	g_7462	RB0429	">AB018318_1(AB018318|pid:g3882271) Homo sapiens mRNA for KIAA0775   protein, complete cds. "	DPlate 072	C04			AU095580	AU070894			18	F08
7463	g_7463	RA3733		DPlate 070	D04			AU065426	AU173790			18	G08
7464	g_7464	RB0414		DPlate 072	D04			AU070882				18	H08
7465	g_7465	RA3781	">AF051231_1(AF051231|pid:g2982293) Picea mariana ISP42-like protein   (Sb41) mRNA, partial cds; similar to Saccharomyces   cerevisiae mitochondrial import-site-protein ISP42   (TOM40) encoded by GenBank Accession Number X56885. "	DPlate 070	E04			AU173801	AU173802			18	I08
7466	g_7466	RB0430	>TAE7349_1(AJ007349|pid:g3702665) Triticum aestivum mRNA for PR-1.2   protein. 	DPlate 072	E04			AU070895	AU101697			18	J08
7467	g_7467	RA3702		DPlate 070	F04			AU162516				18	K08
7468	g_7468	RB0438		DPlate 072	F04			AU070902				18	L08
7469	g_7469	RA3758	">D90915_98(D90915|pid:g1653702) Synechocystis sp. PCC6803 complete   genome, 17/27, 2137259-2267259; ORF_ID:sll1841.   &S76485(S76485) "	DPlate 070	G04			AU032228				18	M08
7470	g_7470	RB0415		DPlate 072	G04			AU070883				18	N08
7471	g_7471	RA3727		DPlate 070	H04			AU173788	AU173789			18	O08
7472	g_7472	RB0440		DPlate 072	H04			AU070904				18	P08
7473	g_7473	RA3894	">CEF22B5_8(Z50044|pid:g3876233) Caenorhabditis elegans cosmid F22B5,   complete sequence; similar to phenylalanyl-tRNA   synthetase; cDNA EST EMBL:T01401 comes from this gene;   cDNA EST yk303c5.3 comes from this gene; cDNA EST   yk303c5.5 comes from this gene; cDNA EST yk452d5.3 comes   from this gene; cDNA EST yk452d5.5 comes from this gene.   "	DPlate 070	A10			AU032328	AU173815			18	A20
7474	g_7474	RB0644	">ATAC004481_20(AC004481|pid:g3337367) Arabidopsis thaliana   chromosome II BAC F13P17 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 072	A10			AU071042				18	B20
7475	g_7475	RA3815	>A48514_1(A48514|pid:g2302292) Sequence 2 from Patent WO9603505;   unnamed protein product.   &TATHIORDH_1(X69915|pid:g2995378) 	DPlate 070	B10			AU162529	AU032253			18	C20
7476	g_7476	RB0660		DPlate 072	B10			AU071055	AU101705			18	D20
7477	g_7477	RA3839	">ATAC007019_10(AC007019|pid:g4417274) Arabidopsis thaliana   chromosome II BAC F7D8 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 070	C10			AU032279	AU175074			18	E20
7478	g_7478	RB0668		DPlate 072	C10			AU071062				18	F20
7479	g_7479	RA3855		DPlate 070	D10			AU162539	AU032297			18	G20
7480	g_7480	RB0676	>F70865(F70865) probable esterase - Mycobacterium tuberculosis   (strain H37RV) &MTV008_18(AL021246|pid:g2791503) 	DPlate 072	D10			AU071069				18	H20
7481	g_7481	RA3863	>(P46290) 60S RIBOSOMAL PROTEIN L31.   &NGU23784_1(U23784|pid:g915313) 	DPlate 070	E10			AU162542	AU032304			18	I20
7482	g_7482	RB0653	">ATF10M10_18(AL035521|pid:g4455186) Arabidopsis thaliana DNA   chromosome 4, BAC clone F10M10 (ESSAII project);   similarity to ethylene-responsive element binding   protein homolog, Stylosanthes hamata, U91857; Contains   Binding-protein-dependent transport systems inner   membrane component signature, Bpd_Transp_Innembr   [LQHVISGENETAPCQGFSSDSTVISAGMP]. "	DPlate 072	E10			AU071050				18	J20
7483	g_7483	RA3879	">D63484_1(D63484|pid:g1469882) Human mRNA for KIAA0150 gene, partial   cds; The KIAA0150 gene product is novel.. "	DPlate 070	F10			AU162544	AU032319			18	K20
7484	g_7484	RB0677	">ATF26P21_16(AL031804|pid:g3688185) Arabidopsis thaliana DNA   chromosome 4, BAC clone F26P21 (ESSAII project);   similarity to AT.I.24, Arabidopsis thaliana, gb:U63815. "	DPlate 072	F10			AU078367	AU102212			18	L20
7485	g_7485	RA3895	">AF024625_1(AF024625|pid:g2558938) Brassica napus arm repeat   containing protein (ARC1) mRNA, complete cds; novel   protein; contains arm repeats in the C-terminal region. "	DPlate 070	G10			AU032329	AU173816			18	M20
7486	g_7486	RB0622	">RICGTPBP_1(L35845|pid:g642121) Oryza sativa small GTP-binding   protein (ORRab-2) mRNA, complete cds; 282..293   GTP-binding domain; 456..467 GTP-binding domain;   138..160 GTP-binding domain. "	DPlate 072	G10			AU071024				18	N20
7487	g_7487	RA3808	">ATT9A21_10(AL021713|pid:g2832700) Arabidopsis thaliana DNA   chromosome 4, BAC clone T9A21 (ESSAII project);   similarity to multidrug resistance protein, Homo   sapiens, PIR2:S71841; contains EST gb:N37245. "	DPlate 070	H10			AU173806	AU173807			18	O20
7488	g_7488	RB0630	">ATF1N20_17(AL022140|pid:g2961352) Arabidopsis thaliana DNA   chromosome 4, BAC clone F1N20 (ESSAII project);   similarity to DNA-binding protein ABF2, wild oat,   PIR2:S61414. "	DPlate 072	H10			AU071032	AU091465			18	P20
7489	g_7489	SA0102		DPlate 074	A04			AU075841	AU075842			19	A08
7490	g_7490	SA1077		DPlate 078	A04			AU173940	AU057028			19	B08
7491	g_7491	SA0110	>YUP8H12_19(AC000098|pid:g2388577) Arabidopsis thaliana chromosome 1   YAC yUP8H12 complete sequence; Similar to Arabidopsis   putative ion-channel PID:g2262157 (gb|AC002329).. 	DPlate 074	B04			AU055867				19	C08
7492	g_7492	SA1085	">PAU93273_1(U93273|pid:g2688824) Prunus armeniaca putative   auxin-repressed protein mRNA, complete cds. "	DPlate 078	B04			AU057038	AU057039			19	D08
7493	g_7493	SA0126	">AF016713_1(AF016713|pid:g4102839) Lycopersicon esculentum   oligopeptide transporter (LeOPT1) mRNA, complete cds;   oligopeptide transporter. "	DPlate 074	C04			AU055884	AU055885			19	E08
7494	g_7494	SA1093	>SDTUBERPR_1(X98304|pid:g1370589) S.demissum mRNA for protein   induced upon tuberization; putative transit peptide. 	DPlate 078	C04			AU057050				19	F08
7495	g_7495	SA0142		DPlate 074	D04			AU091713	AU055909			19	G08
7496	g_7496	SA1006		DPlate 078	D04			AU056944				19	H08
7497	g_7497	SA0150	>(P07850) SULFITE OXIDASE (EC 1.8.3.1).   &A34180(A34180;S10446;S07219) 	DPlate 074	E04			AU055918	AU055919			19	I08
7498	g_7498	SA1070	">AF009413_1(AF009413|pid:g2267597) Oryza sativa 10 kDa chaperonin   mRNA, complete cds. "	DPlate 078	E04			AU057019	AU057020			19	J08
7499	g_7499	SA0158	">ATT13J8_11(AL035524|pid:g4455359) Arabidopsis thaliana DNA   chromosome 4, BAC clone T13J8 (ESSAII project);   similarity to MSP1, Saccharomyces cerevisiae,   PIR2:A49506; Contains AAA-protein family signatur. "	DPlate 074	F04			AU055928	AU055929			19	K08
7500	g_7500	SA1023	>ATCHIV_1(Y14590|pid:g2597826) Arabidopsis thaliana CHIV gene. 	DPlate 078	F04			AU056965				19	L08
7501	g_7501	SA0174	">AF062894_1(AF062894|pid:g3941480) Arabidopsis thaliana putative   transcription factor (MYB59) mRNA, complete cds; MYB59;   R2R3-MYB factor family member. "	DPlate 074	G04			AU055948	AU055949			19	M08
7502	g_7502	SA1071	>(P80595) APYRASE PRECURSOR (EC 3.6.1.5) (ATP-DIPHOSPHATASE)   (ADENOSINE DIPHOSPHATASE) (ADPASE)   (ATP-DIPHOSPHOHYDROLASE). &JC4616(JC4616;PC4147)   &STU58597_1(U58597|pid:g1381633) 	DPlate 078	G04			AU057021	AU057022			19	N08
7503	g_7503	SA0119	>S76354(S76354) ABC1-type transport protein sll0005 - Synechocystis   sp. (strain PCC 6803) &SYCSLRB_97(D64000|pid:g1001579) 	DPlate 074	H04			AU055876	AU055877			19	O08
7504	g_7504	SA1079	">LMFL779_2(AL034368|pid:g4493761) Leishmania major Friedlin cosmid   L779, complete sequence; predicted using hexExon; L779.2,   Hypothetical protein, len: 4125 aa. "	DPlate 078	H04			AU057030	AU057031			19	P08
7505	g_7505	SA0180	>CELC31H2_2(U41748|pid:g1118141) Caenorhabditis elegans cosmid   C31H2; coded for by C. elegans cDNA yk16f8.5; coded for   by C. elegans cDNA yk55f7.5; coded for by C. elegans   cDNA yk16f8.3; coded for by C. elegans cDNA yk55f7.3;   coded for by C. elegans cDNA yk72a5.5; coded for by C.   elegans cDNA yk72a5.3; Similar to collagen alpha   (weak).. 	DPlate 074	A10			AU055960	AU055961			19	A20
7506	g_7506	SA1273		DPlate 078	A10			AU057246	AU057247			19	B20
7507	g_7507	SA0217		DPlate 074	B10			AU056004	AU056005			19	C20
7508	g_7508	SA1281	">ATAC006300_15(AC006300|pid:g4432861) Arabidopsis thaliana   chromosome II BAC F13B15 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 078	B10			AU057258	AU057259			19	D20
7509	g_7509	SA0225	">ATU63815_1(U63815|pid:g1532163) Arabidopsis thaliana AT.I.24-1,   AT.I.24-2, AT.I.24-3, AT.I.24-4, AT.I.24-5, AT.I.24-6,   AT.I.24-9 and AT.I.24-14 genes, partial cds, AT.I.24-7,   ascorbate peroxidase (ATHAPX1), EF-1alpha-A1, -A2 and   -A3 (EF-1alpha) and AT.I.24-13 genes, complete cds;   similar to glutaredoxin encoded by GenBank Accession   Number Z49699; localized according to blastn similarity   to EST sequences; therefore, the coding span corresponds   only to an area of similarity since the initation codon   and stop codon could not be precisely determined. "	DPlate 074	C10			AU162644	AU056017			19	E20
7510	g_7510	SA1210		DPlate 078	C10			AU057158	AU057159			19	F20
7511	g_7511	SA0233		DPlate 074	D10			AU056026	AU056027			19	G20
7512	g_7512	SA1250	">ATFCA4_9(Z97339|pid:g2244910) Arabidopsis thaliana DNA chromosome   4, ESSA I contig fragment No. 4; unnamed protein   product. &B71420(B71420) "	DPlate 078	D10			AU057215	AU057216			19	H20
7513	g_7513	SA0241	">(P43188) ADENYLATE KINASE, CHLOROPLAST (EC 2.7.4.3) (ATP-AMP   TRANSPHOSPHORYLASE). &PDBF(1ZAK)A &PDBF(1ZAK)B   &S45634(S45634;S43039) "	DPlate 074	E10			AU056039	AU056040			19	I20
7514	g_7514	SA1258		DPlate 078	E10			AU078375				19	J20
7515	g_7515	SA0249	">D90899_73(D90899|pid:g1651723) Synechocystis sp. PCC6803 complete   genome, 1/27, 1-133859; ORF_ID:slr1124. &S74499(S74499)   "	DPlate 074	F10			AU056050	AU056051			19	K20
7516	g_7516	SA1266	">SC1C3_2(AL023702|pid:g3169028) Streptomyces coelicolor cosmid 1C3;   SC1C3.02, possible cationic amino acid transporter, len:   503 aa; similar to many bacterial membrane proteins e.g.   M. tuberculosis TR:O05896 EMBL; Z95121 MTCY20B11.28c   (495 aa), fasta scores; opt: 1649 z-score: 2116.1 E():   0, 52.6% identity in 485 aa overlap, and to many   eukaryotic transporters e.g. CTR1_HUMAN high-affinity   cationic amino acid transporter (629 aa), fasta scores;   opt: 897 z-score: 1337.3E(): 0, 35.0% identity in 432   aa overlap. Contains 2x Pfam match to entry aa_permeases   PF00324, Amino acid permeases, scores 50.38 and 51.60. "	DPlate 078	F10			AU057237	AU057238			19	L20
7517	g_7517	SA0265		DPlate 074	G10			AU056070	AU056071			19	M20
7518	g_7518	SA1219	">ATT13J8_17(AL035524|pid:g4455365) Arabidopsis thaliana DNA   chromosome 4, BAC clone T13J8 (ESSAII project);   similarity to cytochrome-c oxidase oxidase chain VIb,   Homo sapiens, PIR1:OGHU6B. "	DPlate 078	G10			AU057173	AU057174			19	N20
7519	g_7519	SA0273	">AF052203_1(AF052203|pid:g4079798) Oryza sativa 23 kDa polypeptide   of photosystem II mRNA, complete cds. "	DPlate 074	H10			AU173872				19	O20
7520	g_7520	SA1227	">AF051236_1(AF051236|pid:g2982303) Picea mariana hypothetical   protein (Sb50) mRNA, partial cds; similar to   Caenorhabditis elegans C01F1.3 gene product encoded by   GenBank Accession Number U58761. "	DPlate 078	H10			AU057186				19	P20
7521	g_7521	SA0825		DPlate 077	A04			AU173919	AU173920			20	A08
7522	g_7522	SA1782	">AC002291_14(AC002291|pid:g2829913) Arabidopsis thaliana chromosome   I BAC F22K20 genomic sequence, complete sequence; highly   similar to gp|X67953|47149 and others. "	DPlate 080	A04			AU057783	AU162782			20	B08
7523	g_7523	SA0833		DPlate 077	B04			AU173923	AU173924			20	C08
7524	g_7524	SA1790	">F12F1_27(AC002131|pid:g3157951) Arabidopsis thaliana chromosome 1   BAC F12F1 sequence, complete sequence; Contains   similarity to vesicle trafficking protein gb|U91538 from   Mus musculus. ESTs gb|F15494 and gb|F14097 come from   this gene.. "	DPlate 080	B04			AU057789	AU057790			20	D08
7525	g_7525	SA0841	">ATAC002510_14(AC002510|pid:g2618698) Arabidopsis thaliana chromosome   II BAC T32G6 genomic sequence, complete sequence; unknown   protein. "	DPlate 077	C04			AU056742	AU056743			20	E08
7526	g_7526	SA1703		DPlate 080	C04			AU057702				20	F08
7527	g_7527	SA0857		DPlate 077	D04			AU162717	AU056766			20	G08
7528	g_7528	SA1727		DPlate 080	D04			AU162775	AU057725			20	H08
7529	g_7529	SA0873		DPlate 077	E04			AU093404	AU056784			20	I08
7530	g_7530	SA1759	">ATAC006135_17(AC006135|pid:g4218010) Arabidopsis thaliana   chromosome II BAC F24H14 genomic sequence, complete   sequence; &ATAC006439_1(AC006439|pid:g4309720) "	DPlate 080	E04			AU057756	AU057757			20	J08
7531	g_7531	SA0889	">ATAC006587_4(AC006587|pid:g4510396) Arabidopsis thaliana chromosome   II BAC T17D12 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 077	F04			AU056810	AU056811			20	K08
7532	g_7532	SA1767	>(Q99471) C-MYC BINDING PROTEIN MM-1.   &D89667_1(D89667|pid:g1731809) 	DPlate 080	F04			AU162780	AU057768			20	L08
7533	g_7533	SA0866		DPlate 077	G04			AU173925	AU173926			20	M08
7534	g_7534	SA1712	">AB024058_1(AB024058|pid:g4514655) Hordeum vulgare Ids3 mRNA,   complete cds; IDS3. "	DPlate 080	G04			AU057711				20	N08
7535	g_7535	SA0874	>(P54641) VACUOLAR ATP SYNTHASE SUBUNIT AC39 (EC 3.6.1.34) (V-ATPASE   AC39 SUBUNIT) (41 KD ACCESSORY PROTEIN) (DVA41).   &A55016(A55016) &DDU13150_1(U13150|pid:g532733) 	DPlate 077	H04			AU056785	AU056786			20	O08
7536	g_7536	SA1744	">AB008103_1(AB008103|pid:g3434967) Arabidopsis thaliana AtERF-1 mRNA   for ethylene responsive element binding factor 1,   complete cds; transcription factor. "	DPlate 080	H04			AU057740	AU083516			20	P08
7537	g_7537	SA0982	">RICBZIPPA_1(D78609|pid:g1783305) Oryza sativa mRNA for bZIP   protein, complete cds. "	DPlate 077	A10			AU173935				20	A20
7538	g_7538	SA1838	>(P36039) HYPOTHETICAL 29.4 KD PROTEIN IN STE6-LOS1 INTERGENIC   REGION. &S38045(S38045)   &SCYKL207W_1(Z28207|pid:g486369) 	DPlate 080	A10			AU057844				20	B20
7539	g_7539	SA0990	">ATAC004481_9(AC004481|pid:g3337356) Arabidopsis thaliana chromosome   II BAC F13P17 genomic sequence, complete sequence; "	DPlate 077	B10			AU056930	AU056931			20	C20
7540	g_7540	SA1862	>S52737(S52737) NADH dehydrogenase (ubiquinone) (EC 1.6.5.3) 76K chain   precursor - potato &ST76CISUB_1(X85808|pid:g758340) 	DPlate 080	B10			AU057871	AU057872			20	D20
7541	g_7541	SA0911	>A39659_1(A39659|pid:g2295932) Sequence 1 from Patent EP0612848;   unnamed protein product.   &NTHSR203_1(X77136|pid:g444002) &S42807(S42807) 	DPlate 077	C10			AU091470	AU056827			20	E20
7542	g_7542	SA1870	">CELF25B5_5(U23172|pid:g726394) Caenorhabditis elegans cosmid F25B5;   similar to myoblast cell surface antigen (SP:CS24_HUMAN,   P23246) and D. melanogaster No-on-transient A protein   (PIR:JH0162). "	DPlate 080	C10			AU176534				20	F20
7543	g_7543	SA0927	">AF020553_1(AF020553|pid:g2444420) Glycine max ribosome-associated   protein p40 mRNA, complete cds; similar to laminin   receptor protein. "	DPlate 077	D10			AU056850	AU056851			20	G20
7544	g_7544	SA1886		DPlate 080	D10			AU057897				20	H20
7545	g_7545	SA0959	">ATAC006300_17(AC006300|pid:g4432863) Arabidopsis thaliana   chromosome II BAC F13B15 genomic sequence, complete   sequence; "	DPlate 077	E10			AU056889	AU056890			20	I20
7546	g_7546	SA1823	">TOBTID3_1(D26453|pid:g688423) Nicotiana glauca X Nicotiana   langsdorffii mRNA for tumor-related protein, complete   cds, clone:tid3. "	DPlate 080	E10			AU057824	AU057825			20	J20
7547	g_7547	SA0967	">ATAC005917_22(AC005917|pid:g4191791) Arabidopsis thaliana   chromosome II BAC F3P11 genomic sequence, complete   sequence; "	DPlate 077	F10			AU056904	AU056905			20	K20
7548	g_7548	SA1847		DPlate 080	F10			AU057856				20	L20
7549	g_7549	SA0975		DPlate 077	G10			AU070269	AU173934			20	M20
7550	g_7550	SA1855		DPlate 080	G10			AU057865				20	N20
7551	g_7551	SA0983	>A55817(A55817) cyclin-dependent kinase p130-PITSLRE - mouse   &MUSCDPK_1(L37092|pid:g561746) 	DPlate 077	H10			AU056921	AU056922			20	O20
7552	g_7552	SA1863	">ATAC006200_14(AC006200|pid:g4262234) Arabidopsis thaliana   chromosome II BAC F10A8 genomic sequence, complete   sequence; unknown protein. "	DPlate 080	H10			AU057873				20	P20
7553	g_7553	SS3122	">ATF28A23_2(AL021961|pid:g2911040) Arabidopsis thaliana DNA chromosome   4, BAC clone F28A23 (ESSAII project); similarity to   protein kinase TMKL1, Arabidopsis thaliana,   PATCHX:E353150; contains EST gb:N38144, AA395810, N38554,   N38553, N38550, N38543, T45570, AA394573. "	DPlate 082	A04			D47552	AU032661			21	A08
7554	g_7554	SS5131		DPlate 084	A04			D48741	AU174076			21	B08
7555	g_7555	SS3138	">AF094775_1(AF094775|pid:g3789952) Oryza sativa chlorophyll   a/b-binding protein presursor (Cab27) mRNA, nuclear gene   encoding chloroplast protein, complete cds; 27 KDa. "	DPlate 082	B04			D47560	AU096265			21	C08
7556	g_7556	SS5139	">ATAC006921_7(AC006921|pid:g4510345) Arabidopsis thaliana chromosome   II BAC F2H17 genomic sequence, complete sequence;   unknown protein. "	DPlate 084	B04			D48748				21	D08
7557	g_7557	SS3154		DPlate 082	C04			D47572	AU082433			21	E08
7558	g_7558	SS5171		DPlate 084	C04			D48776				21	F08
7559	g_7559	SS3107	>CELW09G10_4(AF016671|pid:g2315665) Caenorhabditis elegans cosmid   W09G10; Similar to collagen. 	DPlate 082	D04			D47538	AU162910			21	G08
7560	g_7560	SS5179		DPlate 084	D04			AU032840	AU032841			21	H08
7561	g_7561	SS3115	">AC000103_9(AC000103|pid:g2213615) Genomic sequence for Arabidopsis   thaliana BAC F21J9, complete sequence; cytochrome P-450   isolog; similar to ESTs dbj|D41610, gb|T20562 and   emb|Z26058. "	DPlate 082	E04			D47545	AU032659			21	I08
7562	g_7562	SS5116		DPlate 084	E04			D48727	AU174074			21	J08
7563	g_7563	SS3147	>CMPMEL2_1(Z70521|pid:g1843440) C.melo mRNA (clone pMel2). 	DPlate 082	F04			D47567	AU032664			21	K08
7564	g_7564	SS5132	">AF081825_1(AF081825|pid:g4322346) Rattus norvegicus   sodium-dependent high-affinity dicarboxylate transporter   (NADC3) mRNA, complete cds; solute transporter. "	DPlate 084	F04			D48742	AU174077			21	L08
7565	g_7565	SS3155	">AC004122_12(AC004122|pid:g3540189) Arabidopsis thaliana chromosome   I BAC T27I1 genomic sequence, complete sequence;   Hypothetical protein. "	DPlate 082	G04			D47573	AU101760			21	M08
7566	g_7566	SS5140		DPlate 084	G04			D48749	AU174079			21	N08
7567	g_7567	SS3163		DPlate 082	H04			D47581	AU101761			21	O08
7568	g_7568	SS5148	">ATAC005917_22(AC005917|pid:g4191791) Arabidopsis thaliana   chromosome II BAC F3P11 genomic sequence, complete   sequence; "	DPlate 084	H04			D48756	AU098352			21	P08
7569	g_7569	SS3869		DPlate 082	A10			AU065838	AU082435			21	A20
7570	g_7570	SS5680	>(Q42978) NONSPECIFIC LIPID-TRANSFER PROTEIN 2 PRECURSOR (LTP 2).   &OSU31766_1(U31766|pid:g951334) 	DPlate 084	A10			D49057	AU070444			21	B20
7571	g_7571	SS3885	>IBA6224_1(AJ006224|pid:g4160280) Ipomoea batatas mRNA for purple   acid phosphatase. 	DPlate 082	B10			AU065845	AU032743			21	C20
7572	g_7572	SS5696	>(P48276) HYPOTHETICAL 18.6 KD PROTEIN YCF36.   &CPU30821_72(U30821|pid:g1016155) 	DPlate 084	B10			D49068	AU101830			21	D20
7573	g_7573	SS3814	>LELRPGENE_1(X95269|pid:g1619300) L.esculentum LRP gene. 	DPlate 082	C10			D47980	C22630			21	E20
7574	g_7574	SS5809	">ATAC004238_27(AC004238|pid:g3033400) Arabidopsis thaliana   chromosome II BAC F19I3 genomic sequence, complete   sequence; "	DPlate 084	C10			D49123				21	F20
7575	g_7575	SS3822	>S57813(S57813) hypothetical protein (clone TPP15) - tomato   (fragment) &SLU20595_1(U20595|pid:g924632) 	DPlate 082	D10			AU032719	AU175145			21	G20
7576	g_7576	SS5849	>(P36213) PHOTOSYSTEM I REACTION CENTRE SUBUNIT II PRECURSOR   (PHOTOSYSTEM I 20 KD SUBUNIT) (PSI-D).   &BLYPSAD_1(M98254|pid:g167085) &JQ2247(JQ2247) 	DPlate 084	D10			D49154	AU174090			21	H20
7577	g_7577	SS3830	>ATH6787_1(AJ006787|pid:g3559805) Arabidopsis thaliana mRNA for   putative phytochelatin synthetase. 	DPlate 082	E10			D47992	AU032723			21	I20
7578	g_7578	SS5865		DPlate 084	E10			AU181032				21	J20
7579	g_7579	SS3831	">ATU78866_1(U78866|pid:g1699023) Arabidopsis thaliana putative   arginine-aspartate-rich RNA binding protein (gene1500),   (gene1000), and (gene400) genes, complete cds.   &ATU78867_1(U78867|pid:g1699051) "	DPlate 082	F10			D47993	AU032724			21	K20
7580	g_7580	SS5881	">ZMU43082_1(U43082|pid:g1421730) Zea mays T cytoplasm male sterility   restorer factor 2 (rf2) mRNA, complete cds; restorer   factor 2; Allele: Rf2+B73; putative aldehyde   dehydrogenase; T cytoplasm male sterility. "	DPlate 084	F10			AU101840	AU101841			21	L20
7581	g_7581	SS3855	">STU72489_1(U72489|pid:g1881585) Solanum tuberosum remorin mRNA,   complete cds; plasma-membrane associated phosphoprotein.   "	DPlate 082	G10			AU065830	AU101781			21	M20
7582	g_7582	SS5882	">ATT10I14_5(AL021712|pid:g2832672) Arabidopsis thaliana DNA   chromosome 4, BAC clone T10I14 (ESSAII project); strong   similarity to nifU protein homolog YPL135w,   Saccharomyces cerevisiae, PIR2:S69049. "	DPlate 084	G10			AU070451				21	N20
7583	g_7583	SS3895	">ATAC006283_16(AC006283|pid:g4432844) Arabidopsis thaliana   chromosome II BAC T1B3 genomic sequence, complete   sequence; unknown protein. "	DPlate 082	H10			AU065851	AU032747			21	O20
7584	g_7584	SS5803		DPlate 084	H10			D49117	AU174088			21	P20
7585	g_7585	ST0090	>(P48603) F-ACTIN CAPPING PROTEIN BETA SUBUNIT.   &DMU35240_1(U35240|pid:g1016279) 	DPlate 086	A04			AU161512	AU032974			22	A08
7586	g_7586	ST1284	">WHTWALI_1(L28008|pid:g451193) Triticum aestivum (wali7) mRNA, 3'   end, partial cds. "	DPlate 088	A04			AU070522				22	B08
7587	g_7587	ST0083	">AF035944_1(AF035944|pid:g2665890) Fragaria x ananassa   calcium-dependent protein kinase (MAX17) mRNA, complete   cds. "	DPlate 086	B04			C22659	C22658			22	C08
7588	g_7588	ST1292		DPlate 088	B04			D39718	AU161615			22	D08
7589	g_7589	ST0020	">OSU09450_1(U09450|pid:g780372) Oryza sativa enolase mRNA, complete   cds; 2-phospho-D-glycerate hydrolase. "	DPlate 086	C04			AU075535	AU032950			22	E08
7590	g_7590	ST1213		DPlate 088	C04			D39660				22	F08
7591	g_7591	ST0060		DPlate 086	D04			AU066045	AU101892			22	G08
7592	g_7592	ST1253	">ATF20O9_17(AL021749|pid:g2842491) Arabidopsis thaliana DNA   chromosome 4, BAC clone F20O9 (ESSAII project); contains   EST gb:R29877. "	DPlate 088	D04			D39687	AU161611			22	H08
7593	g_7593	ST0076		DPlate 086	E04			AU032965	AU163162			22	I08
7594	g_7594	ST1214	>(P12695) DIHYDROLIPOAMIDE ACETYLTRANSFERASE COMPONENT (E2) OF   PYRUVATE DEHYDROGENASE COMPLEX PRECURSOR (EC 2.3.1.12)   (PDC-E2). &A30198(A30198;S53909;S63003;S63938)   &SC23CDS_14(X86470|pid:g791115)   &SCYNL071W_1(Z71347|pid:g1301955)   &YSCACE_1(J04096|pid:g170972) 	DPlate 088	E04			D39661	AU097023			22	J08
7595	g_7595	ST0084	>(P51848) PYRUVATE DECARBOXYLASE ISOZYME 2 (EC 4.1.1.1) (PDC).   &OSU27350_1(U27350|pid:g1009710)   &OSU38199_1(U38199|pid:g1777455) 	DPlate 086	F04			D39374	AU174140			22	K08
7596	g_7596	ST1238	">AC002329_17(AC002329|pid:g2262172) DNA sequence of Arabidopsis   thaliana BAC F5J6 from chromosome IV, complete sequence;   "	DPlate 088	F04			AU161609				22	L08
7597	g_7597	ST0092		DPlate 086	G04			AU066050	AU032975			22	M08
7598	g_7598	ST1254	">ATAC004138_11(AC004138|pid:g3461821) Arabidopsis thaliana   chromosome II BAC T17M13 genomic sequence, complete   sequence; "	DPlate 088	G04			D39688	AU174213			22	N08
7599	g_7599	ST0005		DPlate 086	H04			AU066032	AU032946			22	O08
7600	g_7600	ST1278	">T1F15_13(AC004393|pid:g3176669) Arabidopsis thaliana chromosome 1   BAC T1F15 sequence, complete sequence; End is cut off.. "	DPlate 088	H04			AU174217	AU033021			22	P08
7601	g_7601	ST0625	">AGU83687_1(U83687|pid:g1835701) Apium graveolens NADPH-dependent   mannose 6-phosphate reductase (m6pr) mRNA, complete cds;   aldo-keto reductase; similar to aldose 6-phosphate   reductase also known as NADP-sorbitol-6-phosphate   dehydrogenase encoded by GenBank Accession Number   D11080. "	DPlate 086	A10			AU163183	AU163184			22	A20
7602	g_7602	ST1990		DPlate 088	A10			D40195				22	B20
7603	g_7603	ST0641	">AF041255_1(AF041255|pid:g2773404) Sus scrofa pyridoxal kinase mRNA,   complete cds. "	DPlate 086	B10			AU174149	AU174150			22	C20
7604	g_7604	ST1911	>(P25889) HYPOTHETICAL 45.3 KD PROTEIN IN CDD-MGLC INTERGENIC   REGION. &AE000303_13(AE000303|pid:g1788469)   &B64983(B64983) 	DPlate 088	B10			D40139	AU033056			22	D20
7605	g_7605	ST0657	">ATF18A5_12(AL035528|pid:g4455302) Arabidopsis thaliana DNA   chromosome 4, BAC clone F18A5 (ESSAII project);   similarity to GTPase activating protein,   Schizosaccharomyces pombe, AL023634. "	DPlate 086	C10			AU101912	AU101913			22	E20
7606	g_7606	ST1919	>(P52838) FLAVONOL SULFOTRANSFERASE-LIKE (EC 2.8.2.-).   &FBU10277_1(U10277|pid:g498647) 	DPlate 088	C10			D40147	AU174230			22	F20
7607	g_7607	ST0673	">RIC14B_1(L76377|pid:g1196835) Oryza sativa (clone 14b) osmotin   protein (14b) gene, 3' complete cds. "	DPlate 086	D10			AU101914	AU101915			22	G20
7608	g_7608	ST1935		DPlate 088	D10			AU175156				22	H20
7609	g_7609	ST0602	">AC002130_9(AC002130|pid:g2760324) The sequence of BAC F1N21 from   Arabidopsis thaliana chromosome 1, complete sequence;   similar to EST gb|T75851. "	DPlate 086	E10			AU101904	AU101905			22	I20
7610	g_7610	ST1943	>LETWI1_1(X85138|pid:g1359905) L.esculentum twi1 mRNA; homologous to   glucosyltransferases. 	DPlate 088	E10			D40163	AU174232			22	J20
7611	g_7611	ST0634	>(P33126) HEAT SHOCK PROTEIN 82. &OSHSP82A_1(Z11920|pid:g20256)   &S25541(S25541;S25542) 	DPlate 086	F10			AU082446	AU082447			22	K20
7612	g_7612	ST1951		DPlate 088	F10			AU174234	AU174235			22	L20
7613	g_7613	ST0642		DPlate 086	G10			AU070508	AU101909			22	M20
7614	g_7614	ST1959	">AC003970_20(AC003970|pid:g3482929) Arabidopsis thaliana chromosome   I BAC F14J9 genomic sequence contains phyA marker,   complete sequence; Putative transcription factor;   contains Myb DNA-binding domain motif, 68157-68216.   Similar to Arabidopsis thaliana transcription factor   ATMYB4, gi|3047079. "	DPlate 088	G10			D40175	AU174237			22	N20
7615	g_7615	ST0690		DPlate 086	H10			AU101919	AU101920			22	O20
7616	g_7616	ST1904	">ATAC002505_14(AC002505|pid:g2739372) Arabidopsis thaliana   chromosome II BAC T9J22 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 088	H10			D40134	AU174225			22	P20
7617	g_7617	ST3553	">GMU44838_1(U44838|pid:g1165322) Glycine max extensin (SbHRGP3)   gene, complete cds. "	DPlate 090	A04			AU181046				23	A08
7618	g_7618	ST5276		DPlate 092	A04			AU175169				23	B08
7619	g_7619	ST3577	">F19P19_12(AC000104|pid:g2341033) Sequence of BAC F19P19 from   Arabidopsis thaliana chromosome 1, complete sequence;   Similar to Babesia aldo-keto reductase (gb|M93122).. "	DPlate 090	B04			D41224	AU058116			23	C08
7620	g_7620	ST5213		DPlate 092	B04			AU174355	AU102018			23	D08
7621	g_7621	ST3570	">ATT6K21_8(AL021889|pid:g2894599) Arabidopsis thaliana DNA   chromosome 4, BAC clone T6K21 (ESSAII project); contains   EST gb:T43356, AA042469. "	DPlate 090	C04			D41220				23	E08
7622	g_7622	ST5237	">(P35721) SUCCINATE DEHYDROGENASE CYTOCHROME B560 SUBUNIT (SUCCINATE   DEHYDROGENASE, SUBUNIT III).   &MPOMTCG_11(M68929|pid:g786193) &S25968(S25968) "	DPlate 092	C04			C25095	AU174356			23	F08
7623	g_7623	ST3578		DPlate 090	D04			D41225	AU108380			23	G08
7624	g_7624	ST5261	">ATM4I22_13(AL030978|pid:g3269293) Arabidopsis thaliana DNA   chromosome 4, P1 clone M4I22 (ESSAII project); contains   EST gb:N65535, T13933, N38467, T45990, T45289, T75915. "	DPlate 092	D04			C25104	AU174358			23	H08
7625	g_7625	ST3594	>ZMHMGD1_1(Y08807|pid:g2196672) Z.mays mRNA for HMG protein. 	DPlate 090	E04			D41238	AU082759			23	I08
7626	g_7626	ST5238		DPlate 092	E04			AU175168				23	J08
7627	g_7627	ST3556	">ATAC006135_17(AC006135|pid:g4218010) Arabidopsis thaliana   chromosome II BAC F24H14 genomic sequence, complete   sequence; &ATAC006439_1(AC006439|pid:g4309720) "	DPlate 090	F04			AU175163	AU175162			23	K08
7628	g_7628	ST5254	">ATFCA5_1(Z97340|pid:g2244951) Arabidopsis thaliana DNA chromosome   4, ESSA I contig fragment No. 5; strong similarity to   dynein light chain; Protein sequence is in conflict with   the conceptual translation. &B71425(B71425) "	DPlate 092	F04			AU058127				23	L08
7629	g_7629	ST3564	">ATAC004684_7(AC004684|pid:g3236240) Arabidopsis thaliana chromosome   II BAC F13M22 genomic sequence, complete sequence;   unknown protein. "	DPlate 090	G04			D41218	AU101973			23	M08
7630	g_7630	ST5262		DPlate 092	G04			C25105				23	N08
7631	g_7631	ST3588	>A65002(A65002) hypothetical protein b2299 - Escherichia coli   (strain K-12) &AE000319_3(AE000319|pid:g1788637) 	DPlate 090	H04			D41233	AU101974			23	O08
7632	g_7632	ST5294	">ATAC003680_25(AC003680|pid:g2979562) Arabidopsis thaliana   chromosome II BAC F17K2 genomic sequence, complete   sequence; unknown protein.   &ATAC004665_30(AC004665|pid:g3386623) "	DPlate 092	H04			AU161757	AU161758			23	P08
7633	g_7633	ST3887		DPlate 090	A10			D41406				23	A20
7634	g_7634	ST5604		DPlate 092	A10			C25210	AU174361			23	B20
7635	g_7635	ST3864	>ATH010818_1(AJ010818|pid:g4127456) Arabidopsis thaliana mRNA for   chloroplast Cpn21 protein. 	DPlate 090	B10			D41385				23	C20
7636	g_7636	ST5612	>MS11553_1(Y11553|pid:g1871577) M.sativa mRNA for 21kD protein. 	DPlate 092	B10			AU033234				23	D20
7637	g_7637	ST3888	">ATAC006921_7(AC006921|pid:g4510345) Arabidopsis thaliana chromosome   II BAC F2H17 genomic sequence, complete sequence;   unknown protein. "	DPlate 090	C10			D41407	AU108433			23	E20
7638	g_7638	ST5668	">ATFCA8_52(Z97343|pid:g2245125) Arabidopsis thaliana DNA chromosome   4, ESSA I contig fragment No. 8; similarity to   globulin-1O, GLB1O - maize. &F71446(F71446) "	DPlate 092	C10			C25236	AU174367			23	F20
7639	g_7639	ST3957	">AF015913_1(AF015913|pid:g2323410) Homo sapiens SKB1Hs mRNA,   complete cds; homolog of fission yeast Skb1. "	DPlate 090	D10			D41447	AU101987			23	G20
7640	g_7640	ST5676	">AB018587_1(AB018587|pid:g4240033) Zea mays ZmGR1a mRNA, complete   cds. "	DPlate 092	D10			C25239	AU174369			23	H20
7641	g_7641	ST3965	">ATAC006439_19(AC006439|pid:g4309738) Arabidopsis thaliana   chromosome II BAC T30D6 genomic sequence, complete   sequence; "	DPlate 090	E10			D41453				23	I20
7642	g_7642	ST5621		DPlate 092	E10			C25216	AU174362			23	J20
7643	g_7643	ST3989	">AF067401_1(AF067401|pid:g4056615) Oryza sativa Scl1 protein (Scl1)   mRNA, partial cds; Scarecrow-like; similar to Oryza   sativa sequence presented in GenBank Accession Number   D41474. "	DPlate 090	F10			D41474	AU108459			23	K20
7644	g_7644	ST5653	">ATT19P19_12(AL022605|pid:g3080442) Arabidopsis thaliana DNA   chromosome 4, BAC clone T19P19 (ESSAII project);   contains EST gb:Z26779, T75611, Z33718, T46761. "	DPlate 092	F10			AU033236				23	L20
7645	g_7645	ST3910	">ATF13C5_18(AL021711|pid:g2832629) Arabidopsis thaliana DNA   chromosome 4, BAC clone F13C5 (ESSAII project); strong   similarity to 4-coumarate-CoA ligase, Arabidopsis   thaliana, PIR2:S57784. "	DPlate 090	G10			D41418	AU108438			23	M20
7646	g_7646	ST5630		DPlate 092	G10			C25219	AU174364			23	N20
7647	g_7647	ST3942	>(P03631) A AND A* PROTEINS. &PHIX174_9(V01128|pid:g1667374)   &PX1CG_9(J02482|pid:g216020)   &ZABPF4(A04239;B94690;B92262) 	DPlate 090	H10			AU066109	AU108446			23	O20
7648	g_7648	ST5695	">ATAC003672_14(AC003672|pid:g3341685) Arabidopsis thaliana   chromosome II BAC F16B22 genomic sequence, complete   sequence; unknown protein. "	DPlate 092	H10			AU066220	AU174371			23	P20
7649	g_7649	ST6415	">OSEXPANSI_1(Y07782|pid:g2924247) Oryza sativa expansin (Os-EXP-1)   mRNA, complete cds. "	DPlate 094	A04			C25440	AU078740			24	A08
7650	g_7650	EF1114		DPlate 048	A12			AU172923				24	B08
7651	g_7651	ST6439	">S48102(S48102) endo-1,4-beta-D-glucanase, xyloglucan-specific   (clone NXG1) - common nasturtium   &TMNXG1A_1(X68254|pid:g311835) "	DPlate 094	B04			C25447				24	C08
7652	g_7652	EF1162		DPlate 048	B12			AU172934				24	D08
7653	g_7653	ST6416		DPlate 094	C04			AU102065				24	E08
7654	g_7654	EF1178		DPlate 048	C12			AU172937				24	F08
7655	g_7655	ST6448		DPlate 094	D04			C25451	AU078169			24	G08
7656	g_7656	EF1186		DPlate 048	D12			AU172941	AU172940			24	H08
7657	g_7657	ST6501	">ATAC005309_25(AC005309|pid:g3738299) Arabidopsis thaliana   chromosome II BAC F17A22 genomic sequence, complete   sequence; &ATAC006072_3(AC006072|pid:g4249395) "	DPlate 094	E04			AU175173				24	I08
7658	g_7658	EG0017		DPlate 048	E12			AU077688	AU058154			24	J08
7659	g_7659	ST6509	">ATAC004684_4(AC004684|pid:g3236237) Arabidopsis thaliana chromosome   II BAC F13M22 genomic sequence, complete sequence; "	DPlate 094	F04			AU097686				24	K08
7660	g_7660	EG0073		DPlate 048	F12			AU029870	AU101465			24	L08
7661	g_7661	ST6541	">PHVPVPR3A_1(M75856|pid:g169363) P.vulgaris PVPR3 protein mRNA,   complete cds. "	DPlate 094	G04			AU033310	AU174419			24	M08
7662	g_7662	EG0026		DPlate 048	G12			AU029849	AU077694			24	N08
7663	g_7663	ST6565		DPlate 094	H04			C25489	AU174425			24	O08
7664	g_7664	EG0042		DPlate 048	H12			AU029859	AU166153			24	P08
7665	g_7665	D94Water+D		DPlate 094	A10							24	A20
7666	g_7666	no clone										24	B20
7667	g_7667	D94Water+D		DPlate 094	B10							24	C20
7668	g_7668	no clone										24	D20
7669	g_7669	D94Water+D		DPlate 094	C10							24	E20
7670	g_7670	no clone										24	F20
7671	g_7671	D94Water+D		DPlate 094	D10							24	G20
7672	g_7672	no clone										24	H20
7673	g_7673	D94Water+D		DPlate 094	E10							24	I20
7674	g_7674	no clone										24	J20
7675	g_7675	D94Water+D		DPlate 094	F10							24	K20
7676	g_7676	no clone										24	L20
7677	g_7677	D94Water+D		DPlate 094	G10							24	M20
7678	g_7678	no clone										24	N20
7679	g_7679	D94Water+D		DPlate 094	H10							24	O20
7680	g_7680	no clone										24	P20
7681	g_7681	EG0209	>(Q42976) NONSPECIFIC LIPID-TRANSFER PROTEIN 4 PRECURSOR (LTP 4)   (FRAGMENT). &OSU29176_1(U29176|pid:g902058) 	DPlate 049	A05			AU058222				13	A09
7682	g_7682	EG0861		DPlate 051	A05			AU065661	AU030288			13	B09
7683	g_7683	EG0249	">AC003113_18(AC003113|pid:g2781362) Arabidopsis thaliana BAC F24O1   chromosome 1, complete sequence; similar to (Z34465),   extensin-like maize protein. "	DPlate 049	B05			AU058240	AU101470			13	C09
7684	g_7684	EG0869	">ATAC005168_9(AC005168|pid:g3426039) Arabidopsis thaliana chromosome   II BAC F12C20 genomic sequence, complete sequence;   unknown protein. "	DPlate 051	B05			AU065663	AU030295			13	D09
7685	g_7685	EG0273		DPlate 049	C05			AU058254				13	E09
7686	g_7686	EG0885		DPlate 051	C05			AU065666	AU030308			13	F09
7687	g_7687	EG0202		DPlate 049	D05			AU058219	AU091955			13	G09
7688	g_7688	EG0830		DPlate 051	D05			AU030264	AU030265			13	H09
7689	g_7689	EG0218	">AF039573_1(AF039573|pid:g2773154) Oryza sativa abscisic acid- and   stress-inducible protein (Asr1) mRNA, complete cds;   similar to tomato ABA- stress- and ripening-related   protein ASR. "	DPlate 049	E05			AU058229	AU093388			13	I09
7690	g_7690	EG0831	>PDBF(1VDC) MOL_ID: 1; MOLECULE: NADPH DEPENDENT THIOREDOXIN   REDUCTASE; CHAIN: NULL; SYNONYM: NTR; EC: 1.6.4.5;   ENGINEERED: YES 	DPlate 051	E05			AU172967				13	J09
7691	g_7691	EG0234	">ATU90439_16(U90439|pid:g2257716) Arabidopsis thaliana chromosome II   BAC T06D20 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 049	F05			AU091960	AU058234			13	K09
7692	g_7692	EG0871	">ATAC006224_5(AC006224|pid:g4531437) Arabidopsis thaliana chromosome   II P1 MFL8 genomic sequence, complete sequence; "	DPlate 051	F05			AU172969	AU030296			13	L09
7693	g_7693	EG0258		DPlate 049	G05			AU058245				13	M09
7694	g_7694	EG0895		DPlate 051	G05			AU065668	AU030315			13	N09
7695	g_7695	EG0274		DPlate 049	H05			AU058255	AU091968			13	O09
7696	g_7696	EG0808		DPlate 051	H05			AU030240	AU030241			13	P09
7697	g_7697	EG0433	>T27D20_9(AF076274|pid:g3377843) Arabidopsis thaliana BAC T27D20;   contains similarity to rat p47 protein (GB:AB002086). 	DPlate 049	A11			AU172954	AU058314			13	A21
7698	g_7698	EG1005	">AF013487_1(AF013487|pid:g2331301) Zea mays ribosomal protein S4   type I (rps4) mRNA, complete cds. "	DPlate 051	A11			AU162297	AU030395			13	B21
7699	g_7699	EG0441	">ATAC002535_5(AC002535|pid:g2529662) Arabidopsis thaliana chromosome   II BAC T30B22 genomic sequence, complete sequence;   &ATAC005309_3(AC005309|pid:g3738278) "	DPlate 049	B11			AU162290	AU058316			13	C21
7700	g_7700	EG1013		DPlate 051	B11			C74772				13	D21
7701	g_7701	EG0449		DPlate 049	C11			AU058318				13	E21
7702	g_7702	EG1085		DPlate 051	C11			AU030455	AU030456			13	F21
7703	g_7703	EG0457	">AF093540_1(AF093540|pid:g3747050) Zea mays ribosomal protein L26   mRNA, partial cds; similar to Brassica rapa ribosomal   protein in GenBank Accession Number D78495. "	DPlate 049	D11			AU172958	AU030000			13	G21
7704	g_7704	EG1093	>A24450(S12898;A24450)collagen alpha 2(VIII) chain - bovine   (fragment) 	DPlate 051	D11			AU058413				13	H21
7705	g_7705	EG0465	>(P35683) EUKARYOTIC INITIATION FACTOR 4A (EIF-4A).   &RICEIF4A_1(D12627|pid:g303844) &S38358(S38358) 	DPlate 049	E11			AU058322	AU091405			13	I21
7706	g_7706	EG1022		DPlate 051	E11			C74776				13	J21
7707	g_7707	EG0426	>T15F16_14(AF076275|pid:g3377822) Arabidopsis thaliana BAC T15F16;   contains similarity to Caenorhabditis elegans MEL-26   (GB:U67737). 	DPlate 049	F11			AU091398	AU029978			13	K21
7708	g_7708	EG1070	>AE000968_9(AE000968|pid:g2648586) Archaeoglobus fulgidus section   139 of 172 of the complete genome; similar to GB:L77117   SP:Q57665 PID:1498988 percent identity: 60.92;   identified by sequence similarity; putative.   &C69494(C69494) 	DPlate 051	F11			AU162299	AU030444			13	L21
7709	g_7709	EG0442		DPlate 049	G11			AU029992	AU091401			13	M21
7710	g_7710	EG1094		DPlate 051	G11			AU030461				13	N21
7711	g_7711	EG0458	>(P16632) 40S RIBOSOMAL PROTEIN S24 (S19).   &HSU12202_2(U12202|pid:g517222)   &HUMRPS24A_2(M31520|pid:g337506) &JH0213(JH0213;S68918)   &MARPS19_1(X52658|pid:g49652) &R3HY24(S10325)   &R3RT24(S09197;S20565) &RNRPS24_1(X52445|pid:g57858)   &RRRPS24_1(X51538|pid:g57722) 	DPlate 049	H11			AU065598	AU030001			13	O21
7712	g_7712	EG1007		DPlate 051	H11			AU065692	AU030396			13	P21
7713	g_7713	EH0370		DPlate 053	A05			AU093391	AU093392			14	A09
7714	g_7714	EH1183		DPlate 055	A05			AU031235	AU031236			14	B09
7715	g_7715	EH0394		DPlate 053	B05			AU091457	AU030887			14	C09
7716	g_7716	EH1128		DPlate 055	B05			AU095289	AU031195			14	D09
7717	g_7717	EH0315	>(P52875) TRANSMEMBRANE PROTEIN PFT27. &A31351(A31351)   &MUSTMP_1(M23568|pid:g535682) 	DPlate 053	C05			AU030831	AU030832			14	E09
7718	g_7718	EH1130		DPlate 055	C05			AU031198				14	F09
7719	g_7719	EH0323	">AF007219_1(AF007219|pid:g2253411) Tetraodon fluviatilis PP2A   inhibitor (set) gene, complete cds; SET. "	DPlate 053	D05			AU172994	AU091436			14	G09
7720	g_7720	EH1194		DPlate 055	D05			AU101539				14	H09
7721	g_7721	EH0331	">ATAC002336_10(AC002336|pid:g2651302) Arabidopsis thaliana   chromosome II BAC T2P4 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 053	E05			AU165886	AU030841			14	I09
7722	g_7722	EH1131	>(P48608) DIAPHANOUS PROTEIN. &DMU11288_1(U11288|pid:g575927) 	DPlate 055	E05			AU031199				14	J09
7723	g_7723	EH0339	">ATF13D4_3(AL031369|pid:g3482967) Arabidopsis thaliana DNA   chromosome 2, BAC clone F13D4 (ESSAII project);   similarity to protein phosphatase 2C,   Schizosaccharomyces pombe, PIR2:S54297; Contains Protein   phosphatase 2C signature [FFGVYDGHG]; contains EST   gb:T76114, AA041138. "	DPlate 053	F05			AU172997	AU172998			14	K09
7724	g_7724	EH1171		DPlate 055	F05			AU095297	AU031228			14	L09
7725	g_7725	EH0371	>ATINVINHH_1(Y12807|pid:g2765244) Arabidopsis thaliana mRNA for   invertase inhibitor homolog. 	DPlate 053	G05			AU173001	AU173002			14	M09
7726	g_7726	EH1108		DPlate 055	G05			AU095285	AU031177			14	N09
7727	g_7727	EH0324	>AE000817_10(AE000817|pid:g2621381) Methanobacterium   thermoautotrophicum from bases 251486 to 264642 (section   23 of 148) of the complete genome; Function Code:14.00 -   Unknown. &H69141(H69141) 	DPlate 053	H05			AU172995	AU030837			14	O09
7728	g_7728	EH1132		DPlate 055	H05			AU031200				14	P09
7729	g_7729	EH0571		DPlate 053	A11			AU093466	AU031017			14	A21
7730	g_7730	EH1314	">ATAC003000_7(AC003000|pid:g2642158) Arabidopsis thaliana chromosome   II BAC T5I7 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 055	A11			AU031303	AU031304			14	B21
7731	g_7731	EH0579		DPlate 053	B11			AU165918	AU031021			14	C21
7732	g_7732	EH1370		DPlate 055	B11			AU164813	AU031338			14	D21
7733	g_7733	EH0587		DPlate 053	C11			AU095199	AU031026			14	E21
7734	g_7734	EH1339		DPlate 055	C11			AU164801				14	F21
7735	g_7735	EH0524		DPlate 053	D11			AU095184	AU095185			14	G21
7736	g_7736	EH1379		DPlate 055	D11			AU031347	AU031348			14	H21
7737	g_7737	EH0725	>S56684(S56684) histone H2B-6 - wheat   &WHTPH2B6A_1(D37942|pid:g531056) 	DPlate 053	E11			AU075448	AU031069			14	I21
7738	g_7738	EH1316	">AF043533_1(AF043533|pid:g3421109) Arabidopsis thaliana 20S   proteasome beta subunit PBC2 (PBC2) mRNA, complete cds. "	DPlate 055	E11			AU031306				14	J21
7739	g_7739	EH0733	">AP000003_93(AP000003|pid:g3257103) Pyrococcus horikoshii OT3   genomic DNA, 544001-777000 nt. position (3/7);   &H71115(H71115) "	DPlate 053	F11			AU075455	AU075456			14	K21
7740	g_7740	EH1324		DPlate 055	F11			AU031314	AU031315			14	L21
7741	g_7741	EH0741	">ATAF000657_14(AF000657|pid:g2462834) Arabidopsis thaliana BAC   F19G10, complete sequence; hypothetical protein. "	DPlate 053	G11			AU075460	AU075461			14	M21
7742	g_7742	EH1332		DPlate 055	G11			AU162343				14	N21
7743	g_7743	EH0749		DPlate 053	H11			AU075464	AU031082			14	O21
7744	g_7744	EH1340	">ATAC004786_12(AC004786|pid:g3445208) Arabidopsis thaliana   chromosome II BAC T20K9 genomic sequence, complete   sequence; "	DPlate 055	H11			AU031327				14	P21
7745	g_7745	EH1969	">ATF16A16_13(AL035353|pid:g4218122) Arabidopsis thaliana DNA   chromosome 4, BAC clone F16A16 (ESSAII project);   similarity to predicted protein. Arabidopsis thaliana;   contains EST gb:T44959. "	DPlate 057	A05			AU031610	AU031611			15	A09
7746	g_7746	FE0482	>(P37834) PEROXIDASE PRECURSOR (EC 1.11.1.7).   &RICPEROX_1(D14997|pid:g287401) 	DPlate 059	A05			AU174871	AU174870			15	B09
7747	g_7747	EH1993		DPlate 057	B05			AU031624				15	C09
7748	g_7748	FE0490	">ATU64907_1(U64907|pid:g4097549) Arabidopsis thaliana farnesylated   protein ATFP4 mRNA, partial cds; farnesylated protein. "	DPlate 059	B05			AU174873	AU174872			15	D09
7749	g_7749	EH1914	">AF039573_1(AF039573|pid:g2773154) Oryza sativa abscisic acid- and   stress-inducible protein (Asr1) mRNA, complete cds;   similar to tomato ABA- stress- and ripening-related   protein ASR. "	DPlate 057	C05			AU031589	AU164976			15	E09
7750	g_7750	FE0403		DPlate 059	C05			AU174808				15	F09
7751	g_7751	EH1922		DPlate 057	D05			AU031593	AU031594			15	G09
7752	g_7752	FE0419	>ATH5813_1(AJ005813|pid:g3096910) Arabidopsis thaliana mRNA for   neoxanthin cleavage enzyme. 	DPlate 059	D05			AU174820	AU174819			15	H09
7753	g_7753	EH1962	">(P80497) ATP SYNTHASE 6 KD SUBUNIT, MITOCHONDRIAL (EC 3.6.1.34)   (FRAGMENT). "	DPlate 057	E05			AU101588				15	I09
7754	g_7754	FE0427	">(P42862) GLUCOSE-6-PHOSPHATE ISOMERASE, CYTOSOLIC A (GPI-A) (EC   5.3.1.9) (PHOSPHOGLUCOSE ISOMERASE A) (PGI-A)   (PHOSPHOHEXOSE ISOMERASE A) (PHI- A).   &RICPGIA_1(D45217|pid:g639684) "	DPlate 059	E05			AU174825				15	J09
7755	g_7755	EH1923	">ATAC003040_22(AC003040|pid:g3242718) Arabidopsis thaliana   chromosome II BAC F26B6 genomic sequence, complete   sequence; "	DPlate 057	F05			AU164450				15	K09
7756	g_7756	FE0435	">AF094773_1(AF094773|pid:g3789948) Oryza sativa translation   initiation factor 5A (eIF-5A) mRNA, complete cds. "	DPlate 059	F05			AU174831	AU174830			15	L09
7757	g_7757	EH1931		DPlate 057	G05			AU078148	AU078149			15	M09
7758	g_7758	FE0459	">AF051204_1(AF051204|pid:g2982243) Picea mariana hypothetical   protein (Sb07) mRNA, complete cds. "	DPlate 059	G05			AU174852	AU174851			15	N09
7759	g_7759	EH1947	>(P25866) UBIQUITIN-CONJUGATING ENZYME E2-17 KD (EC 6.3.2.19)   (UBIQUITIN-PROTEIN LIGASE) (UBIQUITIN CARRIER PROTEIN).    &WHTUCP1A_1(M62720|pid:g170785) 	DPlate 057	H05			AU090501	AU031602			15	O09
7760	g_7760	FE0475	>S76600(S76600) hypothetical protein - Synechocystis sp. (strain PCC   6803) &SYCSLRF_6(D64004|pid:g1001707) 	DPlate 059	H05			AU174861				15	P09
7761	g_7761	FE0008	">AF094773_1(AF094773|pid:g3789948) Oryza sativa translation   initiation factor 5A (eIF-5A) mRNA, complete cds. "	DPlate 057	A11			AU174549	AU174548			15	A21
7762	g_7762	FL0068	>(P25875) CHLOROPLAST 30S RIBOSOMAL PROTEIN S16.   &CHHVTRNK_2(X52765|pid:g11603) &S28766(S28766) 	DPlate 059	A11			AU174933	AU174932			15	B21
7763	g_7763	FE0016	>NTPAPGENE_1(Y15489|pid:g2632088) Nicotiana tabacum pap gene. 	DPlate 057	B11			AU174555				15	C21
7764	g_7764	FL0037	">HSU22055_1(U22055|pid:g799177) Human 100 kDa coactivator mRNA,   complete cds. &I38968(I38968) "	DPlate 059	B11			AU174909	AU174910			15	D21
7765	g_7765	FE0056	">AF041382_1(AF041382|pid:g2773363) Drosophila melanogaster microtubule   binding protein D-CLIP-190 mRNA, complete cds; CLIP-170   homolog. "	DPlate 057	C11			AU174572	AU174573			15	E21
7766	g_7766	FL0053	">ATAC004411_23(AC004411|pid:g3522956) Arabidopsis thaliana   chromosome II BAC F14M4 genomic sequence, complete   sequence; "	DPlate 059	C11			AU174921	AU174920			15	F21
7767	g_7767	FE0088	">AC005106_3(AC005106|pid:g3935139) Genomic sequence for Arabidopsis   thaliana BAC T25N20, complete sequence; hypothetical   protein. "	DPlate 057	D11			AU174596				15	G21
7768	g_7768	FL0061	">CHU93909_1(U93909|pid:g3342234) Cercopithecine herpesvirus 15   nuclear antigen EBNA-1 gene, complete cds. "	DPlate 059	D11			AU174925	AU174926			15	H21
7769	g_7769	FE0117	">AF030357_1(AF030357|pid:g2772934) Arabidopsis thaliana C-8,7 sterol   isomerase mRNA, complete cds; aSI1. "	DPlate 057	E11			AU174613				15	I21
7770	g_7770	FL0069		DPlate 059	E11			AU174935	AU174934			15	J21
7771	g_7771	FE0125	">ATFCA1_39(Z97336|pid:g2244827) Arabidopsis thaliana DNA chromosome   4, ESSA I contig fragment No. 1; similar to hypothetical   protein YMR009w - yeast. &H71409(H71409) "	DPlate 057	F11			AU174619	AU174620			15	K21
7772	g_7772	FL0077	>OSA18624_1(Y18624|pid:g4158221) Oryza sativa mRNA for reversibly   glycosylated polypeptide. 	DPlate 059	F11			AU174946	AU174945			15	L21
7773	g_7773	FE0149	">ATAC002521_5(AC002521|pid:g2947060) Arabidopsis thaliana chromosome   II BAC T20F6 genomic sequence, complete sequence; "	DPlate 057	G11			AU174631	AU174630			15	M21
7774	g_7774	FL0085		DPlate 059	G11			AU174956	AU174955			15	N21
7775	g_7775	FE0189		DPlate 057	H11			AU174669				15	O21
7776	g_7776	FL0006		DPlate 059	H11			AU174881	AU174880			15	P21
7777	g_7777	RA0330	">AF073875_1(AF073875|pid:g3978258) Arabidopsis thaliana   endo-1,4-beta-D-glucanase KORRIGAN (KOR) gene, KOR-1   allele, complete cds.   &AF074092_1(AF074092|pid:g3493633)   &AF074375_1(AF074375|pid:g3598956)   &ATU37702_1(U37702|pid:g1022807) &S71215(S71215) "	DPlate 061	A05			AU173081				16	A09
7778	g_7778	RA1276	>(P46611) S-ADENOSYLMETHIONINE SYNTHETASE (EC 2.5.1.6) (METHIONINE   ADENOSYLTRANSFERASE) (ADOMET SYNTHETASE).   &OSSAMS1_1(Z26867|pid:g450549) 	DPlate 063	A05			D24100				16	B09
7779	g_7779	RA0386		DPlate 061	B05			AU173090				16	C09
7780	g_7780	RA1221	>G01430(G01430) PL6 protein - human   &HSU09584_1(U09584|pid:g1209020) 	DPlate 063	B05			AU173135	AU173136			16	D09
7781	g_7781	RA0307		DPlate 061	C05			AU173074	AU173075			16	E09
7782	g_7782	RA1245	">AC003970_26(AC003970|pid:g3482933) Arabidopsis thaliana chromosome   I BAC F14J9 genomic sequence contains phyA marker,   complete sequence; Similar to cdc2 protein kinases. "	DPlate 063	C05			D24095	AU031735			16	F09
7783	g_7783	RA0387		DPlate 061	D05			AU173091				16	G09
7784	g_7784	RA1277		DPlate 063	D05			AU176511				16	H09
7785	g_7785	RA0308		DPlate 061	E05			AU173076	AU173077			16	I09
7786	g_7786	RA1286		DPlate 063	E05			AU176513				16	J09
7787	g_7787	RA0364		DPlate 061	F05			AU173084				16	K09
7788	g_7788	RA1215	">MTU16727_1(U16727|pid:g571484) Medicago truncatula peroxidase   precursor (rip1) gene, complete cds. "	DPlate 063	F05			D24090	C20484			16	L09
7789	g_7789	RA0372		DPlate 061	G05			D23845	AU164535			16	M09
7790	g_7790	RA1256		DPlate 063	G05			AU181010				16	N09
7791	g_7791	RA0409	">AF094773_1(AF094773|pid:g3789948) Oryza sativa translation   initiation factor 5A (eIF-5A) mRNA, complete cds. "	DPlate 061	H05			AU101601	AU101602			16	O09
7792	g_7792	RA1280		DPlate 063	H05			AU176512				16	P09
7793	g_7793	RA0530		DPlate 061	A11			D23896	AU031685			16	A21
7794	g_7794	RA1480	>(P07850) SULFITE OXIDASE (EC 1.8.3.1).   &A34180(A34180;S10446;S07219) 	DPlate 063	A11			AU173155	AU173156			16	B21
7795	g_7795	RA0554	">ALFNABP_1(L07291|pid:g166410) Alfalfa nucleic acid binding protein   (alfin-1) mRNA, partial cds; putative. "	DPlate 061	B11			D23907	AU164574			16	C21
7796	g_7796	RA1488	>(Q42525) HEXOKINASE (EC 2.7.1.1). &ATU18754_1(U18754|pid:g619928) 	DPlate 063	B11			AU031754	AU031753			16	D21
7797	g_7797	RA0594	">AC002291_1(AC002291|pid:g2829918) Arabidopsis thaliana chromosome I   BAC F22K20 genomic sequence, complete sequence; similar   to ""tub"" protein gp|U82468|2072162; location of EST   gb|T45528 and gb|AA395363. "	DPlate 061	C11			AU031694	AU031695			16	E21
7798	g_7798	RA1509		DPlate 063	C11			D24191	AU167001			16	F21
7799	g_7799	RA0515		DPlate 061	D11			AU101617				16	G21
7800	g_7800	RA1525		DPlate 063	D11			D24206	AU173168			16	H21
7801	g_7801	RA0531	">ATF1N20_11(AL022140|pid:g2961346) Arabidopsis thaliana DNA   chromosome 4, BAC clone F1N20 (ESSAII project); strong   similarity to pectinesterase, Lycopersicon esculentum,   PATX:E312172; contains EST gb:T43750, Z26220, Z26709. "	DPlate 061	E11			D23897	AU101619			16	I21
7802	g_7802	RA1573	>(P43591) HYPOTHETICAL 39.9 KD PROTEIN IN MPR1-GCN20 INTERGENIC   REGION. &S56262(S56262)   &YSCCHRVIN_76(D50617|pid:g836762) 	DPlate 063	E11			D24244	AU173172			16	J21
7803	g_7803	RA0555	>STCYTC82_1(X79275|pid:g633687) S.tuberosum (Desiree) 8.2kD subunit   of cytochrome C reductase mRNA; 8.2 kDa subunit of   cytochrome c reductase. 	DPlate 061	F11			D39007	AU082555			16	K21
7804	g_7804	RA1589	">ATF4D11_3(AL022537|pid:g3063693) Arabidopsis thaliana DNA   chromosome 4, BAC clone F4D11 (ESSAII project);   similarity to predicted protein, Synechocystis sp.,   PIR2:S74814. "	DPlate 063	F11			D24256	AU031770			16	L21
7805	g_7805	RA0579	>T4B21_14(AF118223|pid:g4115934) Arabidopsis thaliana BAC T4B21;   contains similarity to Methanobacterium   thermoautotrophicum transcriptional regulator   (GB:AE000850); coded for by A. thaliana cDNA T41846;   coded for by A. thaliana cDNA N38491; coded for by A.   thaliana cDNA T44713. 	DPlate 061	G11			D39009	AU164580			16	M21
7806	g_7806	RA1526	">SPAC637_8(AL034583|pid:g4056552) S.pombe chromosome I cosmid c637;   SPAC637.08, len:317, SIMILARITY:Saccharomyces   cerevisiae, YGL091C, NB35_YEAST, nbp35 protein., (328   aa), fasta scores: opt: 1437, E():0, (62.9% identity in   302 aa). "	DPlate 063	G11			D24207	AU176518			16	N21
7807	g_7807	RA0595	>(P41057) 40S RIBOSOMAL PROTEIN YS29A. 	DPlate 061	H11			D39010	AU162383			16	O21
7808	g_7808	RA1558	">GMU42608_1(U42608|pid:g1335862) Glycine max clathrin heavy chain   mRNA, complete cds. "	DPlate 063	H11			AU173170	AU173171			16	P21
7809	g_7809	RA1981		DPlate 065	A05			AU173276				17	A09
7810	g_7810	RA2749	>(P32260) CYSTEINE SYNTHASE CHLOROPLAST PRECURSOR (EC 4.2.99.8)   (O-ACETYLSERINE SULFHYDRYLASE) (O-ACETYLSERINE   (THIOL)-LYASE) (CSASE). &SPICYSSY_1(D14722|pid:g303902)   	DPlate 067	A05			D24907	AU031942			17	B09
7811	g_7811	RA1989	>(Q55158) RIBOFLAVIN-SPECIFIC DEAMINASE (EC 3.5.4.-).   &S74377(S74377) &SYCCPNC_56(D64001|pid:g1001153) 	DPlate 065	B05			D28312	AU031831			17	C09
7812	g_7812	RA2702	>OSHSC70A_1(X67711|pid:g763160) O.sativa hsp70 gene for heat shock   protein 70. &S53126(S53126) 	DPlate 067	B05			D24882	AU031933			17	D09
7813	g_7813	RA1926	>(P40713) FRUCTOKINASE (EC 2.7.1.4).   &ECCSCABKR_2(X81461|pid:g608707) &S52161(S52161) 	DPlate 065	C05			AU173260	AU173261			17	E09
7814	g_7814	RA2758	>(P26779) SAPOSIN C (CO-BETA-GLUCOSIDASE) (A1 ACTIVATOR)   (GLUCOSYLCERAMIDASE ACTIVATOR) (SPHINGOLIPID ACTIVATOR   PROTEIN A) (SAP-2). &S21770(S21770) 	DPlate 067	C05			AU173392				17	F09
7815	g_7815	RA1958	">GMU12735_2(U12735|pid:g530088) Glycine max   aminoalcoholphosphotransferase (AAPT1) mRNA, complete   cds; "	DPlate 065	D05			D39099	AU173268			17	G09
7816	g_7816	RA2766	>(P53496) ACTIN 11. &ATU27981_1(U27981|pid:g1002533)   &S68109(S68109) 	DPlate 067	D05			AU173395				17	H09
7817	g_7817	RA1982		DPlate 065	E05			D39110	AU173277			17	I09
7818	g_7818	RA2790	">AF036172_1(AF036172|pid:g4104457) Zea mays 2-oxoglutarate/malate   translocator (Zmmt) gene, partial cds. "	DPlate 067	E05			D24923	AU173398			17	J09
7819	g_7819	RA1927	">ATAC004165_7(AC004165|pid:g3150403) Arabidopsis thaliana chromosome   II BAC T27E13 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 065	F05			D28305	AU031816			17	K09
7820	g_7820	RA2783		DPlate 067	F05			D24919	AU031947			17	L09
7821	g_7821	RA1943	>(P40027) HYPOTHETICAL 27.7 KD PROTEIN IN PIP1-GLN3 INTERGENIC   REGION. &S50542(S50542) &SCE9379_7(U18796|pid:g603272) 	DPlate 065	G05			D24450	AU031819			17	M09
7822	g_7822	RA2791	>CELZC449_6(U41510|pid:g1099002) Caenorhabditis elegans cosmid   ZC449; coded for by C. elegans cDNA yk61e11.3; coded for   by C. elegans cDNA yk69a7.5; coded for by C. elegans   cDNA yk61e11.5. 	DPlate 067	G05			D24924	AU173399			17	N09
7823	g_7823	RA1944	">ATAC006931_32(AC006931|pid:g4512685) Arabidopsis thaliana   chromosome II BAC F7D19 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 065	H05			D24451	AU031820			17	O09
7824	g_7824	RA2736	">AB017042_1(AB017042|pid:g4126809) Oryza sativa mRNA for glyoxalase   I, complete cds; putative. "	DPlate 067	H05			D24899	AU031940			17	P09
7825	g_7825	RA2052		DPlate 065	A11			D24492	AU031838			17	A21
7826	g_7826	RA2920	">AB008782_1(AB008782|pid:g2626753) Arabidopsis thaliana mRNA for   sulfate transporter, complete cds. "	DPlate 067	A11			D25000	AU031967			17	B21
7827	g_7827	RA2068	">ATAC004411_8(AC004411|pid:g3522938) Arabidopsis thaliana chromosome   II BAC F14M4 genomic sequence, complete sequence;   unknown protein. "	DPlate 065	B11			D24501	AU173300			17	C21
7828	g_7828	RA2952	">AF001505_1(AF001505|pid:g2160782) Oryza sativa putative ammonium   transporter OsAMT1p (OsAMT1) mRNA, complete cds. "	DPlate 067	B11			D39189				17	D21
7829	g_7829	RA2076		DPlate 065	C11			D24507				17	E21
7830	g_7830	RA2968	">ATT13J8_11(AL035524|pid:g4455359) Arabidopsis thaliana DNA   chromosome 4, BAC clone T13J8 (ESSAII project);   similarity to MSP1, Saccharomyces cerevisiae,   PIR2:A49506; Contains AAA-protein family signatur. "	DPlate 067	C11			D25040	AU031974			17	F21
7831	g_7831	RA2045	">OSU28047_1(U28047|pid:g1143864) Oryza sativa beta-glucosidase mRNA,   nuclear gene encoding chloroplast protein, complete cds;   beta-D-glucoside glucohydrolase; dimer of 60 kDa   monomers; localized in the plastid. "	DPlate 065	D11			AU176521				17	G21
7832	g_7832	RA2976	">DCU93048_1(U93048|pid:g2224911) Daucus carota somatic embryogenesis   receptor-like kinase mRNA, complete cds; SERK. "	DPlate 067	D11			D25047	C22605			17	H21
7833	g_7833	RA2061	">PUMMICY_1(L34207|pid:g1196798) Petroselinum crispum mitotic cyclin   gene, complete cds; amino acid feature: destruction box,   aa 33 .. 41; amino acid feature: cyclin box, aa 215 ..   363; amino acid feature: P-box, aa 215 .. 248. "	DPlate 065	E11			D24497	AU173295			17	I21
7834	g_7834	RA2929	">OSU72255_1(U72255|pid:g4097948) Oryza sativa beta-1,3-glucanase   precursor (Gns9) gene, complete cds. "	DPlate 067	E11			D39187				17	J21
7835	g_7835	RA2014	>(Q02283) HOMEOBOX-LEUCINE ZIPPER PROTEIN HAT5 (HD-ZIP PROTEIN 5)   (HD-ZIP PROTEIN ATHB-1). &ATHB1_3(X58821|pid:g16329)   &S16325(S16325) 	DPlate 065	F11			AU173287	AU173288			17	K21
7836	g_7836	RA2937		DPlate 067	F11			D25012	AU173407			17	L21
7837	g_7837	RA2030		DPlate 065	G11			AU173291				17	M21
7838	g_7838	RA2945	">ATF25I24_17(AL049525|pid:g4539370) Arabidopsis thaliana DNA   chromosome 4, BAC clone F25I24 (ESSA project); strong   similarity to UDP-galactose 4-epimerase, Cyamopsis   tetragonoloba, AJ005082. "	DPlate 067	G11			D25020	AU173409			17	N21
7839	g_7839	RA2062	>ZMGRP3_1(Y07781|pid:g1532071) Z.mays grp3 mRNA for glycine-rich   protein. 	DPlate 065	H11			AU173296	AU173297			17	O21
7840	g_7840	RA2953	>JC5695(JC5695)Dnm1p/Vps1p-like protein - human 	DPlate 067	H11			D25026	AU162446			17	P21
7841	g_7841	RA3394	">SPCC1322_5(AL035259|pid:g4176545) S.pombe chromosome III cosmid   c1322; SPCC1322.05c, len:612, SIMILARITY:Saccharomyces   cerevisiae, LKHA_YEAST, probable leukotriene a-4   hydrolase, (671 aa), fasta scores: opt: 1595, E():0,   (46.7% identity in 625 aa). "	DPlate 069	A05			D39356				18	A09
7842	g_7842	RB0028		DPlate 071	A05			AU070661				18	B09
7843	g_7843	RA3315	">ATAC002332_9(AC002332|pid:g2459415) Arabidopsis thaliana chromosome   II BAC F4P9 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 069	B05			AU173486	AU173487			18	C09
7844	g_7844	RB0052	">AF087142_1(AF087142|pid:g3676764) Homo sapiens TED protein (TED)   mRNA, complete cds. "	DPlate 071	B05			AU070672				18	D09
7845	g_7845	RA3355	">HVU59313_1(U59313|pid:g1718238) Hordeum vulgare (1,4)-beta-xylan   endohydrolase isoenzyme X-II mRNA, partial cds;   xylanase. "	DPlate 069	C05			AU173493	AU173494			18	E09
7846	g_7846	RB0060		DPlate 071	C05			AU076225	AU091463			18	F09
7847	g_7847	RA3371		DPlate 069	D05			AU173498	AU173499			18	G09
7848	g_7848	RB0021	">ATAC002387_7(AC002387|pid:g2583113) Arabidopsis thaliana chromosome   II BAC F4L23 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 071	D05			AU070657	AU101687			18	H09
7849	g_7849	RA3379	>(P31924) SUCROSE SYNTHASE 2 (EC 2.4.1.13) (SUCROSE-UDP   GLUCOSYLTRANSFERASE 2). &ORRSS2_1(X59046|pid:g20095) 	DPlate 069	E05			D39345	AU173501			18	I09
7850	g_7850	RB0061	">SHU91982_1(U91982|pid:g4099921) Stylosanthes hamata EREBP-3 homolog   mRNA, complete cds; similar to Nicotiana tabacum   EREBP-3, GenBank Accession Number D38124. "	DPlate 071	E05			AU173832				18	J09
7851	g_7851	RA3395	">AC004122_14(AC004122|pid:g3540187) Arabidopsis thaliana chromosome   I BAC T27I1 genomic sequence, complete sequence;   Hypothetical protein. "	DPlate 069	F05			AU173503	AU173504			18	K09
7852	g_7852	RB0077	">D82036_1(D82036|pid:g4107003) Oryza sativa mRNA for OSK5, complete   cds. &D82038_1(D82038|pid:g4107007) "	DPlate 071	F05			AU070683	AU162564			18	L09
7853	g_7853	RA3316	">SPCC1322_5(AL035259|pid:g4176545) S.pombe chromosome III cosmid   c1322; SPCC1322.05c, len:612, SIMILARITY:Saccharomyces   cerevisiae, LKHA_YEAST, probable leukotriene a-4   hydrolase, (671 aa), fasta scores: opt: 1595, E():0,   (46.7% identity in 625 aa). "	DPlate 069	G05			AU181017				18	M09
7854	g_7854	RB0085		DPlate 071	G05			AU085985	AU070688			18	N09
7855	g_7855	RA3348	">ATF10M23_21(AL035440|pid:g4455210) Arabidopsis thaliana DNA   chromosome 4, BAC clone F10M23 (ESSAII project);   similarity to aspartate-tRNA ligase (EC 6.1.1.12)   -Methanobacterium thermoautotrophicum, GB:AE000809;   Contains Aminoacyl-transfer RNA synthetases class-II   signatures [FRAEDSFTHRHLCEFVGLD] [GVGLERVVML]; contains   EST gb:AA720362, Z34062. "	DPlate 069	H05			D25145	AU173492			18	O09
7856	g_7856	RB0093		DPlate 071	H05			AU070691				18	P09
7857	g_7857	RA3408	">ATAC004411_27(AC004411|pid:g3522949) Arabidopsis thaliana   chromosome II BAC F14M4 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 069	A11			AU032060	AU162465			18	A21
7858	g_7858	RB0227		DPlate 071	A11			AU070775				18	B21
7859	g_7859	RA3424	>(P47916) S-ADENOSYLMETHIONINE SYNTHETASE (EC 2.5.1.6) (METHIONINE   ADENOSYLTRANSFERASE) (ADOMET SYNTHETASE).   &POPSAMPDPT_1(M73430|pid:g497900) 	DPlate 069	B11			AU065347	AU090510			18	C21
7860	g_7860	RB0251	>CELR04E5_3(U41538|pid:g1109849) Caenorhabditis elegans cosmid   R04E5; proline rich; coded for by C. elegans cDNA   yk91g9.5; coded for by C. elegans cDNA yk104c8.5. 	DPlate 071	B11			AU070791	AU092001			18	D21
7861	g_7861	RA3440	">ATAC003680_25(AC003680|pid:g2979562) Arabidopsis thaliana   chromosome II BAC F17K2 genomic sequence, complete   sequence; unknown protein.   &ATAC004665_30(AC004665|pid:g3386623) "	DPlate 069	C11			AU095513	AU032071			18	E21
7862	g_7862	RB0228		DPlate 071	C11			AU070776				18	F21
7863	g_7863	RA3448		DPlate 069	D11			AU032075	AU101679			18	G21
7864	g_7864	RB0252	">ATM3E9_3(AL022223|pid:g2982452) Arabidopsis thaliana DNA chromosome   4, BAC clone M3E9 (ESSA project); similarity to Cf-2.1,   Solanum pimpinellifolium; Contains Protein kinases   signatures and profile,   [IGTGSSGVVYRITIPSGESLAVK][IIHGDVKAMNVLL]; contains EST   gb:N37940, AA395026, T41929. "	DPlate 071	D11			AU070792	AU101693			18	H21
7865	g_7865	RA3456		DPlate 069	E11			AU090572				18	I21
7866	g_7866	RB0276	">AF104221_2(AF104221|pid:g4039153) Arabidopsis thaliana low   temperature and salt responsive protein LTI6B (lti6b)   and low temperature and salt responsive protein LTI6A   (lti6a) genes, complete cds.   &AF122005_1(AF122005|pid:g4325217) "	DPlate 071	E11			AU070804	AU090573			18	J21
7867	g_7867	RA3472		DPlate 069	F11			AU162488	AU162489			18	K21
7868	g_7868	RB0229	">AF004358_1(AF004358|pid:g2190992) Aegilops squarrosa glutathione   S-transferase TSI-1 mRNA, complete cds; GST isozyme. "	DPlate 071	F11			AU162577	AU070777			18	L21
7869	g_7869	RA3488	">ATAC005313_5(AC005313|pid:g3548802) Arabidopsis thaliana chromosome   II BAC T18E12 genomic sequence, complete sequence;   &ATAC006284_28(AC006284|pid:g4335769) "	DPlate 069	G11			AU032088				18	M21
7870	g_7870	RB0293	">PVU34334_1(U34334|pid:g1420887) Phaseolus vulgaris non-specific   lipid transfer-like protein mRNA, complete cds.   &S72530(S72530) "	DPlate 071	G11			AU173847	AU070814			18	N21
7871	g_7871	RA3496	">AE001454_5(AE001454|pid:g4154673) Helicobacter pylori, strain J99   section 15 of 132 of the complete genome; similar to H.   pylori 26695 gene HP0171. "	DPlate 069	H11			AU032092	AU173520			18	O21
7872	g_7872	RB0222	">AF031547_1(AF031547|pid:g2641211) Fritillaria agrestis histone-like   protein mRNA, complete cds. "	DPlate 071	H11			AU070770	AU091995			18	P21
7873	g_7873	RB0813	">D55708_1(D55708|pid:g2696221) Oryza sativa mRNA for chitinase,   complete cds. &JC5841(JC5841) "	DPlate 073	A05			AU071144	AU083510			19	A09
7874	g_7874	SA0326	">ATF13D4_8(AL031369|pid:g3482972) Arabidopsis thaliana DNA   chromosome 2, BAC clone F13D4 (ESSAII project);   similarity to predicted protein, Arabidopsis thaliana,   PID:e1285453. "	DPlate 075	A05			AU102213	AU056142			19	B09
7875	g_7875	RB0821	>DCHCBT1B_1(Z84385|pid:g2239087) D.caryophyllus mRNA for   anthranilate N-hydroxycinnamoyl/benzoyltransferase   (clone pchcbt1b). &DCHCBT1_1(Z84383|pid:g2239083) 	DPlate 073	B05			AU071151				19	C09
7876	g_7876	SA0334	">ATAC003673_11(AC003673|pid:g3004565) Arabidopsis thaliana   chromosome II BAC F19F24 genomic sequence, complete   sequence; "	DPlate 075	B05			AU056153	AU056154			19	D09
7877	g_7877	RB0861	">SBU60764_1(U60764|pid:g1408222) Sorghum bicolor   pathogenesis-related protein (PR-10) mRNA, complete cds.   "	DPlate 073	C05			AU071177	AU101708			19	E09
7878	g_7878	SA0358	">AF094775_1(AF094775|pid:g3789952) Oryza sativa chlorophyll   a/b-binding protein presursor (Cab27) mRNA, nuclear gene   encoding chloroplast protein, complete cds; 27 KDa. "	DPlate 075	C05			AU056185	AU056186			19	F09
7879	g_7879	RB0806	">D26015_1(D26015|pid:g2541876) Nicotiana tabacum mRNA for CND41,   chloroplast nucleoid DNA binding protein, complete cds. "	DPlate 073	D05			AU071138	AU163489			19	G09
7880	g_7880	SA0374		DPlate 075	D05			AU056203	AU056204			19	H09
7881	g_7881	RB0870		DPlate 073	E05			AU071185				19	I09
7882	g_7882	SA0382	">AF052585_1(AF052585|pid:g4091806) Malus domestica cultivar Fuji   CONSTANS-like protein 2 (Col2) mRNA, complete cds. "	DPlate 075	E05			AU173881				19	J09
7883	g_7883	RB0878	>(Q05047) CYTOCHROME P450 LXXII (EC 1.14.14.1) (PROBABLE   GERANIOL-10- HYDROXYLASE) (GE10H).   &CTRCTP450P_1(L10081|pid:g167484) 	DPlate 073	F05			AU071192				19	K09
7884	g_7884	SA0390		DPlate 075	F05			AU056219	AU173882			19	L09
7885	g_7885	RB0815	">AF082033_1(AF082033|pid:g3551960) Hemerocallis hybrid cultivar   senescence-associated protein 15 (SA15) mRNA, complete   cds; mRNA accumulates in senescing petals and   accumulation is induced by exogenous ABA. "	DPlate 073	G05			AU071146	AU163490			19	M09
7886	g_7886	SA0311		DPlate 075	G05			AU056123				19	N09
7887	g_7887	RB0823	">ATT6K21_12(AL021889|pid:g2894603) Arabidopsis thaliana DNA   chromosome 4, BAC clone T6K21 (ESSAII project);   similarity to predicted protein, Arabidopsis thaliana. "	DPlate 073	H05			AU071153				19	O09
7888	g_7888	SA0319	">T31J12_6(AC006416|pid:g4337177) Arabidopsis thaliana chromosome 1   BAC T31J12 sequence, complete sequence; Identical to   gb|Y10557 g5bf gene from Arabidopsis thaliana. ESTs   gb|R30578, gb|R90475, gb|T22384, gb|T22425, gb|N64934   and gb|T46767 come from this gene.. "	DPlate 075	H05			AU056132	AU162652			19	P09
7889	g_7889	SA0035	">S75487_1(S75487|pid:g913445) adh3a=alcohol dehydrogenase ADH,   adh3b=alcohol dehydrogenase ADH [Lycopersicon   esculentum=tomatoes, cv. red cherry, Genomic, 6282 nt];   alcohol dehydrogenase homolog; This sequence comes from   Fig. 2. Map location 4. Protein sequence is in   conflict with the conceptual translation; mismatch(46[R-   &V]). "	DPlate 073	A11			AU055750	AU055751			19	A21
7890	g_7890	SA0427	">AB016283_1(AB016283|pid:g3345477) Oryza sativa gene for carbonic   anhydrase, complete cds. "	DPlate 075	A11			AU056257	AU056258			19	B21
7891	g_7891	SA0051	>(Q39021) MITOGEN-ACTIVATED PROTEIN KINASE HOMOLOG 1 (EC 2.7.1.-)   (MAP KINASE 1) (ATMPK1).   &ATHATMPK1_1(D14713|pid:g533280) 	DPlate 073	B11			AU055781	AU055782			19	C21
7892	g_7892	SA0435		DPlate 075	B11			AU056267	AU056268			19	D21
7893	g_7893	SA0059		DPlate 073	C11			AU055795	AU055796			19	E21
7894	g_7894	SA0443	">MCU80071_1(U80071|pid:g1773330) Mesembryanthemum crystallinum   glycolate oxidase (GOX) mRNA, complete cds. "	DPlate 075	C11			AU056281	AU095634			19	F21
7895	g_7895	SA0083	">(P22200) PYRUVATE KINASE, CYTOSOLIC ISOZYME (EC 2.7.1.40).   &S12248(S12248) &STPYRK_1(X53688|pid:g22576) "	DPlate 073	D11			AU055828	AU055829			19	G21
7896	g_7896	SA0451	>(P35614) EUKARYOTIC PEPTIDE CHAIN RELEASE FACTOR SUBUNIT 1 (ERF1)   (OMNIPOTENT SUPPRESSOR PROTEIN 1 HOMOLOG) (SUP1   HOMOLOG). &AT81KBGEN_8(X98130|pid:g1402882)   &ATERF13_1(X97486|pid:g1495249)   &ATSLP1_1(X69375|pid:g16514) &S31328(S31328) 	DPlate 075	D11			AU056293	AU056294			19	H21
7897	g_7897	SA0091	">ATM7J2_19(AL022197|pid:g2980806) Arabidopsis thaliana DNA   chromosome 4, P1 clone M7J2 (ESSAII project); similarity   to antisense basic fibroblast growth factor, rat,   G1518635. "	DPlate 073	E11			AU055843	AU055844			19	I21
7898	g_7898	SA0459		DPlate 075	E11			AU056305	AU056306			19	J21
7899	g_7899	SA0012	">AB023967_1(AB023967|pid:g4514554) Homo sapiens mRNA for Rod1,   complete cds. "	DPlate 073	F11			AU055714	AU055715			19	K21
7900	g_7900	SA0467	">ANARBCLSC_2(L02522|pid:g142089) Anabaena sp. ribulose   1,5-bisphosphate carboxylase/oxygenase large subunit   (rbcL) gene, complete cds; ribulose 1,5-bisphosphate   carboxylase/oxygenase small subunit (rbcS) gene,   complete cds; (rbcX) gene, complete cds; putative.   &JQ2270(JQ2270) "	DPlate 075	F11			AU056317	AU056318			19	L21
7901	g_7901	SA0020	">ATAC006282_17(AC006282|pid:g4415922) Arabidopsis thaliana   chromosome II BAC F13K3 genomic sequence, complete   sequence; "	DPlate 073	G11			AU055724	AU055725			19	M21
7902	g_7902	SA0475		DPlate 075	G11			AU056326				19	N21
7903	g_7903	SA0028	">ATAC006931_11(AC006931|pid:g4512667) Arabidopsis thaliana   chromosome II BAC F7D19 genomic sequence, complete   sequence; "	DPlate 073	H11			AU055739	AU055740			19	O21
7904	g_7904	SA0483	">ATFCA5_20(Z97340|pid:g2244970) Arabidopsis thaliana DNA chromosome   4, ESSA I contig fragment No. 5; hypothetical protein.   &ATSEB1_1(Y14423|pid:g2326365) &E71427(E71427) "	DPlate 075	H11			AU173885	AU173886			19	P21
7905	g_7905	SA0515		DPlate 076	A05			AU056366	AU056367			20	A09
7906	g_7906	SA1307		DPlate 079	A05			AU181023				20	B09
7907	g_7907	SA0563	">A55450(A55450) cysteine synthase (EC 4.2.99.8) C precursor,   mitochondrial - spinach   &SPICYSCA_1(D37963|pid:g1066153) "	DPlate 076	B05			AU056419	AU056418			20	C09
7908	g_7908	SA1363		DPlate 079	B05			AU057342				20	D09
7909	g_7909	SA0579		DPlate 076	C05			AU173895	AU173896			20	E09
7910	g_7910	SA1387	">MUSCEREBN_1(L10908|pid:g862343) Mus musculus Gcap1 mRNA, partial   cds. "	DPlate 079	C05			AU057373	AU057374			20	F09
7911	g_7911	SA0508		DPlate 076	D05			AU173889	AU056359			20	G09
7912	g_7912	SA1356		DPlate 079	D05			AU173951				20	H09
7913	g_7913	SA0564		DPlate 076	E05			AU056420				20	I09
7914	g_7914	SA1364	">ZMU79961_1(U79961|pid:g2443857) Zea mays vacuolar sorting receptor   homolog mRNA, partial cds; similar to Pisum sativum   BP-80 vacuolar sorting receptor, GenBank Accession   Number U79958. "	DPlate 079	E05			AU173952	AU057343			20	J09
7915	g_7915	SA0572		DPlate 076	F05			AU056426	AU173894			20	K09
7916	g_7916	SA1396		DPlate 079	F05			AU057382	AU057383			20	L09
7917	g_7917	SA0580	">(P09315) GLYCERALDEHYDE 3-PHOSPHATE DEHYDROGENASE A PRECURSOR,   CHLOROPLAST (EC 1.2.1.12).   &DEZMG3(A30890;S00353;S19255)   &MZEG3PD_1(M18976|pid:g168479)   &ZMGPA1_1(X15408|pid:g763035) "	DPlate 076	G05			AU173897	AU173898			20	M09
7918	g_7918	SA1417		DPlate 079	G05			AU057407				20	N09
7919	g_7919	SA0588	">ATAC006223_17(AC006223|pid:g4263711) Arabidopsis thaliana   chromosome II BAC F22D22 genomic sequence, complete   sequence; "	DPlate 076	H05			AU162686	AU056443			20	O09
7920	g_7920	SA1433		DPlate 079	H05			AU057425				20	P09
7921	g_7921	SA0709		DPlate 076	A11			AU082565	AU056583			20	A21
7922	g_7922	SA1530	">AF039532_1(AF039532|pid:g2801538) Oryza sativa harpin induced gene   1 homolog (Hin1) mRNA, complete cds. "	DPlate 079	A11			AU173961	AU057524			20	B21
7923	g_7923	SA0717		DPlate 076	B11			AU090519	AU056594			20	C21
7924	g_7924	SA1539		DPlate 079	B11			AU057537	AU057538			20	D21
7925	g_7925	SA0733		DPlate 076	C11			AU056615	AU056616			20	E21
7926	g_7926	SA1579	">ATU49259_1(U49259|pid:g1293565) Arabidopsis thaliana isopentenyl   diphosphate:dimethylallyl diphosphate isomerase (IPP2)   mRNA, complete cds; functionally complements an IDI1   mutant of Saccharomyces cerevisiae. &S71370(S71370) "	DPlate 079	C11			AU077794	AU077795			20	F21
7927	g_7927	SA0741	">ALFNDGS_1(L37606|pid:g1066499) Medicago sativa (clone GG16-1)   NADH-dependent glutamate synthase gene, complete cds. "	DPlate 076	D11			AU173913	AU056628			20	G21
7928	g_7928	SA1508		DPlate 079	D11			AU070287				20	H21
7929	g_7929	SA0757	">ATF24J7_16(AL021768|pid:g2853087) Arabidopsis thaliana DNA   chromosome 4, BAC clone F24J7 (ESSAII project);   similarity to cyclin C homolog 1, Schizosaccharomyces   pombe, PATCHX:G2055413; contains EST gb:Z18405. "	DPlate 076	E11			AU056645	AU056646			20	I21
7930	g_7930	SA1556	">GMU43838_1(U43838|pid:g1438879) Glycine max choline kinase GmCK1p   mRNA, complete cds; choline kinase. "	DPlate 079	E11			AU057557	AU057558			20	J21
7931	g_7931	SA0765	">GHU88318_1(U88318|pid:g1843647) Gossypium hirsutum   (+)-delta-cadinene synthase (cdn1) mRNA, complete cds;   sesquiterpene cyclase; delta-cadinene synthase. "	DPlate 076	F11			AU056657	AU056658			20	K21
7932	g_7932	SA1572		DPlate 079	F11			AU057574				20	L21
7933	g_7933	SA0734		DPlate 076	G11			AU056617				20	M21
7934	g_7934	SA1580		DPlate 079	G11			AU057579				20	N21
7935	g_7935	SA0750		DPlate 076	H11			AU056638	AU056639			20	O21
7936	g_7936	SA1588		DPlate 079	H11			AU173964				20	P21
7937	g_7937	SS0086		DPlate 081	A05			C23573	AU032455			21	A09
7938	g_7938	SS4236	">ATSABRE14_1(U19134|pid:g719291) Arabidopsis thaliana SABRE gene, exon   14 and complete cds. "	DPlate 083	A05			D48162	AU101788			21	B09
7939	g_7939	SS0023		DPlate 081	B05			AU032437	AU091720			21	C09
7940	g_7940	SS4252	">AGU83687_1(U83687|pid:g1835701) Apium graveolens NADPH-dependent   mannose 6-phosphate reductase (m6pr) mRNA, complete cds;   aldo-keto reductase; similar to aldose 6-phosphate   reductase also known as NADP-sorbitol-6-phosphate   dehydrogenase encoded by GenBank Accession Number   D11080. "	DPlate 083	B05			D48175	AU032804			21	D09
7941	g_7941	SS0063	">AF044216_1(AF044216|pid:g2935342) Arabidopsis thaliana steroid   22-alpha-hydroxylase (DWF4) gene, complete cds; member   of the cytochrome P450 superfamily; CYP90B1. "	DPlate 081	C05			AU065768	AU173983			21	E09
7942	g_7942	SS4268		DPlate 083	C05			AU174049	AU101790			21	F09
7943	g_7943	SS0087		DPlate 081	D05			C23574	AU032456			21	G09
7944	g_7944	SS4237	">AF051236_1(AF051236|pid:g2982303) Picea mariana hypothetical   protein (Sb50) mRNA, partial cds; similar to   Caenorhabditis elegans C01F1.3 gene product encoded by   GenBank Accession Number U58761. "	DPlate 083	D05			D48163				21	H09
7945	g_7945	SS0040		DPlate 081	E05			AU075867	AU075868			21	I09
7946	g_7946	SS4261	">TAU91981_1(U91981|pid:g4099919) Triticum aestivum pollen allergen   homolog mRNA, complete cds; ps93. "	DPlate 083	E05			D48180	AU174046			21	J09
7947	g_7947	SS0048	>(P12339) CHLOROPLAST 30S RIBOSOMAL PROTEIN S7.   &CHZMXX_74(X86563|pid:g902274)   &CHZMXX_98(X86563|pid:g902298)   &S58630(S58630;S58605;A29470) 	DPlate 081	F05			AU162795	AU162796			21	K09
7948	g_7948	SS4277		DPlate 083	F05			D48191	AU101791			21	L09
7949	g_7949	SS0709	>PVRNP1_1(X82030|pid:g558629) P.vulgaris mRNA for RNP1 chloroplast   RNA binding protein. &S49463(S49463) 	DPlate 081	G05			D46191	AU032541			21	M09
7950	g_7950	SS4293	">AF032976_1(AF032976|pid:g2655295) Oryza sativa germin-like protein   6 (GER6) mRNA, complete cds; similar to wheat and barley   oxalate oxidase. "	DPlate 083	G05			D48202	AU101793			21	N09
7951	g_7951	SS0702	>PHDNANAM_1(X92204|pid:g1279640) P.hybrida NAM gene. 	DPlate 081	H05			D46185	AU032537			21	O09
7952	g_7952	SS4206	">ATT16L1_26(AL031394|pid:g3549679) Arabidopsis thaliana DNA   chromosome 4, BAC clone T16L1 (ESSAII project);   similarity to inositol 1, 3, 4-trisphosphat. "	DPlate 083	H05			D48140	AU096553			21	P09
7953	g_7953	SS2667		DPlate 081	A11			D47349	AU174006			21	A21
7954	g_7954	SS5018		DPlate 083	A11			AU181028				21	B21
7955	g_7955	SS2675	">ATAC004261_8(AC004261|pid:g3402703) Arabidopsis thaliana chromosome   II BAC T3K9 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 081	B11			D47357	AU174007			21	C21
7956	g_7956	SS5074		DPlate 083	B11			D48696	AU174069			21	D21
7957	g_7957	SS2691	>(P20027) MYB-RELATED PROTEIN HV33. &HVMYB3G_1(X70881|pid:g456214)   &S31818(S31818;S35419;S61508;S04897) 	DPlate 081	C11			D47363	AU174010			21	E21
7958	g_7958	SS5043	">ATM3E9_4(AL022223|pid:g2982453) Arabidopsis thaliana DNA chromosome   4, BAC clone M3E9 (ESSA project); strong similarity to   fructose-bisphosphate aldolase, Arabidopsis thaliana,   PIR1:ADMU; Contains Fructose-bisphosphate aldolase   class-I active site, [VLLEGTLLKPN]. "	DPlate 083	C11			AU070425				21	F21
7959	g_7959	SS2628	">ATAC003058_4(AC003058|pid:g3135254) Arabidopsis thaliana chromosome   II BAC F27F23 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 081	D11			D47325	AU173993			21	G21
7960	g_7960	SS5012	">AF022731_1(AF022731|pid:g2570497) Oryza sativa H protein subunit of   glycine decarboxylase mRNA, complete cds. "	DPlate 083	D11			D48667	AU163050			21	H21
7961	g_7961	SS2636	">AP000003_136(AP000003|pid:g3257146) Pyrococcus horikoshii OT3   genomic DNA, 544001-777000 nt. position (3/7);   &C71121(C71121) "	DPlate 081	E11			AU173998	AU173999			21	I21
7962	g_7962	SS5044	>(P51306) CHLOROPLAST 50S RIBOSOMAL PROTEIN L29.   &PPU38804_120(U38804|pid:g1276772) &S73227(S73227) 	DPlate 083	E11			AU174066	AU174067			21	J21
7963	g_7963	SS2644	>S39394(S39394;S39395) protochlorophyllide reductase (EC 1.3.1.33)   precursor - wheat &TAPWR5PI_1(X76532|pid:g510677) 	DPlate 081	F11			D47332	AU162885			21	K21
7964	g_7964	SS5068	">AC003970_20(AC003970|pid:g3482929) Arabidopsis thaliana chromosome   I BAC F14J9 genomic sequence contains phyA marker,   complete sequence; Putative transcription factor;   contains Myb DNA-binding domain motif, 68157-68216.   Similar to Arabidopsis thaliana transcription factor   ATMYB4, gi|3047079. "	DPlate 083	F11			D48692	AU163067			21	L21
7965	g_7965	SS2652		DPlate 081	G11			D47339	AU174003			21	M21
7966	g_7966	SS5076	>(Q03431) PARATHYROID HORMONE/PARATHYROID HORMONE-RELATED PEPTIDE   RECEPTOR PRECURSOR.   &A49191(I38139;A49191;I38113;G01562;S29610)   &HSPHR_1(X68596|pid:g396813)   &HSPTHPRH9_1(U22409|pid:g897596)   &HSU17418_1(U17418|pid:g596130)   &HUMPTHR_1(L04308|pid:g190722) 	DPlate 083	G11			D48698	AU096750			21	N21
7967	g_7967	SS2684	">(P08640) GLUCOAMYLASE S1/S2 PRECURSOR (EC 3.2.1.3) (GLUCAN   1,4-ALPHA- GLUCOSIDASE) (1,4-ALPHA-D-GLUCAN   GLUCOHYDROLASE).   &S48478(S48478;A26877;B26877;S27281;JC6123)   &SC9168_1(Z38061|pid:g557822)   &SCU30626_1(U30626|pid:g1304387) "	DPlate 081	H11			AU174008	AU174009			21	O21
7968	g_7968	SS5084	">D90899_4(D90899|pid:g1651654) Synechocystis sp. PCC6803 complete   genome, 1/27, 1-133859; ORF_ID:sll0558. &S74430(S74430)   "	DPlate 083	H11			D48705	AU101810			21	P21
7969	g_7969	SS6076	">AB000801_1(AB000801|pid:g1816444) Oryza sativa mRNA for chalcone   synthase, complete cds. "	DPlate 085	A05			AU032899				22	A09
7970	g_7970	ST0815	">ATF4I10_17(AL035525|pid:g4455338) Arabidopsis thaliana DNA chromosome   4, BAC clone F4I10 (ESSAII project); similarity to FAB1   protein, Saccharomyces cerevisiae, PIR2:S56274. "	DPlate 087	A05			D39468	AU161577			22	B09
7971	g_7971	SS6061	">ATU63815_6(U63815|pid:g1532168) Arabidopsis thaliana AT.I.24-1,   AT.I.24-2, AT.I.24-3, AT.I.24-4, AT.I.24-5, AT.I.24-6,   AT.I.24-9 and AT.I.24-14 genes, partial cds, AT.I.24-7,   ascorbate peroxidase (ATHAPX1), EF-1alpha-A1, -A2 and   -A3 (EF-1alpha) and AT.I.24-13 genes, complete cds;   localized according to blastn similarity to EST   sequences; therefore, the coding span corresponds only   to an area of similarity since the initation codon and   stop codon could not be precisely determined. "	DPlate 085	B05			AU070466				22	C09
7972	g_7972	ST0831	">RPXX03_35(AJ235272|pid:g3861068) Rickettsia prowazekii strain   Madrid E, complete genome; segment 3/4. "	DPlate 087	B05			D39478	AU174163			22	D09
7973	g_7973	SS6030		DPlate 085	C05			C24872	AU101848			22	E09
7974	g_7974	ST0855	">AF062072_1(AF062072|pid:g3668066) Homo sapiens zinc finger protein   216 (ZNF216) gene, complete cds.   &AF062346_1(AF062346|pid:g3643809)   &AF062347_1(AF062347|pid:g3643811) "	DPlate 087	C05			D39489	AU175152			22	F09
7975	g_7975	SS6038	>ATNAP16KD_1(Z96936|pid:g2765837) Arabidopsis thaliana mRNA for   nitrilase associated protein NAP16kDa; pos. 112 to 116   sequence identity to nitrilase isoform 1 and 2. 	DPlate 085	D05			AU174105	AU174106			22	G09
7976	g_7976	ST0871	">ATAC006836_18(AC006836|pid:g4406767) Arabidopsis thaliana   chromosome II BAC F19B11 genomic sequence, complete   sequence; "	DPlate 087	D05			AU174168	AU174169			22	H09
7977	g_7977	SS6054		DPlate 085	E05			AU070464				22	I09
7978	g_7978	ST0895	>EPRZ(S06427)phospholipid transfer protein homolog - rice 	DPlate 087	E05			AU174173	AU174174			22	J09
7979	g_7979	SS6094	>S70489(S70489)photosystem II protein X precursor - Arabidopsis   thaliana 	DPlate 085	F05			AU163131	AU174113			22	K09
7980	g_7980	ST0824		DPlate 087	F05			D39474	AU032997			22	L09
7981	g_7981	SS6023		DPlate 085	G05			AU162105	AU162106			22	M09
7982	g_7982	ST0888		DPlate 087	G05			D39507	AU175154			22	N09
7983	g_7983	SS6031	">ATAC005917_5(AC005917|pid:g4191775) Arabidopsis thaliana chromosome   II BAC F3P11 genomic sequence, complete sequence; "	DPlate 085	H05			AU065939	AU101849			22	O09
7984	g_7984	ST0896	">SPAC19A8_12(Z98974|pid:g2388911) S.pombe chromosome I cosmid c19A8;   SPAC19A8.12, unknown, len:741aa, similar eg. to YNL118C,   PSU1_YEAST, P53550, involved in respiration, (970aa),   fasta scores, opt:776, E():0, (29.1% identity in 784 aa   overlap), contains PS00893 mutT domain signature. "	DPlate 087	H05			D39512	AU174175			22	P09
7985	g_7985	SS6330	">ATT16H5_5(AL024486|pid:g3250678) Arabidopsis thaliana DNA   chromosome 4, BAC clone T16H5 (ESSAII project);   &ATU27590_1(U27590|pid:g1353266) "	DPlate 085	A11			D49213	AU174128			22	A21
7986	g_7986	ST1008	">AC000103_18(AC000103|pid:g2213626) Genomic sequence for Arabidopsis   thaliana BAC F21J9, complete sequence; weak similarity   to C3HC4 zinc finger. "	DPlate 087	A11			D39562	AU033011			22	B21
7987	g_7987	SS6346		DPlate 085	B11			D49224	AU101861			22	C21
7988	g_7988	ST1016		DPlate 087	B11			D39563	AU033012			22	D21
7989	g_7989	SS6363	">HUMNFE1YYD_1(M76541|pid:g189174) Human DNA-binding protein (NF-E1)   mRNA, complete cds; 'Coding region of NF-E1 (YY-1,   delta)'. "	DPlate 085	C11			AU161478				22	E21
7990	g_7990	ST1024	>ZMB3TUB_1(X74654|pid:g398845) Z.mays mRNA for beta 3 tubulin. 	DPlate 087	C11			D39565	AU174186			22	F21
7991	g_7991	SS6379		DPlate 085	D11			D49239	AU101865			22	G21
7992	g_7992	ST1032		DPlate 087	D11			AU097015				22	H21
7993	g_7993	SS6316	">AF058391_1(AF058391|pid:g3063661) Arabidopsis thaliana nucleoside   diphosphate kinase Ia mRNA, complete cds; NDPK Ia. "	DPlate 085	E11			D49204	AU174125			22	I21
7994	g_7994	ST1072		DPlate 087	E11			AU033016	C23620			22	J21
7995	g_7995	SS6509	">A43932(A49963;A45106;B45106;A43932;B33532;A61257;PQ0328;)mucin 2   precursor, intestinal - human (fragments) "	DPlate 085	F11			D49299	AU101878			22	K21
7996	g_7996	ST1080	>AF058914_8(AF058914|pid:g3047082) Arabidopsis thaliana BAC F21E10;   similar to Vigna radiata pectinacetylesterase precursor   (GB:X99348). 	DPlate 087	F11			AU161590	AU161589			22	L21
7997	g_7997	SS6541	>S60892(S60892) nucleosome assembly protein 1 - soybean   &SOYSNAP_1(L38856|pid:g1161252) 	DPlate 085	G11			D49319				22	M21
7998	g_7998	ST1133	">ATF9D16_10(AL035394|pid:g4454032) Arabidopsis thaliana DNA   chromosome 4, BAC clone F9D16 (ESSAII project);   similarity to chS-Rex-b - Gallus gallus (chicken),   gb:L10333; contains EST gb:W43040, N65866, Aa597867,   H76040, Aa712824, T76206, Z30846. "	DPlate 087	G11			AU174200	AU174201			22	N21
7999	g_7999	SS6581	">HVJ222779_1(AJ222779|pid:g2695931) Hordeum vulgare mRNA for   hypothetical protein, clone RG49; homology to   hypothetical cyanobacterial proteins. "	DPlate 085	H11			D49342	AU101885			22	O21
8000	g_8000	ST1118	>HSNC2ALPH_1(X96506|pid:g1491710) H.sapiens mRNA for NC2 alpha   subunit; alpha subunit; forms heterodimer with NC.   &S70618(S70618) 	DPlate 087	H11			D39607	AU161597			22	P21
8001	g_8001	ST2576	>(Q09909) HYPOTHETICAL 74.4 KD PROTEIN C30D11.09 IN CHROMOSOME I.   &S62567(S62567) &SPAC30D11_9(Z67961|pid:g1065896) 	DPlate 089	A05			D40531				23	A09
8002	g_8002	ST4376	">F5O8_30(AC005990|pid:g4056457) Arabidopsis thaliana chromosome 1   BAC F5O8 sequence, complete sequence; ESTs gb|234051 and   gb|F13722 come from this gene.. "	DPlate 091	A05			D41704	AU174334			23	B09
8003	g_8003	ST2505	">SPAC2C4_11(Z99259|pid:g2414622) S.pombe chromosome I cosmid c2C4;   SPAC2C4.11c, len:258aa; similarity eg. to YOR3513C,   Q02462, unclassified protein, (218aa), fasta scores,   opt:966, E():0, (72.7% identity in 205 aa overlap). "	DPlate 089	B05			D40483	AU174253			23	C09
8004	g_8004	ST4305	>(P40954) CHITINASE 3 PRECURSOR (EC 3.2.1.14).   &CAU15801_1(U15801|pid:g571429) 	DPlate 091	B05			AU033160				23	D09
8005	g_8005	ST2513	>LEAJ5077_1(AJ005077|pid:g3201541) Lycopersicon esculentum mRNA for   protein kinase TCTR2. 	DPlate 089	C05			D40490	AU174255			23	E09
8006	g_8006	ST4313		DPlate 091	C05			AU033163				23	F09
8007	g_8007	ST2521	">ATAC002505_2(AC002505|pid:g3075382) Arabidopsis thaliana chromosome   II BAC T9J22 genomic sequence, complete sequence;   &ATAC004484_1(AC004484|pid:g3075384) "	DPlate 089	D05			D40496	AU174257			23	G09
8008	g_8008	ST4337		DPlate 091	D05			AU033169				23	H09
8009	g_8009	ST2545	>(Q59007) HYPOTHETICAL PROTEIN MJ1612. &C64501(C64501)   &U67601_6(U67601|pid:g1592213) 	DPlate 089	E05			C23634				23	I09
8010	g_8010	ST4345	">ATAC005700_24(AC005700|pid:g3831470) Arabidopsis thaliana   chromosome II BAC T32F6 genomic sequence, complete   sequence; unknown protein, 3' partial. "	DPlate 091	E05			D41686	AU097377			23	J09
8011	g_8011	ST2553		DPlate 089	F05			AU174261				23	K09
8012	g_8012	ST4353	">ATAC005700_24(AC005700|pid:g3831470) Arabidopsis thaliana   chromosome II BAC T32F6 genomic sequence, complete   sequence; unknown protein, 3' partial. "	DPlate 091	F05			D41689				23	L09
8013	g_8013	ST2569	>S06475(S06475;A33246;JQ0156)phenylalanine ammonia-lyase (EC   4.3.1.5) - rice 	DPlate 089	G05			D40527	AU108308			23	M09
8014	g_8014	ST4361		DPlate 091	G05			D41695	AU174327			23	N09
8015	g_8015	ST2593	>AF061282_6(AF061282|pid:g4539666) Sorghum bicolor 22 kDa kafirin   cluster; 	DPlate 089	H05			D40542	AU101952			23	O09
8016	g_8016	ST4393	">AF049066_1(AF049066|pid:g2935523) Pinus radiata 21 kD protein   precursor (PRE79) mRNA, complete cds. "	DPlate 091	H05			D41716	AU101998			23	P09
8017	g_8017	ST3049		DPlate 089	A11			AU174280				23	A21
8018	g_8018	ST5159	">AE001390_3(AE001390|pid:g3845167) Plasmodium falciparum chromosome   2, section 27 of 73 of the complete sequence; predicted   by GlimmerM. "	DPlate 091	A11			C25073	AU174350			23	B21
8019	g_8019	ST3018		DPlate 089	B11			AU174278				23	C21
8020	g_8020	ST5104		DPlate 091	B11			AU102011	AU102012			23	D21
8021	g_8021	ST3050		DPlate 089	C11			AU097233				23	E21
8022	g_8022	ST5120	">PCU56834_1(U56834|pid:g1432056) Petroselinum crispum DNA binding   protein WRKY3 mRNA, complete cds; WRKY-type DNA-binding   protein. &S72445(S72445) "	DPlate 091	C11			AU161705				23	F21
8023	g_8023	ST3003	">ATAC005313_4(AC005313|pid:g3548801) Arabidopsis thaliana chromosome   II BAC T18E12 genomic sequence, complete sequence;   &ATAC006284_27(AC006284|pid:g4335768) "	DPlate 089	D11			AU163224	AU058106			23	G21
8024	g_8024	ST5168		DPlate 091	D11			AU181051				23	H21
8025	g_8025	ST3027	>RNY15748_1(Y15748|pid:g2665356) Rattus norvegicus mRNA for PkB   kinase. 	DPlate 089	E11			D40851	C22679			23	I21
8026	g_8026	ST5184	>S61830(S61830;S65863;S60458;S37493;S44238;S49477)   subtilisin/chymotrypsin inhibitor - maize   &ZMCIMS_1(X69972|pid:g475922)   &ZMMPI_1(X78988|pid:g475253)   &ZMPIS7_1(X82187|pid:g559538) 	DPlate 091	E11			AU066141	AU097480			23	J21
8027	g_8027	ST3043	">RNU46007_1(U46007|pid:g3320122) Rattus norvegicus espin mRNA,   complete cds; contains 8 ankyrin-like repeats in the   amino-terminal third, which are most similar to the   ankyrin-like repeats of the Drosophila forked gene large   protein. "	DPlate 089	F11			D40865	AU090583			23	K21
8028	g_8028	ST5192		DPlate 091	F11			AU181052				23	L21
8029	g_8029	ST3059	>(P33126) HEAT SHOCK PROTEIN 82. &OSHSP82A_1(Z11920|pid:g20256)   &S25541(S25541;S25542) 	DPlate 089	G11			D40879	AU174281			23	M21
8030	g_8030	ST5145		DPlate 091	G11			AU161717				23	N21
8031	g_8031	ST3077	">ATFCA8_52(Z97343|pid:g2245125) Arabidopsis thaliana DNA chromosome   4, ESSA I contig fragment No. 8; similarity to   globulin-1O, GLB1O - maize. &F71446(F71446) "	DPlate 089	H11			D40894	AU174283			23	O21
8032	g_8032	ST5153	">HUMORF006_1(D38552|pid:g559713) Human mRNA for KIAA0073 gene,   partial cds; The ha1539 protein is related to   cyclophilin.. "	DPlate 091	H11			AU066135	AU102015			23	P21
8033	g_8033	ST6181		DPlate 093	A05			AU102058				24	A09
8034	g_8034	posi33		DPlate 094	H12							24	B09
8035	g_8035	ST6102		DPlate 093	B05			AU161845				24	C09
8036	g_8036	posi34										24	D09
8037	g_8037	ST6110		DPlate 093	C05			AU102039	AU102040			24	E09
8038	g_8038	posi35										24	F09
8039	g_8039	ST6126		DPlate 093	D05			AU174387				24	G09
8040	g_8040	posi36										24	H09
8041	g_8041	ST6174		DPlate 093	E05			AU078168				24	I09
8042	g_8042	posi37										24	J09
8043	g_8043	ST6119	">ATT5L19_11(AL049481|pid:g4539001) Arabidopsis thaliana DNA chromosome   4, BAC clone T5L19 (ESSA project); similarity to m6A   methyltransferase - Homo sapiens, PID:g2460037; Contains   N-6 Adenine-specific DNA methylases signature [ILVDPPW]. "	DPlate 093	F05			AU082103	AU082104			24	K09
8044	g_8044	posi38										24	L09
8045	g_8045	ST6127	">HSU85429_1(U85429|pid:g1835589) Human transcription factor NFATx3   mRNA, complete cds; isoform of NFATx. "	DPlate 093	G05			AU102049	AU102050			24	M09
8046	g_8046	posi39										24	N09
8047	g_8047	ST6143		DPlate 093	H05			AU176554				24	O09
8048	g_8048	posi40										24	P09
8049	g_8049	ST6296		DPlate 093	A11			AU058148				24	A21
8050	g_8050	no clone										24	B21
8051	g_8051	ST6317	">T31J12_3(AC006416|pid:g4337175) Arabidopsis thaliana chromosome 1   BAC T31J12 sequence, complete sequence; ESTs gb|T20589,   gb|T04648, gb|AA597906, gb|T04111, gb|R84180, gb|R65428,   gb|T44439, gb|T76570, gb|R90004, gb|T45020, gb|T42457,   gb|T20921, gb|AA042762 and gb|AA720210 come from this   gene.. "	DPlate 093	B11			C25413	AU174404			24	C21
8052	g_8052	no clone										24	D21
8053	g_8053	ST6381	">AB002820_1(AB002820|pid:g1944205) Oryza sativa mRNA for RicMT,   complete cds. "	DPlate 093	C11			AU174411	AU174412			24	E21
8054	g_8054	no clone										24	F21
8055	g_8055	ST6302	">F17O7_13(AC003671|pid:g3176684) Arabidopsis thaliana chromosome 1   BAC F17O7 complete sequence; Contains similarity to   equilibratiave nucleoside transporter 1 gb|U81375 from   Homo sapiens. ESTs gb|N65317, gb|T20785, gb|AA586285   and gb|AA712578 come from this gene.. "	DPlate 093	D11			AU174400	AU174401			24	G21
8056	g_8056	no clone										24	H21
8057	g_8057	ST6310		DPlate 093	E11			C25412	AU174403			24	I21
8058	g_8058	no clone										24	J21
8059	g_8059	ST6359	">D78336_2(D78336|pid:g1877026) Rice mitochondrial DNA for ribosomal   protein L2, ribosomal protein S19, complete cds. "	DPlate 093	F11			AU161915				24	K21
8060	g_8060	no clone										24	L21
8061	g_8061	ST6367		DPlate 093	G11			C25427	AU174409			24	M21
8062	g_8062	no clone										24	N21
8063	g_8063	ST6383	">ATF14M19_3(AL049480|pid:g4539293) Arabidopsis thaliana DNA   chromosome 4, BAC clone F14M19 (ESSA project);   similarity to Bactrocera tryoni membrane transporter   (white) gene, PID:g3676298; Contains ABC transporters   family signature [LSGGERRRVSIGLSL]. "	DPlate 093	H11			AU033292				24	O21
8064	g_8064	no clone										24	P21
8065	g_8065	EG0569		DPlate 050	A05			AU030056	AU030057			13	A10
8066	g_8066	EH0081	>OSR40G3_1(Y08988|pid:g1658315) O.sativa osr40g3 gene. 	DPlate 052	A05			AU030666	AU030667			13	B10
8067	g_8067	EG0506		DPlate 050	B05			AU076190	AU076191			13	C10
8068	g_8068	EH0010	>NTENVMEMP_1(X94968|pid:g1419090) N.tabacum mRNA for 37kDa   chloroplast inner envelope membrane polypeptide. 	DPlate 052	B05			AU162303	AU030611			13	D10
8069	g_8069	EG0514	>(P48006) ELONGATION FACTOR 1-BETA A1 (EF-1-BETA).   &ATL1BETA_1(X74733|pid:g398608) &S37103(S37103) 	DPlate 050	C05			AU065602	AU030024			13	E10
8070	g_8070	EH0074	>(Q63009) PROTEIN ARGININE N-METHYLTRANSFERASE 1 (EC 2.1.1.-).   &RNU60882_1(U60882|pid:g1390025) 	DPlate 052	C05			AU162309	AU030662			13	F10
8071	g_8071	EG0522	>(P46294) 40S RIBOSOMAL PROTEIN S16.   &RICRPSAAA_1(L36313|pid:g538428) 	DPlate 050	D05			AU030029	AU030030			13	G10
8072	g_8072	EH0067		DPlate 052	D05			AU164702	AU030658			13	H10
8073	g_8073	EG0562	">ATAC004136_18(AC004136|pid:g3184288) Arabidopsis thaliana   chromosome II BAC T8K22 genomic sequence, complete   sequence; unknown protein. "	DPlate 050	E05			AU166194	AU030054			13	I10
8074	g_8074	EH0075	">ATT4L20_3(AL023094|pid:g3641837) Arabidopsis thaliana DNA   chromosome 4, BAC clone T4L20 (ESSAII project); strong   similarity to coat protein gamma-cop, Bos primigenius;   Contains 2-oxo acid dehydrogenases acyltransferase   component lipoyl binding site, Lipoyl   [NPVVSSAALVSGLHLLKTNPQIVKRWSNEV]; contains EST   gb:AA395649, N96014, H36940, R90482, AA042453, T43773,   R90315, T46306, T75984. "	DPlate 052	E05			AU162310	AU030663			13	J10
8075	g_8075	EG0570	>S52511(S52511;S67540) hypothetical protein YDL008w - yeast   (Saccharomyces cerevisiae)   &SCCHRIV42_20(Z48432|pid:g683689)   &SCYDL008W_2(Z74056|pid:g1430969) 	DPlate 050	F05			AU065611	AU030058			13	K10
8076	g_8076	EH0083		DPlate 052	F05			AU030668				13	L10
8077	g_8077	EG0578	">RNU37486_1(U37486|pid:g1592545) Rattus norvegicus peroxisomal   multifunctional enzyme type II mRNA, complete cds. "	DPlate 050	G05			AU065614	AU030065			13	M10
8078	g_8078	EH0045	">ATAF001308_4(AF001308|pid:g3912919) Arabidopsis thaliana BAC T10M13   from chromosome IV, from 10.8 cM to 11.6 cM, complete   sequence; similar to C. elegans protein B0414.8, GenBank   accession number 2088768; functional catalog ID=99. "	DPlate 052	G05			AU030639	AU030640			13	N10
8079	g_8079	EG0507	">MCU73467_1(U73467|pid:g1657950) Mesembryanthemum crystallinum water   channel protein MipE mRNA, complete cds. "	DPlate 050	H05			AU058335				13	O10
8080	g_8080	EH0077		DPlate 052	H05			AU162311	AU030664			13	P10
8081	g_8081	EG0718		DPlate 050	A11			AU065635	AU030174			13	A22
8082	g_8082	EH0188		DPlate 052	A11			AU165876	AU165877			13	B22
8083	g_8083	EG0750	">AB004568_1(AB004568|pid:g2285792) Arabidopsis thaliana mRNA for   cyanase, complete cds; cyanate lyase.   &AB015748_1(AB015748|pid:g3287503) "	DPlate 050	B11			AU030200	AU101478			13	C22
8084	g_8084	EH0225	">AB002266_1(AB002266|pid:g2943742) Oryza sativa mRNA for XA1,   complete cds. "	DPlate 052	B11			AU030778	AU030779			13	D22
8085	g_8085	EG0758	>(Q01292) KETOL-ACID REDUCTOISOMERASE PRECURSOR (EC 1.1.1.86)   (ACETOHYDROXY-ACID REDUCTOISOMERASE)   (ALPHA-KETO-BETA-HYDROXYLACIL REDUCTOISOMERASE).   &S17180(S17180;S23644) &SOAHRI_1(X57073|pid:g21234) 	DPlate 050	C11			AU065645	AU030206			13	E22
8086	g_8086	EH0249		DPlate 052	C11			AU030794	AU091421			13	F22
8087	g_8087	EG0774	>T15F16_13(AF076275|pid:g3377813) Arabidopsis thaliana BAC T15F16;   coded for by A. thaliana cDNA N97271. 	DPlate 050	D11			AU166205	AU058382			13	G22
8088	g_8088	EH0210		DPlate 052	D11			AU162318	AU030767			13	H22
8089	g_8089	EG0727		DPlate 050	E11			AU030183	AU030184			13	I22
8090	g_8090	EH0211		DPlate 052	E11			AU030768				13	J22
8091	g_8091	EG0767		DPlate 050	F11			AU162292	AU030212			13	K22
8092	g_8092	EH0219		DPlate 052	F11			C74834				13	L22
8093	g_8093	EG0744	">ATAC004005_10(AC004005|pid:g3212854) Arabidopsis thaliana   chromosome II BAC F6E13 genomic sequence, complete   sequence; unknown protein. "	DPlate 050	G11			AU065641	AU030195			13	M22
8094	g_8094	EH0251		DPlate 052	G11			AU091422				13	N22
8095	g_8095	EG0752	">ATAP22_12(Z99708|pid:g2464905) Arabidopsis thaliana DNA chromosome   4, ESSA I AP2 contig fragment No. 2; strong similarity   to minor allergen, Alternaria alternata, PIR2:S43111;   contains EST gb:R64949, AA651052. "	DPlate 050	H11			AU172965	AU058378			13	O22
8096	g_8096	EH0283		DPlate 052	H11			AU095156	AU030816			13	P22
8097	g_8097	EH0858	">AF043538_1(AF043538|pid:g3421123) Arabidopsis thaliana 20S   proteasome beta subunit PBG1 (PBG1) mRNA, complete cds. "	DPlate 054	A05			AU165944	AU031118			14	A10
8098	g_8098	EH1594		DPlate 056	A05			AU031453	AU031454			14	B10
8099	g_8099	EH0866	>(P48578) SERINE/THREONINE PROTEIN PHOSPHATASE PP2A-4 CATALYTIC   SUBUNIT (EC 3.1.3.16). &ATU08047_1(U08047|pid:g473259)   &ATU60136_1(U60136|pid:g4204949) &S52660(S52660) 	DPlate 054	B05			AU065236	AU101516			14	C10
8100	g_8100	EH1507		DPlate 056	B05			AU095351	AU031405			14	D10
8101	g_8101	EH0843	">ATAC006439_9(AC006439|pid:g4309728) Arabidopsis thaliana chromosome   II BAC T30D6 genomic sequence, complete sequence; "	DPlate 054	C05			AU162329	AU031114			14	E10
8102	g_8102	EH1539	>S06475(S06475;A33246;JQ0156)phenylalanine ammonia-lyase (EC   4.3.1.5) - rice 	DPlate 056	C05			AU031420				14	F10
8103	g_8103	EH0851	>(Q01899) MITOCHONDRIAL HEAT SHOCK 70 KD PROTEIN PRECURSOR.   &PV70HSP_1(X66874|pid:g22636) &S25005(S25005) 	DPlate 054	D05			AU101509	AU101510			14	G10
8104	g_8104	EH1595	>(Q42876) CHLOROPLAST AMINOPEPTIDASE 1 PRECURSOR (EC 3.4.11.1)   (LEUCINE AMINOPEPTIDASE) (LAP) (LEUCYL AMINOPEPTIDASE)   (PROLINE AMINOPEPTIDASE) (EC 3.4.11.5) (PROLYL   AMINOPEPTIDASE). &S57812(S57812)   &SLU20594_1(U20594|pid:g924630) 	DPlate 056	D05			AU095379	AU031455			14	H10
8105	g_8105	EH0859		DPlate 054	E05			AU173027				14	I10
8106	g_8106	EH1572		DPlate 056	E05			AU031436	AU031437			14	J10
8107	g_8107	EH0867	>CELC32D5_11(U23511|pid:g746475) Caenorhabditis elegans cosmid   C32D5; coded for by C. elegans cDNA yk3a6.5; coded for   by C. elegans cDNA yk3a6.3; coded for by C. elegans cDNA   yk19e9.3. 	DPlate 054	F05			AU101517	AU101518			14	K10
8108	g_8108	EH1580	">ATAC006234_18(AC006234|pid:g4454464) Arabidopsis thaliana   chromosome II BAC F5H14 genomic sequence, complete   sequence; unknown protein. "	DPlate 056	F05			AU065315	AU101551			14	L10
8109	g_8109	EH0875	">AF017777_12(AF017777|pid:g3004658) Drosophila melanogaster tweety   (tty), flightless (fli), dodo (dod), penguin (pen),   small optic lobes (sol), innocent bystander (iby),   waclaw (waw), bobby sox (bbx), sluggish (slg), helicase   (hlc), misato (mst), and la costa (lcs) genes, complete   cds; "	DPlate 054	G05			AU065240	AU165946			14	M10
8110	g_8110	EH1588	">(P29685) ATP SYNTHASE BETA CHAIN, MITOCHONDRIAL PRECURSOR (EC   3.6.1.34). &HBATPB_1(X58498|pid:g18831) &S20504(S20504)   "	DPlate 056	G05			AU095377	AU031451			14	N10
8111	g_8111	EH0891		DPlate 054	H05			C74920	AU173031			14	O10
8112	g_8112	EH1625		DPlate 056	H05			AU101556	AU101557			14	P10
8113	g_8113	EH0908	">CEF55B11_3(Z83318|pid:g3877698) Caenorhabditis elegans cosmid   F55B11, complete sequence; predicted using Genefinder;   cDNA EST yk369e7.5 comes from this gene. "	DPlate 054	A11			C74923				14	A22
8114	g_8114	EH1755	>(P17784) FRUCTOSE-BISPHOSPHATE ALDOLASE (EC 4.1.2.13).   &ADRZY(JQ0543) &OSFBPA_1(X53130|pid:g20204) 	DPlate 056	A11			AU031505				14	B22
8115	g_8115	EH0916	>OSR40G2_1(Y08987|pid:g1658313) O.sativa osr40g2 gene. 	DPlate 054	B11			C74925	AU173032			14	C22
8116	g_8116	EH1771	">ATFCA2_36(Z97337|pid:g2244865) Arabidopsis thaliana DNA chromosome   4, ESSA I contig fragment No. 2; similarity to   hypothetical protein ZK757.1 - Caenorhabditis elegans.   &E71414(E71414) "	DPlate 056	B11			AU164915	AU031517			14	D22
8117	g_8117	EH0932		DPlate 054	C11			C74928				14	E22
8118	g_8118	EH1787		DPlate 056	C11			AU031527				14	F22
8119	g_8119	EH0948		DPlate 054	D11			AU173035	AU031129			14	G22
8120	g_8120	EH1732		DPlate 056	D11			AU164898				14	H22
8121	g_8121	EH0956		DPlate 054	E11			AU164716	AU031132			14	I22
8122	g_8122	EH1740	">ATAC005170_11(AC005170|pid:g3738322) Arabidopsis thaliana   chromosome II BAC T29E15 genomic sequence, complete   sequence; "	DPlate 056	E11			AU164902	AU031497			14	J22
8123	g_8123	EH1033		DPlate 054	F11			AU077722	AU077723			14	K22
8124	g_8124	EH1764	">HSAJ4162_1(AJ224162|pid:g2897595) Homo sapiens mRNA for putative   lipoic acid synthetase, partial; putative. "	DPlate 056	F11			AU101578				14	L22
8125	g_8125	EH1041		DPlate 054	G11			AU101529	AU101530			14	M22
8126	g_8126	EH1772	">AC005106_9(AC005106|pid:g3935145) Genomic sequence for Arabidopsis   thaliana BAC T25N20, complete sequence; similar to lipid   transfer protein (AB007843). "	DPlate 056	G11			AU090567	AU090568			14	N22
8127	g_8127	EH1065		DPlate 054	H11			AU173039	AU173040			14	O22
8128	g_8128	EH1780	>(P42791) 60S RIBOSOMAL PROTEIN L18.   &ATU15741_1(U15741|pid:g606970) 	DPlate 056	H11			AU164919	AU031524			14	P22
8129	g_8129	FE0209	">AF063901_1(AF063901|pid:g3288821) Arabidopsis thaliana   alanine:glyoxylate aminotransferase (AGT) mRNA, complete   cds; transaminase. "	DPlate 058	A05			AU174684	AU174685			15	A10
8130	g_8130	FL0160	">ATHGTPBPA_1(L38614|pid:g807577) Arabidopsis thaliana GTP-binding   protein mRNA, complete cds. &S59558(S59558) "	DPlate 060	A05			AU175009	AU175008			15	B10
8131	g_8131	FE0233		DPlate 058	B05			AU174703				15	C10
8132	g_8132	FL0168	">HMU85806_1(U85806|pid:g1923252) Hirudo medicinalis SNAP-25 homolog   mRNA, complete cds; 23.8 kda membrane-associated   protein. "	DPlate 060	B05			AU175017	AU175018			15	D10
8133	g_8133	FE0249	>AE000741_4(AE000741|pid:g2983845) Aquifex aeolicus section 73 of   109 of the complete genome. &B70426(B70426) 	DPlate 058	C05			AU174712	AU174711			15	E10
8134	g_8134	FL0184	">ANAPATBA_2(L06674|pid:g142068) Anabaena sp. patB and ORF2 genes,   complete cds; ORF2. "	DPlate 060	C05			AU175038	AU175037			15	F10
8135	g_8135	FE0257	">T22H22_2(AC005388|pid:g3776557) Sequence of BAC T22H22 from   Arabidopsis thaliana chromosome 1, complete sequence;   Contains similarity to gi|2924495 hypothetical protein   Rv1920 from Mycobacterium tuberculosis genome   gb|AL022020.. "	DPlate 058	D05			AU174716	AU174715			15	G10
8136	g_8136	FL0113	">ATAC003058_19(AC003058|pid:g3135269) Arabidopsis thaliana chromosome   II BAC F27F23 genomic sequence, complete sequence;   unknown protein. "	DPlate 060	D05			AU174972	AU174973			15	H10
8137	g_8137	FE0281		DPlate 058	E05			AU174730				15	I10
8138	g_8138	FL0121	>(P01015) ANGIOTENSINOGEN PRECURSOR. &ANRT(A93945;A90456;A01251)   &RATANG5_1(L00094|pid:g202914) 	DPlate 060	E05			AU174981	AU174980			15	J10
8139	g_8139	FE0289	">ATM3E9_4(AL022223|pid:g2982453) Arabidopsis thaliana DNA chromosome   4, BAC clone M3E9 (ESSA project); strong similarity to   fructose-bisphosphate aldolase, Arabidopsis thaliana,   PIR1:ADMU; Contains Fructose-bisphosphate aldolase   class-I active site, [VLLEGTLLKPN]. "	DPlate 058	F05			AU174738	AU174737			15	K10
8140	g_8140	FL0169	">AF004358_1(AF004358|pid:g2190992) Aegilops squarrosa glutathione   S-transferase TSI-1 mRNA, complete cds; GST isozyme. "	DPlate 060	F05			AU175019				15	L10
8141	g_8141	FE0202	">AP000002_62(AP000002|pid:g3256770) Pyrococcus horikoshii OT3   genomic DNA, 287001-544000 nt. position (2/7); similar   to PIR:S44960 percent identity:40.645 in 320aa;   PIR:S69807 percent identity:41.100 in 319aa;   owl:MTY13D1217 percent identity:39.171 in 224aa.   &H71145(H71145) "	DPlate 058	G05			AU174678	AU174679			15	M10
8142	g_8142	FL0177	">ATF1C12_6(AL022224|pid:g2982431) Arabidopsis thaliana DNA   chromosome 4, BAC clone F1C12 (ESSAII project);   similarity to Cf-2.2, Solanum pimpinellifolium,   PATCHX:G1184077; contains EST gb:Z38045, Z46532. "	DPlate 060	G05			AU175029	AU175030			15	N10
8143	g_8143	FE0210	>(P22564) HYPOTHETICAL 32.6 KD PROTEIN IN LYTB-DAPB INTERGENIC   REGION. &AE000113_8(AE000113|pid:g1786213)   &ECLSPDAP_4(X54945|pid:g41934)   &ECO110K_23(D10483|pid:g216457)   &JE0404(JE0404;S40553;F64723;S22291) 	DPlate 058	H05			AU174686	AU174687			15	O10
8144	g_8144	FL0193	">ATF1C12_6(AL022224|pid:g2982431) Arabidopsis thaliana DNA chromosome   4, BAC clone F1C12 (ESSAII project); similarity to   Cf-2.2, Solanum pimpinellifolium, PATCHX:G1184077;   contains EST gb:Z38045, Z46532. "	DPlate 060	H05			AU175043	AU175044			15	P10
8145	g_8145	FE0303		DPlate 058	A11			AU174745	AU174744			15	A22
8146	g_8146	RA0173	">ATAC006260_3(AC006260|pid:g4371280) Arabidopsis thaliana chromosome   II BAC T2N18 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 060	A11			D23795	AU101598			15	B22
8147	g_8147	FE0335	">ATHCDPKA_1(D21805|pid:g604880) Arabidopsis thaliana mRNA for   calcium-dependent protein kinase (CDPK), complete cds.   &S46283(S46283) "	DPlate 058	B11			AU174767	AU174766			15	C22
8148	g_8148	RA0189	>HVHVST1_1(X96431|pid:g1217967) H.vulgare mRNA for high affinity   sulphate transporter. 	DPlate 060	B11			AU164513	AU164514			15	D22
8149	g_8149	FE0343		DPlate 058	C11			AU174772				15	E22
8150	g_8150	RA0111	">D88272_1(D88272|pid:g4062934) Hordeum vulgare mRNA for formate   dehydrogenase, complete cds. "	DPlate 060	C11			D23770	AU031643			15	F22
8151	g_8151	FE0359		DPlate 058	D11			AU174783				15	G22
8152	g_8152	RA0119		DPlate 060	D11			D23772	AU173062			15	H22
8153	g_8153	FE0375	">ATF24A6_1(AL035396|pid:g4454005) Arabidopsis thaliana DNA   chromosome 4, BAC clone F24A6 (ESSAII project);   contains EST gb:Z27009, Z33752. "	DPlate 058	E11			AU174795	AU174794			15	I22
8154	g_8154	RA0135	">ATU18126_1(U18126|pid:g603056) Arabidopsis thaliana inner   mitochondrial membrane protein mRNA, complete cds.   &S71194(S71194) "	DPlate 060	E11			D23780	AU101596			15	J22
8155	g_8155	FE0320	">AF120334_1(AF120334|pid:g4191616) Homo sapiens GTP-binding protein   NGB mRNA, complete cds. "	DPlate 058	F11			AU174753	AU174754			15	K22
8156	g_8156	RA0151		DPlate 060	F11			AU176500				15	L22
8157	g_8157	FE0328		DPlate 058	G11			AU174762				15	M22
8158	g_8158	RA0160		DPlate 060	G11			D23790	AU078033			15	N22
8159	g_8159	FE0352	">AC002130_9(AC002130|pid:g2760324) The sequence of BAC F1N21 from   Arabidopsis thaliana chromosome 1, complete sequence;   similar to EST gb|T75851. "	DPlate 058	H11			AU174776	AU174775			15	O22
8160	g_8160	RA0113		DPlate 060	H11			AU101594				15	P22
8161	g_8161	RA0701		DPlate 062	A05			D23974	AU101631			16	A10
8162	g_8162	RA1645		DPlate 064	A05			AU173187	AU173188			16	B10
8163	g_8163	RA0757	">ATAC006135_14(AC006135|pid:g4218014) Arabidopsis thaliana   chromosome II BAC F24H14 genomic sequence, complete   sequence; "	DPlate 062	B05			AU173105	AU173106			16	C10
8164	g_8164	RA1669	">A54250(A54250)microsomal flavin monooxygenase third form, FMO3 -   rabbit "	DPlate 064	B05			AU173204	AU173205			16	D10
8165	g_8165	RA0758	">ATF19H22_21(AL035679|pid:g4539330) Arabidopsis thaliana DNA   chromosome 4, BAC clone F19H22 (ESSA project); strong   similarity to receptor-like protein kinase -   Catharanthus roseus (Madagascar periwinkle),   PID:e249980; Contains Protein kinases signatures and   profile, Protein_Kinase_Atp [IGVGGFGNVYIGTLDDGTKVAVK],   Protein_Kinase_St [IIHRDVKSTNILL]. "	DPlate 062	C05			D23998	C22581			16	E10
8166	g_8166	RA1606		DPlate 064	C05			D24262	C20486			16	F10
8167	g_8167	RA0703	">AF000939_1(AF000939|pid:g2150000) Hordeum vulgare aleurone   ribonuclease mRNA, partial cds; BAR-1; expression   induced by gibberellins; expressed in aleurone and not   in leaf; contains unique 23 amino acid insert not found   in other ribonucleases. "	DPlate 062	D05			AU164606	AU164607			16	G10
8168	g_8168	RA1622		DPlate 064	D05			D24276				16	H10
8169	g_8169	RA0711	>(P40280) HISTONE H2A. &ZMU08225_1(U08225|pid:g473603) 	DPlate 062	E05			AU173102				16	I10
8170	g_8170	RA1646		DPlate 064	E05			AU173189	AU173190			16	J10
8171	g_8171	RA0727	">ATAC005167_11(AC005167|pid:g3757527) Arabidopsis thaliana   chromosome II BAC F12A24 genomic sequence, complete   sequence; "	DPlate 062	F05			D23986	AU031712			16	K10
8172	g_8172	RA1607		DPlate 064	F05			D24263	AU165957			16	L10
8173	g_8173	RA0759		DPlate 062	G05			D23999	AU031717			16	M10
8174	g_8174	RA1631		DPlate 064	G05			D24282	AU173180			16	N10
8175	g_8175	RA0783	>(P49200) 40S RIBOSOMAL PROTEIN S20 (S22). 	DPlate 062	H05			AU173108	AU164623			16	O10
8176	g_8176	RA1639	">AF004165_1(AF004165|pid:g2213882) Lycopersicon pennellii   2-isopropylmalate synthase (lp-ipmsa) mRNA, complete   cds. "	DPlate 064	H05			AU173183				16	P10
8177	g_8177	RA0968	>(Q40633) METALLOTHIONEIN-LIKE PROTEIN TYPE 1.   &OSU18404_1(U18404|pid:g687638)   &OSU43529_1(U43529|pid:g1815626)   &OSU46159_1(U46159|pid:g4097154) &S57768(S57768) 	DPlate 062	A11			AU070180	AU095440			16	A22
8178	g_8178	RA1771	">ATAC004138_10(AC004138|pid:g3461820) Arabidopsis thaliana   chromosome II BAC T17M13 genomic sequence, complete   sequence; unknown protein. "	DPlate 064	A11			AU173221	AU173222			16	B22
8179	g_8179	RA0976	">AF021256_1(AF021256|pid:g2465426) Hordeum vulgare 32 kDa protein   (JRG1.1) gene, complete cds; similar to jacalin;   regulated by jasmonate.   &HVU43496_1(U43496|pid:g1167953) "	DPlate 062	B11			D24040	AU164654			16	C22
8180	g_8180	RA1779	>ATATP20A_1(X98806|pid:g1546694) A.thaliana mRNA for peroxidase   ATP20a; peroxidase ATP20a. 	DPlate 064	B11			D24355	AU173228			16	D22
8181	g_8181	RA0992	">ENXNUPR_1(L41834|pid:g786117) Ensis minor (clone 1/6) nuclear   protein mRNA, complete cds; putative. "	DPlate 062	C11			D24044	AU101644			16	E22
8182	g_8182	RA1787	">OSU95968_1(U95968|pid:g2224915) Oryza sativa beta-expansin mRNA,   complete cds; cell wall loosening protein. "	DPlate 064	C11			D39077	AU173230			16	F22
8183	g_8183	RA0913	">AC002292_17(AC002292|pid:g2462758) Genomic sequence of Arabidopsis   BAC F8A5, complete sequence; location of EST gb|T221790.   "	DPlate 062	D11			AU173111	AU173112			16	G22
8184	g_8184	RA1716		DPlate 064	D11			D24314	AU173210			16	H22
8185	g_8185	RA0921		DPlate 062	E11			AU173113	AU173114			16	I22
8186	g_8186	RA1740	>(P51848) PYRUVATE DECARBOXYLASE ISOZYME 2 (EC 4.1.1.1) (PDC).   &OSU27350_1(U27350|pid:g1009710)   &OSU38199_1(U38199|pid:g1777455) 	DPlate 064	E11			D24329				16	J22
8187	g_8187	RA0937		DPlate 062	F11			AU173116	AU173117			16	K22
8188	g_8188	RA1756		DPlate 064	F11			D24340	AU031790			16	L22
8189	g_8189	RA0985		DPlate 062	G11			AU181008				16	M22
8190	g_8190	RA1764	>S74343(S74343) aspartate aminotransferase - Synechocystis sp.   (strain PCC 6803) &SYCCPNC_22(D64001|pid:g1001121) 	DPlate 064	G11			D24345	AU101655			16	N22
8191	g_8191	RA0993	">SCFMEMPRO_1(L13655|pid:g294845) Sugarcane membrane protein mRNA,   complete cds; putative. "	DPlate 062	H11			AU162391				16	O22
8192	g_8192	RA1772		DPlate 064	H11			AU181013				16	P22
8193	g_8193	RA2257		DPlate 066	A05			D24616	AU101661			17	A10
8194	g_8194	RA3007		DPlate 068	A05			AU173420				17	B10
8195	g_8195	RA2265	>ZMA7665_1(AJ007665|pid:g3319776) Zea mays mRNA for cytosolic   seryl-tRNA synthetase. 	DPlate 066	B05			D24621	AU173340			17	C10
8196	g_8196	RA3023	>BNAMPBP2_1(Z72152|pid:g1617274) B.napus mRNA for AMP-binding protein   (2287 bp). 	DPlate 068	B05			D39204	AU031982			17	D10
8197	g_8197	RA2210	">ATF16G20_12(AL031326|pid:g3451067) Arabidopsis thaliana DNA   chromosome 4, BAC clone F16G20 (ESSAII project);   similarity to rape mRNA, Brassica napus, PIR2:S42651;   contains EST gb:T44981, T45158. "	DPlate 066	C05			AU173332	AU173333			17	E10
8198	g_8198	RA3047	">ATAC002339_13(AC002339|pid:g2335100) Arabidopsis thaliana   chromosome II BAC T11A7 genomic sequence, complete   sequence; unknown protein. "	DPlate 068	C05			D39213	AU173428			17	F10
8199	g_8199	RA2218	">CEF55F3_1(Z81550|pid:g3877643) Caenorhabditis elegans cosmid F55F3,   complete sequence; cDNA EST EMBL:D69035 comes from this   gene; cDNA EST EMBL:D68766 comes from this gene; cDNA   EST EMBL:M75839 comes from this gene. "	DPlate 066	D05			D24587	AU031858			17	G10
8200	g_8200	RA3040	>S71773(S71773) cysteine proteinase (EC 3.4.22.-) precursor - Zinnia   elegans &ZEU19267_1(U19267|pid:g641905) 	DPlate 068	D05			D25061	AU031985			17	H10
8201	g_8201	RA2226	">AB004650_1(AB004650|pid:g2749775) Chicken mRNA for CENP-C, clone   CENP-C_1_2, complete cds. "	DPlate 066	E05			D24595	AU031859			17	I10
8202	g_8202	RA3072	">ZMU43082_1(U43082|pid:g1421730) Zea mays T cytoplasm male sterility   restorer factor 2 (rf2) mRNA, complete cds; restorer   factor 2; Allele: Rf2+B73; putative aldehyde   dehydrogenase; T cytoplasm male sterility. "	DPlate 068	E05			D39230	AU031992			17	J10
8203	g_8203	RA2258	">AF049588_1(AF049588|pid:g2944066) Canis familiaris synapsin I gene,   partial cds. "	DPlate 066	F05			D24617				17	K10
8204	g_8204	RA3080	">(P28523) CASEIN KINASE II, ALPHA CHAIN (CK II) (EC 2.7.1.37).   &PDBF(1A6O) &S19726(S19726;S16387)   &ZMACK2_1(X61387|pid:g22117) "	DPlate 068	F05			AU173433	AU173434			17	L10
8205	g_8205	RA2266	">(P31691) ADP,ATP CARRIER PROTEIN PRECURSOR (ADP/ATP TRANSLOCASE)   (ADENINE NUCLEOTIDE TRANSLOCATOR) (ANT).   &RICATADPT_1(D12637|pid:g218145) "	DPlate 066	G05			D24622	AU031866			17	M10
8206	g_8206	RA3109	">T24H24_12(AF075598|pid:g3377841) Arabidopsis thaliana BAC T24H24;   contains similarity to phosphofructokinases (Pfam;   PFK.hmm, score; 36.60). "	DPlate 068	G05			D25072	AU032003			17	N10
8207	g_8207	RA2203	">ATH010466_1(AJ010466|pid:g3776005) Arabidopsis thaliana mRNA for   DEAD box RNA helicase, RH15. "	DPlate 066	H05			D24579	AU173329			17	O10
8208	g_8208	RA3141	">ATAC002387_28(AC002387|pid:g2583133) Arabidopsis thaliana   chromosome II BAC F4L23 genomic sequence, complete   sequence; unknown protein. "	DPlate 068	H05			AU173440				17	P10
8209	g_8209	RA2323	">AC003027_26(AC003027|pid:g4204306) Arabidopsis thaliana chromosome   I BAC F21M11 genomic sequence, complete sequence;   Hypothetical protein. "	DPlate 066	A11			AU173347	AU173348			17	A22
8210	g_8210	RA3203	>LELEUZIP_1(Z12127|pid:g19275) L.esculentum mRNA for protein with   leucine zipper; protein of unknown function.   &S21495(S21495) 	DPlate 068	A11			D39256	AU032018			17	B22
8211	g_8211	RA2347		DPlate 066	B11							17	C22
8212	g_8212	RA3211	">ATAC005395_22(AC005395|pid:g3643607) Arabidopsis thaliana   chromosome II BAC F17H15 genomic sequence, complete   sequence; unknown protein. "	DPlate 068	B11			AU173462	AU173463			17	D22
8213	g_8213	RA2387	">ATU38916_1(U38916|pid:g1145627) Arabidopsis thaliana lipase mRNA,   complete cds. &S68410(S68410) "	DPlate 066	C11			D24693	AU031885			17	E22
8214	g_8214	RA3219	">ATAC005397_28(AC005397|pid:g3702340) Arabidopsis thaliana chromosome   II BAC T3F17 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 068	C11			D39267	AU173464			17	F22
8215	g_8215	RA2308	">STU60071_1(U60071|pid:g1708714) Solanum tuberosum disease   resistance homolog (St123) gene, partial cds;   Description: putative plant disease resistance gene   homolog; putative peptide. "	DPlate 066	D11			D24648	AU031873			17	G22
8216	g_8216	RA3227		DPlate 068	D11			D39274				17	H22
8217	g_8217	RA2316	">ATAC005970_3(AC005970|pid:g4006818) Arabidopsis thaliana chromosome   II BAC T6P5 genomic sequence, complete sequence; "	DPlate 066	E11			D24651	AU095464			17	I22
8218	g_8218	RA3235	">ATAC002510_16(AC002510|pid:g2618699) Arabidopsis thaliana   chromosome II BAC T32G6 genomic sequence, complete   sequence; unknown protein. "	DPlate 068	E11			D39280	AU032026			17	J22
8219	g_8219	RA2380	">U89959_18(U89959|pid:g3258575) Arabidopsis thaliana BAC T7I23,   complete sequence; Hypothetical protein. "	DPlate 066	F11			D24688	AU173350			17	K22
8220	g_8220	RA3275	">CREWP6A_1(L29028|pid:g530878) Chlamydomonas eugametos WP6 mRNA,   complete cds; amino acid feature: N-glycosylation sites,   aa 41 .. 43, 46 .. 48, 51 .. 53, 72 .. 74, 107 .. 109,   128 .. 130, 132 .. 134, 158 .. 160, 163 .. 165; amino   acid feature: Rod protein domain, aa 169 .. 340; amino   acid feature: globular protein domain, aa 32 .. 168.   &S50754(S50754) "	DPlate 068	F11			D39291	AU032036			17	L22
8221	g_8221	RA2388		DPlate 066	G11			D24694	AU173352			17	M22
8222	g_8222	RA3204	">AF049236_9(AF049236|pid:g3068711) Arabidopsis thaliana putative   transmembrane protein G1p (AtG1), putative nuclear   DNA-binding protein G2p (AtG2), Em1 protein (ATEM1),   putative chlorophyll synthetase (AtG4), putative   transmembrane protein G5p (AtG5), putative acyl-coA   dehydrogenase (AtG6), and calcium dependent protein   kinase genes, complete cds; and unknown genes; Gp6;   similar to Mus musculus glutaryl-CoA dehydrogenase   precursor encoded by GenBank Accession Number U18992.   &ATU72505_1(U72505|pid:g1657621) "	DPlate 068	G11			D39257	AU032019			17	N22
8223	g_8223	RA2396	>(P29618) CELL DIVISION CONTROL PROTEIN 2 HOMOLOG 1 (EC 2.7.1.-).   &OSRCDC21_1(X60374|pid:g20343) &S22440(S22440) 	DPlate 066	H11			D24699	C22593			17	O22
8224	g_8224	RA3212	">AB000130_1(AB000130|pid:g2055230) Soybean mRNA for SRC2, complete   cds. "	DPlate 068	H11			D39261	AU032021			17	P22
8225	g_8225	RA3752	">F5F19_14(AC006216|pid:g4220455) Arabidopsis thaliana chromosome 1   BAC F5F19 sequence, complete sequence; Identical to gene   gb|D88746 AR791 from Arabidopsis thaliana.. "	DPlate 070	A05			AU065433				18	A10
8226	g_8226	RB0501	">D86744_1(D86744|pid:g2114207) Oryza sativa DNA for glutaredoxin,   complete cds. &JC5445(JC5445;PC4325) "	DPlate 072	A05			AU077756	AU077757			18	B10
8227	g_8227	RA3760		DPlate 070	B05			AU065435	AU173796			18	C10
8228	g_8228	RB0509	">GMU43840_1(U43840|pid:g1438883) Glycine max choline kinase GmCK3p   mRNA, partial cds; choline kinase. "	DPlate 072	B05			AU070945	AU093471			18	D10
8229	g_8229	RA3768	">AF092051_1(AF092051|pid:g4191394) Homo sapiens   beta-1,3-N-acetylglucosaminyltransferase mRNA, complete   cds; glycosyltransferase; b3GnT. "	DPlate 070	C05			AU065438				18	E10
8230	g_8230	RB0557	">AE000801_9(AE000801|pid:g2621154) Methanobacterium   thermoautotrophicum from bases 68653 to 79584 (section 7   of 148) of the complete genome; Function Code:14.00 -   Unknown, ; similar to, gp:GI:g1835286 LN:XCU70889,   p()=0.99995, pid=09%. &B69020(B69020) "	DPlate 072	C05			AU070976				18	F10
8231	g_8231	RA3784		DPlate 070	D05			AU032236	AU081361			18	G10
8232	g_8232	RB0534	">AC005142_3(AC005142|pid:g4263041) Arabidopsis thaliana BAC T5L23   from chromosome IV, near 19 cM, complete sequence;   identical to F9H3.17, genBank accession number AF071527;   similar to F21B7.5, GenBank accession number AC002560;   functional catalog ID=99.   &AF071527_3(AF071527|pid:g4206208) "	DPlate 072	D05			AU070961				18	H10
8233	g_8233	RA3721		DPlate 070	E05			AU162518				18	I10
8234	g_8234	RB0550		DPlate 072	E05			AU173852	AU163472			18	J10
8235	g_8235	RA3753	">PVU34334_1(U34334|pid:g1420887) Phaseolus vulgaris non-specific   lipid transfer-like protein mRNA, complete cds.   &S72530(S72530) "	DPlate 070	F05			AU173794	AU173795			18	K10
8236	g_8236	RB0551		DPlate 072	F05			AU173853				18	L10
8237	g_8237	RA3761	>ASSGT_1(Z83832|pid:g2462911) A.sativa mRNA for UDP-glucose:sterol   glucosyltransferase. 	DPlate 070	G05			AU173797	AU173798			18	M10
8238	g_8238	RB0552		DPlate 072	G05			AU070972				18	N10
8239	g_8239	RA3714	>OSACS5GEN_1(X97066|pid:g3288564) O.sativa acs5 gene. 	DPlate 070	H05			AU065421	AU173534			18	O10
8240	g_8240	RB0584	">ATT6K21_9(AL021889|pid:g2894600) Arabidopsis thaliana DNA chromosome   4, BAC clone T6K21 (ESSAII project); similarity to   predicted protein, Saccharomyces cerevisiae, PIR2:S56868.   "	DPlate 072	H05			AU173854				18	P10
8241	g_8241	RA3856		DPlate 070	A11			AU032298	AU032299			18	A22
8242	g_8242	RB0638	">RICCHT1_1(D16221|pid:g500615) Rice Cht-1 gene for endochitinase,   complete cds. "	DPlate 072	A11			AU077766	AU077767			18	B22
8243	g_8243	RA3981	">ATT5L19_18(AL049481|pid:g4539008) Arabidopsis thaliana DNA   chromosome 4, BAC clone T5L19 (ESSA project); weak   similarity to monoglyceride lipase - Mus musculus,   PID:e1184892; Contains Lipases, serine active site   [IVLVGHSMGG]. "	DPlate 070	B11			AU032388	AU032389			18	C22
8244	g_8244	RB0662		DPlate 072	B11			AU162618	AU071057			18	D22
8245	g_8245	RA3902		DPlate 070	C11			AU162546	AU032332			18	E22
8246	g_8246	RB0655	">ZMU82200_1(U82200|pid:g3290004) Zea mays pathogenesis related   protein-1 (PR-1) mRNA, complete cds. "	DPlate 072	C11			AU071051	AU175075			18	F22
8247	g_8247	RA3942		DPlate 070	D11			AU070232	AU173820			18	G22
8248	g_8248	RB0608	>TM017A05_11(AF024504|pid:g2435522) Arabidopsis thaliana BAC   TM017A05; contains similarity to other AMP-binding   enzymes. 	DPlate 072	D11			AU071011	AU078255			18	H22
8249	g_8249	RA3958	>ATATP19A_1(X98805|pid:g1546692) A.thaliana mRNA for peroxidase   ATP19a; peroxidase ATP19a. 	DPlate 070	E11			AU032371	AU173827			18	I22
8250	g_8250	RB0648		DPlate 072	E11			AU071046				18	J22
8251	g_8251	RA3966	">AF031231_1(AF031231|pid:g4104060) Triticum aestivum S222 (S222)   mRNA, complete cds. "	DPlate 070	F11			AU032379	AU173828			18	K22
8252	g_8252	RB0656		DPlate 072	F11			AU162614	AU162615			18	L22
8253	g_8253	RA3990	>CELR05F9_12(U41533|pid:g1109819) Caenorhabditis elegans cosmid   R05F9; weak similarity to A. thaliana ELI3-2 protein   (PIR:S28044). 	DPlate 070	G11			AU070240	AU173831			18	M22
8254	g_8254	RB0688	">ATAC007017_13(AC007017|pid:g4510373) Arabidopsis thaliana   chromosome II BAC F11F19 genomic sequence, complete   sequence; "	DPlate 072	G11			AU078037	AU078038			18	N22
8255	g_8255	RA3919	>A46373(A46373) serine/threonine kinase homolog PRO25 - Arabidopsis   thaliana &ATHPRO25A_1(L04999|pid:g166813) 	DPlate 070	H11			AU032342	AU032343			18	O22
8256	g_8256	RB0701	">ATF6H11_4(AL021684|pid:g2827702) Arabidopsis thaliana DNA   chromosome 5, BAC clone F6H11 (ESSAII project);   similarity to hypothetical protein YDR465c,   Saccharomyces cerevisiae, PIR2:S69633. "	DPlate 072	H11			AU071075				18	P22
8257	g_8257	SA0127		DPlate 074	A05			AU055886	AU055887			19	A10
8258	g_8258	SA1087	">D83970_1(D83970|pid:g1854443) Vigna unguiculata mRNA for CPRD8   protein, complete cds. "	DPlate 078	A05			AU057040	AU057041			19	B10
8259	g_8259	SA0135		DPlate 074	B05			AU082562	AU055897			19	C10
8260	g_8260	SA1095	">ATAC002510_4(AC002510|pid:g2618687) Arabidopsis thaliana chromosome   II BAC T32G6 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 078	B05			AU057052	AU057053			19	D10
8261	g_8261	SA0143		DPlate 074	C05			AU173863	AU173864			19	E10
8262	g_8262	SA1032		DPlate 078	C05			AU056977	AU101717			19	F10
8263	g_8263	SA0159	">ATF20D10_5(AL035538|pid:g4467099) Arabidopsis thaliana DNA   chromosome 4, BAC clone F20D10 (ESSA project); strong   similarity to glycine hydroxymethyltransferase -Solanum   tuberosum, PID:g438247; Contains Serine   hydroxymethyltransferase pyridoxal-phosphate attachment   site [DVVTTTTHKSLRGPRGA]; contains EST gb:R64888,   N97047, T46706, T75910, T43283, T46082, Z35015, T44375,   Ai099897, H76188, Z35360. "	DPlate 074	D05			AU055930	AU055931			19	G10
8264	g_8264	SA1048	>TAESERPIN_1(Y11485|pid:g1885350) T.aestivum mRNA for serpin WZS2. 	DPlate 078	D05			AU056992	AU056993			19	H10
8265	g_8265	SA0167		DPlate 074	E05			AU055938	AU055939			19	I10
8266	g_8266	SA1080	">AB009399_1(AB009399|pid:g3218550) Arabidopsis thaliana mRNA for   Cdk-activating kinase 1At, complete cds. "	DPlate 078	E05			AU057032	AU057033			19	J10
8267	g_8267	SA0175	">AF034266_1(AF034266|pid:g4104242) Gossypium hirsutum palmitoyl-acyl   carrier protein thioesterase (FatB1) mRNA, partial cds;   16:0-ACP thioesterasae. "	DPlate 074	F05			AU055950	AU055951			19	K10
8268	g_8268	SA1109	>IG005I10_12(AF013293|pid:g2252840) Arabidopsis thaliana BAC   IG005I10; contains regions of similarity to Haemophilus   influenzae permease (SP:P38767); coded for by A.   thaliana cDNA H76622. 	DPlate 078	F05			AU057063	AU081018			19	L10
8269	g_8269	SA0183	">AC005142_12(AC005142|pid:g4263050) Arabidopsis thaliana BAC T5L23   from chromosome IV, near 19 cM, complete sequence;   similar to M. truncatula N7 nodulin, GenBank accession   number Y17613; functional catalog ID=40.02; functional   catalog ID=50.02. "	DPlate 074	G05			AU055964	AU055965			19	M10
8270	g_8270	SA1117	">D87042_1(D87042|pid:g1504052) Zea mays mRNA for Calcium-dependent   protein kinase, complete cds. "	DPlate 078	G05			AU057068				19	N10
8271	g_8271	SA0191	">CFU50935_1(U50935|pid:g1374804) Canis familiaris collagen type IV   alpha 3 chain (COL4A3) mRNA, partial cds; contains NCI   domain. "	DPlate 074	H05			AU055975	AU055976			19	O10
8272	g_8272	SA1125		DPlate 078	H05			AU057074				19	P10
8273	g_8273	SA0281		DPlate 074	A11			AU056090	AU101713			19	A22
8274	g_8274	SA1235		DPlate 078	A11			AU057195	AU057196			19	B22
8275	g_8275	SA0289	">AB019186_1(AB019186|pid:g4519936) Oryza sativa mRNA for RPR1,   complete cds; NBS-LRR-class gene. "	DPlate 074	B11			AU056102	AU056103			19	C22
8276	g_8276	SA1251		DPlate 078	B11			AU176532				19	D22
8277	g_8277	SA0218		DPlate 074	C11			AU162642	AU056006			19	E22
8278	g_8278	SA1259	>(Q03664) PROBABLE GLUTATHIONE S-TRANSFERASE (EC 2.5.1.18)   (AUXIN-INDUCED PROTEIN PCNT103).   &NTAUX103_1(X56263|pid:g19791) &S16269(S16269) 	DPlate 078	C11			AU057225	AU057226			19	F22
8279	g_8279	SA0226	">AC002130_17(AC002130|pid:g2760332) The sequence of BAC F1N21 from   Arabidopsis thaliana chromosome 1, complete sequence;   similar to nuclear matrix constituent protein 1 (D64087);   similar to EST gb|T22102. "	DPlate 074	D11			AU056018	AU056019			19	G22
8280	g_8280	SA1283	>S31163(S31163)phosphoprotein phosphatase (EC 3.1.3.16) 2A-alpha   catalytic chain (clone EP7) - Arabidopsis thaliana   (fragment) 	DPlate 078	D11			AU057262	AU057263			19	H22
8281	g_8281	SA0266	">ATAP22_38(Z99708|pid:g4006913) Arabidopsis thaliana DNA chromosome   4, ESSA I AP2 contig fragment No. 2; "	DPlate 074	E11			AU173871				19	I22
8282	g_8282	SA1236		DPlate 078	E11			AU057197	AU057198			19	J22
8283	g_8283	SA0274	">AC003952_2(AC003952|pid:g2708738) Arabidopsis thaliana BAC T13L16   from chromosome II, near 33 cM, complete sequence;   similar to C. elegans hypothetical 108.7 kd protein   C14B1.5 (P49958). "	DPlate 074	F11			AU056081	AU056082			19	K22
8284	g_8284	SA1260	">ATFCA1_18(Z97336|pid:g2244806) Arabidopsis thaliana DNA chromosome   4, ESSA I contig fragment No. 1; similarity to   phosphatidylcholine transfer protein - bovine.   &C71407(C71407) "	DPlate 078	F11			AU057227	AU057228			19	L22
8285	g_8285	SA0282	">ATT6K21_7(AL021889|pid:g2894598) Arabidopsis thaliana DNA chromosome   4, BAC clone T6K21 (ESSAII project); similarity to   deubiquitinating enzyme, Mus musculus, PIR2:JC6133;   contains EST gb:H37752. "	DPlate 074	G11			AU056091	AU056092			19	M22
8286	g_8286	SA1268	">ATT9A21_5(AL021713|pid:g2832695) Arabidopsis thaliana DNA   chromosome 4, BAC clone T9A21 (ESSAII project);   similarity to W15DMY32F, W25DMY32; contains EST   gb:N37227. "	DPlate 078	G11			AU057240				19	N22
8287	g_8287	SA0219	">ATAC004005_25(AC004005|pid:g3212879) Arabidopsis thaliana   chromosome II BAC F6E13 genomic sequence, complete   sequence; "	DPlate 074	H11			AU162643	AU056007			19	O22
8288	g_8288	SA1221	">CET28C6_1(Z54238|pid:g3880303) Caenorhabditis elegans cosmid T28C6,   complete sequence. "	DPlate 078	H11			AU057176	AU057177			19	P22
8289	g_8289	SA0819	">D86598_1(D86598|pid:g1483177) Norway spruce mRNA for   antifreeze-like protein (af70), complete cds. "	DPlate 077	A05			AU076254	AU076255			20	A10
8290	g_8290	SA1752	">ATU73528_1(U73528|pid:g2160694) Arabidopsis thaliana B' regulatory   subunit of PP2A (AtB'gamma) mRNA, complete cds; gamma   isoform. "	DPlate 080	A05			AU057747	AU057748			20	B10
8291	g_8291	SA0835	">ATAC006955_4(AC006955|pid:g4544409) Arabidopsis thaliana chromosome   II BAC F28I8 genomic sequence, complete sequence; "	DPlate 077	B05			AU056732	AU056731			20	C10
8292	g_8292	SA1760		DPlate 080	B05			AU057758				20	D10
8293	g_8293	SA0851	>LES010942_1(AJ010942|pid:g3582000) Lycopersicon esculentum mRNA for   hexose transporter. 	DPlate 077	C05			AU108937	AU056756			20	E10
8294	g_8294	SA1784		DPlate 080	C05			AU173971	AU173972			20	F10
8295	g_8295	SA0883		DPlate 077	D05			AU056800	AU056801			20	G10
8296	g_8296	SA1705		DPlate 080	D05			AU057704				20	H10
8297	g_8297	SA0804	">ATF17A8_16(AL049482|pid:g4538911) Arabidopsis thaliana DNA   chromosome 4, BAC clone F17A8 (ESSA project); "	DPlate 077	E05			AU173918	AU056698			20	I10
8298	g_8298	SA1713	>BVRAB1_1(Z49152|pid:g974776) B.vulgaris mRNA for small G protein   (clone 1S3). 	DPlate 080	E05			AU162773	AU057712			20	J10
8299	g_8299	SA0812	>CAR9825_1(AJ009825|pid:g3819099) Cicer arietinum mRNA for copper   containing amine oxidase (DAO). 	DPlate 077	F05			AU162712	AU056706			20	K10
8300	g_8300	SA1721		DPlate 080	F05			AU077806	AU077807			20	L10
8301	g_8301	SA0836		DPlate 077	G05			AU056733	AU056734			20	M10
8302	g_8302	SA1737	">ATAC006234_11(AC006234|pid:g4454458) Arabidopsis thaliana   chromosome II BAC F5H14 genomic sequence, complete   sequence; unknown protein. "	DPlate 080	G05			AU173965	AU173966			20	N10
8303	g_8303	SA0860	">AB009665_1(AB009665|pid:g2696804) Oryza sativa mRNA for water   channel protein, complete cds. "	DPlate 077	H05			AU056769	AU056770			20	O10
8304	g_8304	SA1745	">ATAC006921_8(AC006921|pid:g4510346) Arabidopsis thaliana chromosome   II BAC F2H17 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 080	H05			AU057741	AU057742			20	P10
8305	g_8305	SA0912		DPlate 077	A11			AU056828	AU056829			20	A22
8306	g_8306	SA1840	">ATU93215_14(U93215|pid:g1946368) Arabidopsis thaliana chromosome II   BAC T06B20 genomic sequence, complete sequence; unknown   protein. "	DPlate 080	A11			AU057847				20	B22
8307	g_8307	SA0952	>ANPACCGEN_1(Z47081|pid:g695416) A.nidulans pacC gene for DNA   binding protein. &S54308(S54308) 	DPlate 077	B11			AU076260	AU076261			20	C22
8308	g_8308	SA1933		DPlate 080	B11			AU057949				20	D22
8309	g_8309	SA0960	">ATF10M23_36(AL035440|pid:g4455225) Arabidopsis thaliana DNA   chromosome 4, BAC clone F10M23 (ESSAII project); strong   similarity to gene F20P5.12 of BAC F20P5 from   Arabidopsis thalianachromosome 1, PID:g2194125; contains   EST gb:T13907, Aa395726. "	DPlate 077	C11			AU056891	AU056892			20	E22
8310	g_8310	SA1949		DPlate 080	C11			AU057966				20	F22
8311	g_8311	SA0968	">ATAC003680_4(AC003680|pid:g2979544) Arabidopsis thaliana chromosome   II BAC F17K2 genomic sequence, complete sequence; "	DPlate 077	D11			AU056906	AU056907			20	G22
8312	g_8312	SA1973		DPlate 080	D11			AU173973	AU173974			20	H22
8313	g_8313	SA0984	">ATAC004697_23(AC004697|pid:g3402690) Arabidopsis thaliana   chromosome II BAC T16B24 genomic sequence, complete   sequence; hypothetical protein, 3' partial. "	DPlate 077	E11			AU056923	AU056924			20	I22
8314	g_8314	SA1902	">ATF18A5_6(AL035528|pid:g4455296) Arabidopsis thaliana DNA   chromosome 4, BAC clone F18A5 (ESSAII project);   contains EST gb:T21231. "	DPlate 080	E11			AU057912	AU057913			20	J22
8315	g_8315	SA0905	">AB016166_1(AB016166|pid:g3869206) Arabidopsis thaliana gene for   Phosphate Transporter 4, complete cds.   &AF022872_1(AF022872|pid:g2564661)   &ATAC005770_11(AC005770|pid:g3928081)   &ATU62331_1(U62331|pid:g1502430) "	DPlate 077	F11			AU056819	AU162722			20	K22
8316	g_8316	SA1934		DPlate 080	F11			AU057950				20	L22
8317	g_8317	SA0913	">AB017042_1(AB017042|pid:g4126809) Oryza sativa mRNA for glyoxalase   I, complete cds; putative. "	DPlate 077	G11			AU056830	AU056831			20	M22
8318	g_8318	SA1911	>(P35682) G10 PROTEIN HOMOLOG. &RICMG10IP_1(D12628|pid:g303847) 	DPlate 080	G11			AU057923				20	N22
8319	g_8319	SA0921	">AB017694_1(AB017694|pid:g4519673) Nicotiana tabacum WREBP-2 mRNA,   complete cds. "	DPlate 077	H11			AU056840	AU056841			20	O22
8320	g_8320	SA1967	">ZMU77345_1(U77345|pid:g1935909) Zea mays lethal leaf-spot 1 (lls1)   mRNA, partial cds; Allele: wild-type; LLS1; similar to   bacterial ring-hydroxylating dioxygenase. "	DPlate 080	H11			AU057990				20	P22
8321	g_8321	SS3187	">AC003027_17(AC003027|pid:g4204313) Arabidopsis thaliana chromosome   I BAC F21M11 genomic sequence, complete sequence;   Hypothetical protein. "	DPlate 082	A05			D47600	AU032669			21	A10
8322	g_8322	SS5172	">ATT13J8_19(AL035524|pid:g4455367) Arabidopsis thaliana DNA chromosome   4, BAC clone T13J8 (ESSAII project); similarity to   150-kD protein, Dictyosteliu. "	DPlate 084	A05			D48777	AU101813			21	B10
8323	g_8323	SS3124	">AF072326_1(AF072326|pid:g3822036) Zea mays   endo-1,3-1,4-beta-D-glucanase mRNA, complete cds. "	DPlate 082	B05			D47553	AU101758			21	C10
8324	g_8324	SS5541		DPlate 084	B05			D48949	AU097625			21	D10
8325	g_8325	SS3172		DPlate 082	C05			D47588	AU101762			21	E10
8326	g_8326	SS5573	>S70489(S70489)photosystem II protein X precursor - Arabidopsis   thaliana 	DPlate 084	C05			D48973	AU101820			21	F10
8327	g_8327	SS3202	>(P52706) (R)-MANDELONITRILE LYASE ISOFORM 1 PRECURSOR (EC 4.1.2.10)   (HYDROXYNITRILE LYASE 1) ((R)-OXYNITRILASE 1).   &PSMDL1_1(X72617|pid:g288116)   &PSU78814_1(U78814|pid:g1730332) &S32156(S32156) 	DPlate 082	D05			D47607	AU162930			21	G10
8328	g_8328	SS5542	>(P42796) 60S RIBOSOMAL PROTEIN L11B (L16B).   &ATF28A21_14(AL035526|pid:g4539392)   &ATRPL16B_1(X81800|pid:g550547) 	DPlate 084	D05			D48950	AU174082			21	H10
8329	g_8329	SS3258		DPlate 082	E05			AU096274				21	I10
8330	g_8330	SS5558		DPlate 084	E05			D48962	AU163113			21	J10
8331	g_8331	SS3282	">AF090698_1(AF090698|pid:g3603473) Oryza sativa elicitor-responsive   gene-3 (ERG3) mRNA, complete cds; similar to C2 domain. "	DPlate 082	F05			D47658	AU162939			21	K10
8332	g_8332	SS5535	">D26015_1(D26015|pid:g2541876) Nicotiana tabacum mRNA for CND41,   chloroplast nucleoid DNA binding protein, complete cds. "	DPlate 084	F05			AU096785				21	L10
8333	g_8333	SS3290	">OSU74295_1(U74295|pid:g1661160) Oryza sativa chlorophyll a/b   binding protein (kcdl895) mRNA, complete cds. "	DPlate 082	G05			D47663	AU174020			21	M10
8334	g_8334	SS5575	">ATAC004521_2(AC004521|pid:g3128168) Arabidopsis thaliana chromosome   II BAC F4I1 genomic sequence, complete sequence; "	DPlate 084	G05			D48975				21	N10
8335	g_8335	SS3203		DPlate 082	H05			AU096271	AU096270			21	O10
8336	g_8336	SS5591		DPlate 084	H05			D48990	AU162048			21	P10
8337	g_8337	SS3808	">AF061577_1(AF061577|pid:g3126854) Oryza sativa chlorophyll a/b   binding protein (RCABP89) mRNA, nuclear gene encoding   chloroplast protein, complete cds. "	DPlate 082	A11			AU174022				21	A22
8338	g_8338	SS5811	">AF030387_1(AF030387|pid:g2642217) Oryza sativa NOI protein mRNA,   complete cds. "	DPlate 084	A11			D49125	AU101837			21	B22
8339	g_8339	SS3816	">CEC06B3_8(Z77652|pid:g3874053) Caenorhabditis elegans cosmid C06B3,   complete sequence; "	DPlate 082	B11			D47982	AU101780			21	C22
8340	g_8340	SS5843	>(P47179) HYPOTHETICAL 118.4 KD PROTEIN IN RPS7B-DAL5 INTERGENIC   REGION PRECURSOR. &S57180(S57180)   &SCYJR151C_1(Z49651|pid:g1015903) 	DPlate 084	B11			D49152	AU162074			21	D22
8341	g_8341	SS3832	">ATAC005309_32(AC005309|pid:g3738306) Arabidopsis thaliana   chromosome II BAC F17A22 genomic sequence, complete   sequence; unknown protein. "	DPlate 082	C11			D47994	AU174023			21	E22
8342	g_8342	SS5859	">AF051229_1(AF051229|pid:g2982289) Picea mariana 60S ribosomal   protein L17 (Sb38) mRNA, partial cds. "	DPlate 084	C11			AU181031				21	F22
8343	g_8343	SS3864	>LSTPRPF1_1(X57076|pid:g19521) L.esculentum TPRP-F1 gene for a   proline-rich protein. 	DPlate 082	D11			C24771	AU101782			21	G22
8344	g_8344	SS5867		DPlate 084	D11			AU174092				21	H22
8345	g_8345	SS3872	">(P29790) ATP SYNTHASE GAMMA CHAIN, CHLOROPLAST PRECURSOR (EC   3.6.1.34). &NTATPC_1(X63606|pid:g19785)   &PWNTG(S22486;S23615;S18949) "	DPlate 082	E11			AU065840	AU162975			21	I22
8346	g_8346	SS5875	">RICSODA_1(D00999|pid:g218224) Oryza sativa mRNA for   copper/zinc-superoxide dismutase, complete cds,   clone:RSODA. &RICSODCC_1(L19435|pid:g685242)   &S22508(S22508) "	DPlate 084	E11			D49171	AU174094			21	J22
8347	g_8347	SS3888	">ATT28I19_9(AL035709|pid:g4490726) Arabidopsis thaliana DNA   chromosome 4, BAC clone (ESSA project); "	DPlate 082	F11			AU065847	AU101784			21	K22
8348	g_8348	SS5891		DPlate 084	F11			D49183	AU174095			21	L22
8349	g_8349	SS3896	>CELC17G10_9(U28739|pid:g2731377) Caenorhabditis elegans cosmid   C17G10; similar to alcohol dehydrogenase/ribitol   dehydrogenase; coded for by C. elegans cDNA yk24d12.5;   coded for by C. elegans cDNA yk130f7.3; coded for by C.   elegans cDNA yk130f7.5. 	DPlate 082	G11			C24776	AU082753			21	M22
8350	g_8350	SS5844		DPlate 084	G11			AU181030				21	N22
8351	g_8351	SS3901	">MZETRNMU_1(M76978|pid:g540581) Zea mays transposon MuDR mudrA and   mudrB genes, complete cds. &S59141(S59141)   &ZMU14597_1(U14597|pid:g595816) "	DPlate 082	H11			D47996	AU174026			21	O22
8352	g_8352	SS5852	>AFZ94887_2(Z94887|pid:g2462887) A.flos-aquae rbcL and rbcX genes   (strain NIVA-CYA 142); putative. 	DPlate 084	H11			D49157	AU174091			21	P22
8353	g_8353	ST0061		DPlate 086	A05			AU032961	AU101893			22	A10
8354	g_8354	ST1207		DPlate 088	A05			D39655				22	B10
8355	g_8355	ST0077		DPlate 086	B05			AU066047	AU032966			22	C10
8356	g_8356	ST1215	">BLYBTH7T_1(L36883|pid:g1209251) Hordeum vulgare thionin (BTH7)   gene, complete cds. "	DPlate 088	B05			D39662				22	D10
8357	g_8357	ST0085	">AB011116_1(AB011116|pid:g3043612) Homo sapiens mRNA for KIAA0544   protein, partial cds. "	DPlate 086	C05			AU174141				22	E10
8358	g_8358	ST1231	">D26015_1(D26015|pid:g2541876) Nicotiana tabacum mRNA for CND41,   chloroplast nucleoid DNA binding protein, complete cds. "	DPlate 088	C05			D39673	AU161608			22	F10
8359	g_8359	ST0093	>(P13983) EXTENSIN PRECURSOR (CELL WALL HYDROXYPROLINE-RICH   GLYCOPROTEIN). &NTEXT_1(X13885|pid:g19867)   &S06733(S06733) 	DPlate 086	D05			D39376				22	G10
8360	g_8360	ST1247	>(P49730) RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE SMALL CHAIN (EC   1.17.4.1) (RIBONUCLEOTIDE REDUCTASE) (R2 SUBUNIT).   &NTRIBRDR2_1(X92443|pid:g1044912) 	DPlate 088	D05			D39682	AU174212			22	H10
8361	g_8361	ST0014	">ATAC004484_3(AC004484|pid:g3075386) Arabidopsis thaliana chromosome   II BAC T1D16 genomic sequence, complete sequence;   &ATHER_1(D83257|pid:g1389566)   &ATU47029_1(U47029|pid:g1345132) "	DPlate 086	E05			C22657	C22656			22	I10
8362	g_8362	ST1271	">ATF22I13_4(AL035539|pid:g4539335) Arabidopsis thaliana DNA   chromosome 4, BAC clone F22I13 (ESSA project); EST   H76966 marks 3' end; similarity to other predicted   Arabidopsis thaliana proteins; contains EST gb:H76966. "	DPlate 088	E05			AU161614				22	J10
8363	g_8363	ST0022		DPlate 086	F05			D39361	AU174136			22	K10
8364	g_8364	ST1295	">AF026538_1(AF026538|pid:g4103635) Hordeum vulgare ABA-responsive   protein mRNA, complete cds. "	DPlate 088	F05			D39721	AU097025			22	L10
8365	g_8365	ST0038		DPlate 086	G05			AU066041	AU032954			22	M10
8366	g_8366	ST1264	">(P08640) GLUCOAMYLASE S1/S2 PRECURSOR (EC 3.2.1.3) (GLUCAN 1,4-ALPHA-   GLUCOSIDASE) (1,4-ALPHA-D-GLUCAN GLUCOHYDROLASE).   &S48478(S48478;A26877;B26877;S27281;JC6123)   &SC9168_1(Z38061|pid:g557822)   &SCU30626_1(U30626|pid:g1304387) "	DPlate 088	G05			D39696	AU161613			22	N10
8367	g_8367	ST0062		DPlate 086	H05			AU163159	D39369			22	O10
8368	g_8368	ST1296	">CRPK1_1(Z73295|pid:g1644291) C.roseus mRNA for receptor-like protein   kinase; Autophosphorylation predominantly on Thr, less on   Ser. Mechanism: autophosphorylation in cis.. "	DPlate 088	H05			D39722	C22668			22	P10
8369	g_8369	ST0611	">ATF22K18_17(AL035356|pid:g4220527) Arabidopsis thaliana DNA   chromosome 4, BAC clone F22K18 (ESSAII project);   predicted by genscan; similarity to other predicted or   hypothetical proteins in Arabidpsis, C.elegans and   yeast. "	DPlate 086	A11			AU174147	AU174148			22	A22
8370	g_8370	ST1920	>(Q10169) HYPOTHETICAL 36.8 KD PROTEIN C26A3.16 IN CHROMOSOME I.   &SPAC26A3_16(Z69240|pid:g1177363) 	DPlate 088	A11			AU181042				22	B22
8371	g_8371	ST0651	>(Q07121) COPPER AMINE OXIDASE PRECURSOR (EC 1.4.3.6) (MAOXI).   &ARGMAOX_1(L12983|pid:g289156) 	DPlate 086	B11			AU101910	AU101911			22	C22
8372	g_8372	ST1936		DPlate 088	B11			AU175157	AU176547			22	D22
8373	g_8373	ST0675		DPlate 086	C11			AU163185	AU163186			22	E22
8374	g_8374	ST1984	>(P23654) NEUROTACTIN. &DMNEUTAC_1(X54999|pid:g8290)   &S13795(S13795) 	DPlate 088	C11			D40191	AU174242			22	F22
8375	g_8375	ST0612	">ATAC005824_4(AC005824|pid:g3860247) Arabidopsis thaliana chromosome   II BAC F15K20 genomic sequence, complete sequence;   unknown protein. "	DPlate 086	D11			AU161543	AU161544			22	G22
8376	g_8376	ST1905		DPlate 088	D11			D40135	AU174226			22	H22
8377	g_8377	ST0676	">ATAC004411_23(AC004411|pid:g3522956) Arabidopsis thaliana   chromosome II BAC F14M4 genomic sequence, complete   sequence; "	DPlate 086	E11			AU070514	AU101916			22	I22
8378	g_8378	ST1913	">ATAC006931_24(AC006931|pid:g4512678) Arabidopsis thaliana   chromosome II BAC F7D19 genomic sequence, complete   sequence; unknown protein. "	DPlate 088	E11			D40141	AU174229			22	J22
8379	g_8379	ST0661		DPlate 086	F11			AU082450	AU082451			22	K22
8380	g_8380	ST1961	">ATF20D10_32(AL035538|pid:g4467126) Arabidopsis thaliana DNA   chromosome 4, BAC clone F20D10 (ESSA project); strong   similarity to guanine nucleotide-exchange protein -Bos   taurus, PID:g2674107. "	DPlate 088	F11			D40177				22	L22
8381	g_8381	ST0677		DPlate 086	G11			AU070515				22	M22
8382	g_8382	ST1969	">OSU95968_1(U95968|pid:g2224915) Oryza sativa beta-expansin mRNA,   complete cds; cell wall loosening protein. "	DPlate 088	G11			D40182	AU174239			22	N22
8383	g_8383	ST0614	">ATPEROX2_1(X98774|pid:g1429215) A.thaliana mRNA for peroxidase   ATP6a, EST clone 157A5T7.   &ATPRXR8GE_1(X98320|pid:g1402918) "	DPlate 086	H11			AU081597	AU081598			22	O22
8384	g_8384	ST1977	>S67159(S67159) probable membrane protein YOR262w - yeast   (Saccharomyces cerevisiae)   &SCYOR262W_1(Z75170|pid:g1420591) 	DPlate 088	H11			D40187	AU174240			22	P22
8385	g_8385	ST3618	">AF098458_1(AF098458|pid:g4235430) Hevea brasiliensis latex-abundant   protein (LAR) mRNA, complete cds; similar to Arabidopsis   chromosome 1 YAC YUPiH12R sequence in GenBank Accession   Number AC002986; similar to yeast hypothetical protein   YOR197w. "	DPlate 090	A05			D41251	AU108391			23	A10
8386	g_8386	ST5207	">PCU85499_1(U85499|pid:g1815759) Phalaris coerulescens   pollen-specific protein mRNA, complete cds. "	DPlate 092	A05			AU070597	AU174354			23	B10
8387	g_8387	ST3658	">ATU86081_1(U86081|pid:g1839188) Arabidopsis thaliana root hair   defective 3 (RHD3) gene, complete cds; required for   regulated cell expansion and normal root hair   development in Arabidopsis thaliana; For this reason,   the gene was designated Root Hair Defective3 (RHD3);   encodes an evolutionarily conserved protein with   putative GTP-binding motifs and is expressed in many   plant organs. "	DPlate 090	B05			D41282	AU108400			23	C10
8388	g_8388	ST5231	">ATAC006300_15(AC006300|pid:g4432861) Arabidopsis thaliana   chromosome II BAC F13B15 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 092	B05			C25091	AU102021			23	D10
8389	g_8389	ST3674		DPlate 090	C05			AU181048				23	E10
8390	g_8390	ST5247	">AC004146_2(AC004146|pid:g4204277) Arabidopsis thaliana chromosome I   BAC F5A8 genomic sequence, complete sequence;   Hypothetical protein. "	DPlate 092	C05			C25099				23	F10
8391	g_8391	ST3643	">ATF26P21_12(AL031804|pid:g3688181) Arabidopsis thaliana DNA   chromosome 4, BAC clone F26P21 (ESSAII project);   similarity to calcineurin B, Naegleria gruberi,   gb;U04380; Contains EF-hand calcium-binding domain   [DSDKDGKISKDEW]. "	DPlate 090	D05			D41271	AU101978			23	G10
8392	g_8392	ST5208	">AF079589_1(AF079589|pid:g3386567) Sorghum bicolor   1-aminocyclopropane-1-carboxylate oxidase (ACO2) mRNA,   partial cds; ACC oxidase. "	DPlate 092	D05			AU161736	AU058123			23	H10
8393	g_8393	ST3620	>ZMAJ2959_1(AJ002959|pid:g2624417) Zea mays mRNA for ubiquitin   carrier protein UBC7. 	DPlate 090	E05			D41253	AU101976			23	I10
8394	g_8394	ST5248		DPlate 092	E05			AU174357				23	J10
8395	g_8395	ST3628	">T31J12_3(AC006416|pid:g4337175) Arabidopsis thaliana chromosome 1   BAC T31J12 sequence, complete sequence; ESTs gb|T20589,   gb|T04648, gb|AA597906, gb|T04111, gb|R84180, gb|R65428,   gb|T44439, gb|T76570, gb|R90004, gb|T45020, gb|T42457,   gb|T20921, gb|AA042762 and gb|AA720210 come from this   gene.. "	DPlate 090	F05			D41259	AU174295			23	K10
8396	g_8396	ST5280	">CEZK593_6(Z69385|pid:g3881724) Caenorhabditis elegans cosmid ZK593,   complete sequence; Similarity to Yeast JTA107 protein   (PIR Acc. No. S55137); cDNA EST yk290e3.3 comes from   this gene; cDNA EST yk290e3.5 comes from this gene. "	DPlate 092	F05			C25111	AU174359			23	L10
8397	g_8397	ST3652	">AF033097_1(AF033097|pid:g2754825) Avena sativa nonphototropic   hypocotyl 1 (NPH1-2) mRNA, complete cds; putative   serine/threonine protein kinase. "	DPlate 090	G05			D41278	AU101979			23	M10
8398	g_8398	ST5409	>(Q08704) CHALCONE--FLAVONONE ISOMERASE (EC 5.5.1.6).   &S41570(S41570;S35932) &ZMCHIGNA_1(Z22760|pid:g396149) 	DPlate 092	G05			AU033222				23	N10
8399	g_8399	ST3645	">AGU83687_1(U83687|pid:g1835701) Apium graveolens NADPH-dependent   mannose 6-phosphate reductase (m6pr) mRNA, complete cds;   aldo-keto reductase; similar to aldose 6-phosphate   reductase also known as NADP-sorbitol-6-phosphate   dehydrogenase encoded by GenBank Accession Number   D11080. "	DPlate 090	H05			D41273	AU174297			23	O10
8400	g_8400	ST5402	>AOPRORICH_1(X82413|pid:g1531756) A.officinalis mRNA for   proline-rich-like protein. 	DPlate 092	H05			C25142	AU102024			23	P10
8401	g_8401	ST3927	">T1F15_13(AC004393|pid:g3176669) Arabidopsis thaliana chromosome 1   BAC T1F15 sequence, complete sequence; End is cut off.. "	DPlate 090	A11			AU033137				23	A22
8402	g_8402	ST5616		DPlate 092	A11			AU066206				23	B22
8403	g_8403	ST3935	">OSU25283_1(U25283|pid:g1753085) Oryza sativa clone OSE2 leucine   zipper protein mRNA, complete cds. "	DPlate 090	B11			AU108443	AU174305			23	C22
8404	g_8404	ST5680	">A48018(A48018;S29115;S29116;S29114)mucin 7 precursor, salivary -   human "	DPlate 092	B11			AU082281	AU174370			23	D22
8405	g_8405	ST3943	>EPRZ(S06427)phospholipid transfer protein homolog - rice 	DPlate 090	C11			D41439	AU174307			23	E22
8406	g_8406	ST5688		DPlate 092	C11			AU181054				23	F22
8407	g_8407	ST3983	">ATAC006439_17(AC006439|pid:g4309736) Arabidopsis thaliana   chromosome II BAC T30D6 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 090	D11			D41469	AU101988			23	G22
8408	g_8408	ST5825		DPlate 092	D11			C25293				23	H22
8409	g_8409	ST3960	">HVU89510_1(U89510|pid:g2586127) Hordeum vulgare b-keto acyl   reductase (glossy8) mRNA, complete cds. "	DPlate 090	E11			D41450	AU174309			23	I22
8410	g_8410	ST5843		DPlate 092	E11			AU181056				23	J22
8411	g_8411	ST3968	">ATAC003000_7(AC003000|pid:g2642158) Arabidopsis thaliana chromosome   II BAC T5I7 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 090	F11			D41456				23	K22
8412	g_8412	ST5859	>S61830(S61830;S65863;S60458;S37493;S44238;S49477)   subtilisin/chymotrypsin inhibitor - maize   &ZMCIMS_1(X69972|pid:g475922)   &ZMMPI_1(X78988|pid:g475253)   &ZMPIS7_1(X82187|pid:g559538) 	DPlate 092	F11			AU161827				23	L22
8413	g_8413	ST3906		DPlate 090	G11			D41415	AU033134			23	M22
8414	g_8414	ST5891	">ATF20B18_27(AL049483|pid:g4538945) Arabidopsis thaliana DNA   chromosome 4, BAC clone F20B18 (ESSA project);   similarity to thioredoxin - Lilium longiflorum,   PID:g308906; Contains Thioredoxin family active site   [IVDFYGTWCGSCRAMFPKL]; contains EST gb:N65681, T43004,   Ai100339. "	DPlate 092	G11			AU066245				23	N22
8415	g_8415	ST3939	">ATAC002505_8(AC002505|pid:g2739366) Arabidopsis thaliana chromosome   II BAC T9J22 genomic sequence, complete sequence; "	DPlate 090	H11			D41436	AU108444			23	O22
8416	g_8416	ST5812		DPlate 092	H11			C25289	AU102032			23	P22
8417	g_8417	ST6510		DPlate 094	A05			AU058150				24	A10
8418	g_8418	Nega01										24	B10
8419	g_8419	ST6518	">AF000949_1(AF000949|pid:g2352260) Canis familiaris keratin (KRT9)   gene, complete cds; found in intermediate filaments of   epidermal cells. "	DPlate 094	B05			AU181066				24	C10
8420	g_8420	Nega02										24	D10
8421	g_8421	ST6534		DPlate 094	C05			AU175174	AU176555			24	E10
8422	g_8422	Nega03										24	F10
8423	g_8423	ST6574		DPlate 094	D05			C25491	AU102072			24	G10
8424	g_8424	Nega04										24	H10
8425	g_8425	ST6519	>ATATP20A_1(X98806|pid:g1546694) A.thaliana mRNA for peroxidase   ATP20a; peroxidase ATP20a. 	DPlate 094	E05			C22712	C20522			24	I10
8426	g_8426	Nega01										24	J10
8427	g_8427	ST6551		DPlate 094	F05			AU033312				24	K10
8428	g_8428	Nega02										24	L10
8429	g_8429	ST6559	">ATAC007017_3(AC007017|pid:g4510363) Arabidopsis thaliana chromosome   II BAC F11F19 genomic sequence, complete sequence; "	DPlate 094	G05			C25488	AU174422			24	M10
8430	g_8430	Nega03										24	N10
8431	g_8431	ST6567		DPlate 094	H05			AU161978				24	O10
8432	g_8432	Nega04										24	P10
8433	g_8433	D94Water+D		DPlate 094	A11							24	A22
8434	g_8434	no clone										24	B22
8435	g_8435	D94Water+D		DPlate 094	B11							24	C22
8436	g_8436	no clone										24	D22
8437	g_8437	D94Water+D		DPlate 094	C11							24	E22
8438	g_8438	no clone										24	F22
8439	g_8439	D94Water+D		DPlate 094	D11							24	G22
8440	g_8440	no clone										24	H22
8441	g_8441	D94Water+D		DPlate 094	E11							24	I22
8442	g_8442	no clone										24	J22
8443	g_8443	D94Water+D		DPlate 094	F11							24	K22
8444	g_8444	no clone										24	L22
8445	g_8445	D94Water+D		DPlate 094	G11							24	M22
8446	g_8446	no clone										24	N22
8447	g_8447	D94Water+D		DPlate 094	H11							24	O22
8448	g_8448	no clone										24	P22
8449	g_8449	EG0227		DPlate 049	A06			AU029920				13	A11
8450	g_8450	EG0824		DPlate 051	A06							13	B11
8451	g_8451	EG0212	">PSY14272_1(Y14272|pid:g2695861) Pisum sativum mRNA for   3-deoxy-D-manno-2-octulosonate-8-phosphate synthase,   clone pPS40. &PSY14273_1(Y14273|pid:g2695863) "	DPlate 049	B06			AU058225	AU173569			13	C11
8452	g_8452	EG0848	>(P33278) PROTEIN TRANSLATION FACTOR SUI1 HOMOLOG (GOS2 PROTEIN).   &AF094774_1(AF094774|pid:g3789950)   &OSGOS2G_1(X51910|pid:g20238) &S21636(S21636) 	DPlate 051	B06			AU166208				13	D11
8453	g_8453	EG0236	>(P51848) PYRUVATE DECARBOXYLASE ISOZYME 2 (EC 4.1.1.1) (PDC).   &OSU27350_1(U27350|pid:g1009710)   &OSU38199_1(U38199|pid:g1777455) 	DPlate 049	C06			AU058236				13	E11
8454	g_8454	EG0864		DPlate 051	C06			AU065662	AU030289			13	F11
8455	g_8455	EG0252	>(P51615) MALATE OXIDOREDUCTASE (EC 1.1.1.40) (MALIC ENZYME) (ME)   (NADP- DEPENDENT MALIC ENZYME) (NADP-ME).   &VIIMDN_1(L34836|pid:g515759) 	DPlate 049	D06			AU029929	AU091693			13	G11
8456	g_8456	EG0872		DPlate 051	D06			AU030297	AU091694			13	H11
8457	g_8457	EG0214	>(Q38902) RAC-LIKE GTP BINDING PROTEIN ARAC1.   &ATU41295_1(U41295|pid:g1292908)   &ATU64919_1(U64919|pid:g4097563)   &TM017A05_2(AF024504|pid:g2435520) 	DPlate 049	E06			AU058227	AU082691			13	I11
8458	g_8458	EG0925	">ATAC004683_14(AC004683|pid:g3395435) Arabidopsis thaliana   chromosome II BAC T19C21 genomic sequence, complete   sequence; "	DPlate 051	E06			AU172972	AU030340			13	J11
8459	g_8459	EG0230	">AF031542_1(AF031542|pid:g2641201) Fritillaria agrestis ribosomal   protein L23a (rpl23a) mRNA, complete cds. "	DPlate 049	F06			AU082248	AU029921			13	K11
8460	g_8460	EG0949		DPlate 051	F06			C74762				13	L11
8461	g_8461	EG0238	">AC003027_12(AC003027|pid:g4204294) Arabidopsis thaliana chromosome   I BAC F21M11 genomic sequence, complete sequence;   Similar to human BC-2 protein; Similar to human BC-2   protein, gi|2828147. "	DPlate 049	G06			AU166166				13	M11
8462	g_8462	EG0902	">ATAC004261_2(AC004261|pid:g3402697) Arabidopsis thaliana chromosome   II BAC T3K9 genomic sequence, complete sequence. "	DPlate 051	G06			AU030317	AU030318			13	N11
8463	g_8463	EG0270		DPlate 049	H06			AU091967	AU058253			13	O11
8464	g_8464	EG0926	>ZMA010166_1(AJ010166|pid:g3445397) Zea mays mRNA for S-domain   receptor-like protein kinase. 	DPlate 051	H06			AU065674	AU030341			13	P11
8465	g_8465	EG0435	>STPRORICH_1(AJ000997|pid:g3402282) Solanum tuberosum mRNA for guard   cell proline-rich protein. 	DPlate 049	A12			AU172955	AU029984			13	A23
8466	g_8466	EG1039		DPlate 051	A12			AU030422	AU030423			13	B23
8467	g_8467	EG0443	">HVU37703_1(U37703|pid:g1022811) Hordeum vulgare ORF 62 mRNA,   chloroplast gene, encoding chloroplast protein, complete   cds. "	DPlate 049	B12			AU076182	AU076183			13	C23
8468	g_8468	EG1047		DPlate 051	B12			AU078760	AU058408			13	D23
8469	g_8469	EG0451		DPlate 049	C12			AU058319	AU091402			13	E23
8470	g_8470	EG1055	>ATEST44B7_1(Y10084|pid:g1922242) Arabidopsis thaliana matching EST   44B7; matches EST 44B7. 	DPlate 051	C12			AU065702	AU030436			13	F23
8471	g_8471	EG0483		DPlate 049	D12			AU058331				13	G23
8472	g_8472	EG1072	">ATT4L20_24(AL023094|pid:g3096935) Arabidopsis thaliana DNA   chromosome 4, BAC clone T4L20 (ESSAII project); contains   EST gb:T13919, R64807, Aa651026. "	DPlate 051	D12			AU065704	AU030445			13	H23
8473	g_8473	EG0452		DPlate 049	E12			AU029996				13	I23
8474	g_8474	EG1088		DPlate 051	E12			AU095061	AU058412			13	J23
8475	g_8475	EG0468	>(P08817) ACYL CARRIER PROTEIN II PRECURSOR (ACP II).   &BLYACL2_1(M63799|pid:g166969) 	DPlate 049	F12			AU030006	AU101473			13	K23
8476	g_8476	EG1109	>(P20346) PROBABLE PROTEASE INHIBITOR P322 PRECURSOR.   &S05594(S05594;S45659) &ST322R_1(X13180|pid:g21394) 	DPlate 051	F12			AU058417	AU095067			13	L23
8477	g_8477	EG0492		DPlate 049	G12			AU058333	AU091409			13	M23
8478	g_8478	EG1141		DPlate 051	G12			AU065720	AU030492			13	N23
8479	g_8479	EG0477	>(P52017) PEPTIDYL-PROLYL CIS-TRANS ISOMERASE 10 (EC 5.2.1.8)   (PPIASE) (ROTAMASE) (CYCLOPHILIN-10).   &CELB0252_4(U23453|pid:g733577)   &CEU34954_1(U34954|pid:g1155225) 	DPlate 049	H12			AU030008	AU078239			13	O23
8480	g_8480	EG1142	">ZMU64436_1(U64436|pid:g1498053) Zea mays ribosomal protein S8 mRNA,   complete cds. "	DPlate 051	H12			AU166227	AU030493			13	P23
8481	g_8481	EH0332	>S61625(S61625;S64879) hypothetical protein YLR051c - yeast   (Saccharomyces cerevisiae)   &SCLACHXII_8(X94607|pid:g1181272)   &SCYLR051C_1(Z73223|pid:g1360388) 	DPlate 053	A06			AU065182	AU091438			14	A11
8482	g_8482	EH1148		DPlate 055	A06			AU031208				14	B11
8483	g_8483	EH0348		DPlate 053	B06			AU030853	AU091444			14	C11
8484	g_8484	EH1180		DPlate 055	B06			AU095299	AU095300			14	D11
8485	g_8485	EH0364		DPlate 053	C06			AU030869	AU030870			14	E11
8486	g_8486	EH1233	>(Q09020) WOUND-INDUCED BASIC PROTEIN. &JS0731(JS0731)   &PHVPVPR4A_1(L00625|pid:g169365)   &PHVPVPR4_1(D12914|pid:g217989) 	DPlate 055	C06			AU031263				14	F11
8487	g_8487	EH0388	>D49993(D49993) ADP-ribosylation factor - Ajellomyces capsulata   &HTOARF_1(L25117|pid:g407693) 	DPlate 053	D06			AU082418	AU030883			14	G11
8488	g_8488	EH1241	>(P51425) 60S RIBOSOMAL PROTEIN L39.   &ZMRPL39_1(X95458|pid:g1177369) 	DPlate 055	D06			AU031265				14	H11
8489	g_8489	EH0457		DPlate 053	E06			AU065190	AU095173			14	I11
8490	g_8490	EH1249	">D45423_1(D45423|pid:g1321661) Rice mRNA for ascorbate peroxidase,   complete cds. "	DPlate 055	E06			AU162336				14	J11
8491	g_8491	EH0410	">F12F1_27(AC002131|pid:g3157951) Arabidopsis thaliana chromosome 1   BAC F12F1 sequence, complete sequence; Contains   similarity to vesicle trafficking protein gb|U91538 from   Mus musculus. ESTs gb|F15494 and gb|F14097 come from   this gene.. "	DPlate 053	F06			AU030897	AU030898			14	K11
8492	g_8492	EH1257		DPlate 055	F06			AU175135				14	L11
8493	g_8493	EH0411	>(P38858) SOL3 PROTEIN. &S48903(S48903;S70386)   &SCU46560_1(U46560|pid:g1184943)   &YSCH9986_2(U00027|pid:g458904) 	DPlate 053	G06			AU065188	AU165895			14	M11
8494	g_8494	EH1281		DPlate 055	G06			AU031285	AU166251			14	N11
8495	g_8495	EH0443		DPlate 053	H06			AU165901	AU030923			14	O11
8496	g_8496	EH1274		DPlate 055	H06			AU031280				14	P11
8497	g_8497	EH0757	">AF036340_1(AF036340|pid:g3158394) Arabidopsis thaliana   LRR-containing F-box protein (COI1) mRNA, complete cds.    &ATAF002109_9(AF002109|pid:g2088647) "	DPlate 053	A12			AU075473	AU075474			14	A23
8498	g_8498	EH1348		DPlate 055	A12			AU164804				14	B23
8499	g_8499	EH0773	>OSTRAMBPR_1(Y08962|pid:g1632822) O.sativa mRNA for transmembrane   protein. &OSU77297_1(U77297|pid:g1667594) 	DPlate 053	B12			AU173020	AU075489			14	C23
8500	g_8500	EH1364	>F17O7_4(AC003671|pid:g3176675) Arabidopsis thaliana chromosome 1   BAC F17O7 complete sequence; 	DPlate 055	B12			AU164808	AU164809			14	D23
8501	g_8501	EH0702	">ATAC005395_9(AC005395|pid:g3643610) Arabidopsis thaliana chromosome   II BAC F17H15 genomic sequence, complete sequence; "	DPlate 053	C12			AU031061	AU075433			14	E23
8502	g_8502	EH1380		DPlate 055	C12			AU101545	AU101546			14	F23
8503	g_8503	EH0710	>(P31924) SUCROSE SYNTHASE 2 (EC 2.4.1.13) (SUCROSE-UDP   GLUCOSYLTRANSFERASE 2). &ORRSS2_1(X59046|pid:g20095) 	DPlate 053	D12			AU173014	AU031064			14	G23
8504	g_8504	EH1409	">ATFCA6_10(Z97341|pid:g2245001) Arabidopsis thaliana DNA chromosome   4, ESSA I contig fragment No. 6; similarity to NADH   dehydrogenase (ubiquinone). &C71431(C71431) "	DPlate 055	D12			AU164821	AU173044			14	H23
8505	g_8505	EH0726	">AC002130_8(AC002130|pid:g2760323) The sequence of BAC F1N21 from   Arabidopsis thaliana chromosome 1, complete sequence;   unknown. "	DPlate 053	E12			AU031070	AU075449			14	I23
8506	g_8506	EH1425	">ATAC004669_22(AC004669|pid:g3201627) Arabidopsis thaliana chromosome   II BAC F7F1 genomic sequence, complete sequence; "	DPlate 055	E12			AU164827	AU031367			14	J23
8507	g_8507	EH0742	">CET25C8_1(Z83241|pid:g3880219) Caenorhabditis elegans cosmid T25C8,   complete sequence; similar to Actins; cDNA EST   EMBL:D70786 comes from this gene; cDNA EST EMBL:T00052   comes from this gene; cDNA EST EMBL:T01387 comes from   this gene; cDNA EST EMBL:Z14648 comes from this gene. "	DPlate 053	F12			AU075462	AU031080			14	K23
8508	g_8508	EH1433		DPlate 055	F12			AU181004				14	L23
8509	g_8509	EH0774	">AF004216_1(AF004216|pid:g2224933) Arabidopsis thaliana   ethylene-insensitive3 (EIN3) mRNA, complete cds.   &AF004217_1(AF004217|pid:g2224935) "	DPlate 053	G12			AU075490	AU031090			14	M23
8510	g_8510	EH1457		DPlate 055	G12			AU164833				14	N23
8511	g_8511	EH0782	">AB018441_1(AB018441|pid:g3759184) Nicotiana tabacum phi-1 mRNA,   complete cds. "	DPlate 053	H12			C74905	AU173021			14	O23
8512	g_8512	EH1450		DPlate 055	H12			AU162352	AU031377			14	P23
8513	g_8513	EH1979		DPlate 057	A06			AU164477				15	A11
8514	g_8514	FE0412		DPlate 059	A06			AU174812				15	B11
8515	g_8515	EH1916	>(P48502) UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX 14 KD PROTEIN (EC   1.10.2.2) (CR14). &STCR14_1(X79276|pid:g633681) 	DPlate 057	B06			AU162374	AU031590			15	C11
8516	g_8516	FE0420	">AF040631_1(AF040631|pid:g2921756) Arabidopsis thaliana IAA17/AXR3   protein (AXR3) gene, complete cds; Aux/IAA protein;   alleles shown result in dominant phenotypes.   &ATU49073_1(U49073|pid:g2618723)   &F19P19_31(AC000104|pid:g4389514) "	DPlate 059	B06			AU174821				15	D11
8517	g_8517	EH1932		DPlate 057	C06			AU162375	AU031601			15	E11
8518	g_8518	FE0444	">ATAC006234_12(AC006234|pid:g4454484) Arabidopsis thaliana   chromosome II BAC F5H14 genomic sequence, complete   sequence; "	DPlate 059	C06			AU174835	AU174834			15	F11
8519	g_8519	EH1948		DPlate 057	D06			AU031603	AU095406			15	G11
8520	g_8520	FE0476	>AF003534_64(AF003534|pid:g2738449) Chilo iridescent virus partial   genomic sequence; protein 096R. 	DPlate 059	D06			AU174863	AU174862			15	H11
8521	g_8521	FE0041		DPlate 057	E06			AU174564	AU174563			15	I11
8522	g_8522	FE0445		DPlate 059	E06			AU174837	AU174836			15	J11
8523	g_8523	FE0049	">AF044173_1(AF044173|pid:g3290022) Solanum tuberosum cysteine   synthase mRNA, nuclear gene encoding plastid protein,   complete cds; CS-B; O-acetylserine (thiol) lyase;   plastidic isoform. "	DPlate 057	F06			AU174565	AU174566			15	K11
8524	g_8524	FE0453		DPlate 059	F06			AU174845	AU174844			15	L11
8525	g_8525	FE0057	">ATAC006587_14(AC006587|pid:g4510405) Arabidopsis thaliana   chromosome II BAC T17D12 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 057	G06			AU174575	AU174574			15	M11
8526	g_8526	FE0469		DPlate 059	G06			AU174856				15	N11
8527	g_8527	FE0081		DPlate 057	H06			AU174591				15	O11
8528	g_8528	FE0493	>ASRBCS_1(X84730|pid:g671740) Artificial rbcS gene sequence. 	DPlate 059	H06			AU174875	AU174874			15	P11
8529	g_8529	FE0126	">AF039532_1(AF039532|pid:g2801538) Oryza sativa harpin induced gene   1 homolog (Hin1) mRNA, complete cds. "	DPlate 057	A12			AU174621				15	A23
8530	g_8530	FL0014	>CHOSPSBF_1(X12695|pid:g11953) Rice chloroplast psbH gene for 10 kD   phosphoprotein potential component of photosystem II; 10   kD phosphoprotein (AA 1 - 73).   &CHOSXX_55(X15901|pid:g12016)   &F2RZ0P(JQ0253;S05133;S01905) 	DPlate 059	A12			AU174887	AU174886			15	B23
8531	g_8531	FE0134	">ATF26P21_17(AL031804|pid:g3688186) Arabidopsis thaliana DNA   chromosome 4, BAC clone F26P21 (ESSAII project);   contains EST gb:T13833, T46155. "	DPlate 057	B12			AU174625	AU174624			15	C23
8532	g_8532	FL0022	">AB007194_1(AB007194|pid:g3041777) Oryza sativa mRNA for   fructose-1,6-bisphosphatase (plastidic isoform),   complete cds; plastidic isoform. "	DPlate 059	B12			AU176499				15	D23
8533	g_8533	FE0150	">ATAC006232_18(AC006232|pid:g4314401) Arabidopsis thaliana   chromosome II BAC F10A12 genomic sequence, complete   sequence; "	DPlate 057	C12			AU174632	AU174633			15	E23
8534	g_8534	FL0054	">AF017362_1(AF017362|pid:g2407279) Oryza sativa aldolase mRNA,   complete cds. "	DPlate 059	C12			AU174922				15	F23
8535	g_8535	FE0158		DPlate 057	D12			AU174639				15	G23
8536	g_8536	FL0094		DPlate 059	D12			AU174963				15	H23
8537	g_8537	FE0166		DPlate 057	E12			AU174643				15	I23
8538	g_8538	FL0015	">F5O8_11(AC005990|pid:g4056438) Arabidopsis thaliana chromosome 1   BAC F5O8 sequence, complete sequence; "	DPlate 059	E12			AU174889	AU174888			15	J23
8539	g_8539	FE0174		DPlate 057	F12			AU174653	AU174652			15	K23
8540	g_8540	FL0023	>(P49292) PHOSPHOENOLPYRUVATE CARBOXYKINASE (ATP) (EC 4.1.1.49).   &S52988(S52988;S77950) &UP09241_1(U09241|pid:g607752) 	DPlate 059	F12			AU174895	AU174894			15	L23
8541	g_8541	FE0182		DPlate 057	G12			AU174660	AU174659			15	M23
8542	g_8542	FL0047	">F8K4_23(AC004392|pid:g3367536) Arabidopsis thaliana chromosome 1   BAC F8K4 sequence, complete sequence; Contains   similarity to symbiosis-related like protein F1N20.80   gi|2961343 from A. thaliana BAC gb|AL022140. EST   gb|T04695 comes from this gene.. "	DPlate 059	G12			AU174914	AU174915			15	N23
8543	g_8543	FE0111	">AF008220_12(AF008220|pid:g2293288) Bacillus subtilis rrnB-dnaB   genomic region; similar to with dTDP glucose   4,6-dehydratase of S.griseus.   &BSUB0016_160(Z99119|pid:g2635571) &H69988(H69988) "	DPlate 057	H12			AU174610	AU174611			15	O23
8544	g_8544	FL0071	">AF094775_1(AF094775|pid:g3789952) Oryza sativa chlorophyll   a/b-binding protein presursor (Cab27) mRNA, nuclear gene   encoding chloroplast protein, complete cds; 27 KDa. "	DPlate 059	H12			AU174937	AU174936			15	P23
8545	g_8545	RA0449	">AF116553_1(AF116553|pid:g4530425) Drosophila melanogaster   antennal-specific short-chain dehydrogenase/reductase   (antdh) mRNA, complete cds; ANTDH. "	DPlate 061	A06			D23862	AU101609			16	A11
8546	g_8546	RA1341	>AE000225_8(AE000225|pid:g1787531) Escherichia coli K-12 MG1655   section 115 of 400 of the complete genome; o891; 99 pct   identical to ACO1_ECOLI SW: P25516; CG Site No. 28218.   &G64875(G64875;S22375;A49756) 	DPlate 063	A06			AU176514				16	B11
8547	g_8547	RA0481	">OSU95968_1(U95968|pid:g2224915) Oryza sativa beta-expansin mRNA,   complete cds; cell wall loosening protein. "	DPlate 061	B06			D39004	AU164552			16	C11
8548	g_8548	RA1357	">MTAJ2479_1(AJ002479|pid:g3492803) Medicago truncatula ENBP1 gene,   exons 1 to 12. "	DPlate 063	B06			D24117	AU031738			16	D11
8549	g_8549	RA0489		DPlate 061	C06			AU070172	AU173098			16	E11
8550	g_8550	RA1381	">ATAC006403_6(AC006403|pid:g4337192) Arabidopsis thaliana chromosome   II BAC T28I24 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 063	C06			D24121	AU101652			16	F11
8551	g_8551	RA0458	">ATAC006284_1(AC006284|pid:g4335745) Arabidopsis thaliana chromosome   II BAC T4M8 genomic sequence, complete sequence. "	DPlate 061	D06			AU173094				16	G11
8552	g_8552	RA1390	>(P25460) 40S RIBOSOMAL PROTEIN S11. &S16577(S16577)   &ZMRPS11C_1(X55967|pid:g22470) 	DPlate 063	D06			AU173143	AU173144			16	H11
8553	g_8553	RA0466	">ATAC006223_18(AC006223|pid:g4263712) Arabidopsis thaliana   chromosome II BAC F22D22 genomic sequence, complete   sequence; "	DPlate 061	E06			D23869	AU082119			16	I11
8554	g_8554	RA1311	">DMC62D9_8(AL009171|pid:g2655902) Drosophila melanogaster cosmid   62D9, WORKING DRAFT SEQUENCE; predicted using   Genefinder; preliminary prediction. "	DPlate 063	E06			D24104	AU162407			16	J11
8555	g_8555	RA0474	">S44069(S44069;S67127) ribosomal protein L35a.e.c15, cytosolic -   yeast (Saccharomyces cerevisiae)   &SCYOR234C_1(Z75142|pid:g1420537)   &YSCRPL37_1(L23923|pid:g484241) "	DPlate 061	F06			D23872	AU101611			16	K11
8556	g_8556	RA1319		DPlate 063	F06			AU173140	AU173141			16	L11
8557	g_8557	RA0411	>(P46466) 26S PROTEASE REGULATORY SUBUNIT 4 HOMOLOG (TAT-BINDING   PROTEIN HOMOLOG 2). &RICHTBP2_1(D17789|pid:g556558) 	DPlate 061	G06			D23852	AU031666			16	M11
8558	g_8558	RA1335	>(P49087) VACUOLAR ATP SYNTHASE CATALYTIC SUBUNIT A (EC 3.6.1.34)   (V-ATPASE 69 KD SUBUNIT) (FRAGMENT).   &ZMU36436_1(U36436|pid:g1049253) 	DPlate 063	G06			D24110	AU095449			16	N11
8559	g_8559	RA0451	>(Q08704) CHALCONE--FLAVONONE ISOMERASE (EC 5.5.1.6).   &S41570(S41570;S35932) &ZMCHIGNA_1(Z22760|pid:g396149) 	DPlate 061	H06			AU164550				16	O11
8560	g_8560	RA1343		DPlate 063	H06			AU070185				16	P11
8561	g_8561	RA0556	">ATAF000657_3(AF000657|pid:g2462822) Arabidopsis thaliana BAC   F19G10, complete sequence; hypothetical protein. "	DPlate 061	A12			D23908	AU164575			16	A23
8562	g_8562	RA1574	>(P15847) 41-2 PROTEIN ANTIGEN PRECURSOR. &A45503(A45503)   &PFA412ANT_1(J04656|pid:g160039) 	DPlate 063	A12			D24245	AU173173			16	B23
8563	g_8563	RA0564	>(P52810) 40S RIBOSOMAL PROTEIN S9 (S7).   &PASU12_1(X96613|pid:g1321917) 	DPlate 061	B12			D39008	AU164577			16	C23
8564	g_8564	RA1582	">ATAC004165_19(AC004165|pid:g3150415) Arabidopsis thaliana   chromosome II BAC T27E13 genomic sequence, complete   sequence; &ATAC004680_3(AC004680|pid:g3420046) "	DPlate 063	B12			AU031769	AU031768			16	D23
8565	g_8565	RA0588		DPlate 061	C12			D23927	AU101622			16	E23
8566	g_8566	RA1590	">ATF23E12_14(AL022604|pid:g3080420) Arabidopsis thaliana DNA   chromosome 4, BAC clone F23E12 (ESSAII project); strong   similarity to sugar transporter, Arabidopsis thaliana,   db_xref=PID:g1495273; Contains Sugar transport proteins   signatures [SGGVADWLGRRPMLILS]   [LDGFGVGLVVTLVPIYISETAPPEIR]. "	DPlate 063	C12			D24257	AU173175			16	F23
8567	g_8567	RA0596	>(P46420) GLUTATHIONE S-TRANSFERASE IV (EC 2.5.1.18) (GST-IV)   (GST-27) (CLASS PHI). 	DPlate 061	D12			D28287	AU031696			16	G23
8568	g_8568	RA1519	>(Q01101) ZINC FINGER PROTEIN IA-1 (INSULINOMA-ASSOCIATED PROTEIN   1). &A42750(A42750;A54088)   &HUMIA1X_1(M93119|pid:g184511) 	DPlate 063	D12			D28299	AU031757			16	H23
8569	g_8569	RA0601	>(P54968) IAA-AMINO ACID HYDROLASE (EC 3.5.1.-).   &ATU23794_1(U23794|pid:g887785) 	DPlate 061	E12			D23932	AU164584			16	I23
8570	g_8570	RA1559	">ATAC006921_7(AC006921|pid:g4510345) Arabidopsis thaliana chromosome   II BAC F2H17 genomic sequence, complete sequence;   unknown protein. "	DPlate 063	E12			D28300	AU031764			16	J23
8571	g_8571	RA0609	>MM26SPROT_1(Y13071|pid:g2505940) Mus musculus mRNA for 26S   proteasome non-ATPase subunit. 	DPlate 061	F12			D39011	AU082098			16	K23
8572	g_8572	RA1504		DPlate 063	F12			D39060	AU176517			16	L23
8573	g_8573	RA0617	>(Q08479) ADENYLATE KINASE A (EC 2.7.4.3) (ATP-AMP   TRANSPHOSPHORYLASE). &RICADKA_1(D10334|pid:g391877) 	DPlate 061	G12			D23938				16	M23
8574	g_8574	RA1520	>S78568(S78568)snRNP protein SMX4 - yeast (Saccharomyces cerevisiae)   	DPlate 063	G12			D24201	AU173165			16	N23
8575	g_8575	RA0665	">AF079485_1(AF079485|pid:g3702964) Arabidopsis thaliana rac GTP   binding protein Arac10 (Arac10) mRNA, complete cds;   similar to the Arabidopsis thaliana sequence presented   in GenBank Accession Number AB009053. "	DPlate 061	H12			D23963	AU082698			16	O23
8576	g_8576	RA1528		DPlate 063	H12			D24209				16	P23
8577	g_8577	RA1952		DPlate 065	A06			D24457	AU031821			17	A11
8578	g_8578	RA2752	">AC002130_5(AC002130|pid:g2760334) The sequence of BAC F1N21 from   Arabidopsis thaliana chromosome 1, complete sequence;   similar to ESTs gb|R65104, gb|H75115, dbj|D23573, and   gb|L37629. "	DPlate 067	A06			D24910	AU031944			17	B11
8579	g_8579	RA1960	">ATAC006439_15(AC006439|pid:g4309734) Arabidopsis thaliana   chromosome II BAC T30D6 genomic sequence, complete   sequence; "	DPlate 065	B06			D28308	AU031824			17	C11
8580	g_8580	RA2776	>ATH131580_1(AJ131580|pid:g4049401) Arabidopsis thaliana mRNA for   glutathione transferase AtGST 10. 	DPlate 067	B06			D24913	AU101666			17	D11
8581	g_8581	RA1968	">AF006078_1(AF006078|pid:g4101703) Solanum berthaultii glucose   acyltransferase (pldp15) mRNA, complete cds; serine   carboxypeptidase-like enzyme; contains a. "	DPlate 065	C06			D24463	AU173270			17	E11
8582	g_8582	RA2784		DPlate 067	C06			D24920	AU173397			17	F11
8583	g_8583	RA1905	">ATAC003672_26(AC003672|pid:g3341697) Arabidopsis thaliana   chromosome II BAC F16B22 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 065	D06			D39084	AU173255			17	G11
8584	g_8584	RA2792	">ATAC002343_8(AC002343|pid:g2262105) Arabidopsis thaliana BAC T19F06   genomic sequence, complete sequence; unknown protein. "	DPlate 067	D06			D24925	AU031949			17	H11
8585	g_8585	RA1921	">ATU64906_1(U64906|pid:g4097547) Arabidopsis thaliana farnesylated   protein ATFP3 mRNA, partial cds; farnesylated protein. "	DPlate 065	E06			AU173256	AU173257			17	I11
8586	g_8586	RA2729	>(P19951) 40S RIBOSOMAL PROTEIN S14 (CLONE MCH2). &B30097(B30097) 	DPlate 067	E06			D24897				17	J11
8587	g_8587	RA1929	">AC002328_3(AC002328|pid:g3953458) Genomic sequence for Arabidopsis   thaliana BAC F20N2, complete sequence; unknown; similar   to uridine kinase (Z99117); similar to uracil   phosphoribosyl transferase (AL022223); similar to ESTs   gb|T46383, gb|N99614, and gb|AA979998. "	DPlate 065	F06			AU173262	AU173263			17	K11
8588	g_8588	RA2761	">ZMU92045_1(U92045|pid:g1917019) Zea mays ribosomal protein S6   RPS6-1 (rps6-1) mRNA, complete cds. "	DPlate 067	F06			AU173393	AU173394			17	L11
8589	g_8589	RA1937	>S22697(S22697;S21006) extensin - Volvox carteri (fragment)   &VCISGMR_1(X65165|pid:g21992) 	DPlate 065	G06			AU173264				17	M11
8590	g_8590	RA2777		DPlate 067	G06			D24914	AU108933			17	N11
8591	g_8591	RA1977	>(Q09305) HYPOTHETICAL 41.7 KD PROTEIN F10B5.2 IN CHROMOSOME II.   &CEF10B5_2(Z48334|pid:g3875710) 	DPlate 065	H06			D39107	AU173273			17	O11
8592	g_8592	RA2785	>ATA005901_1(AJ005901|pid:g3717946) Arabidopsis thaliana mRNA for   V-ATPase subunit G (vag1 gene). 	DPlate 067	H06			D39163	AU031948			17	P11
8593	g_8593	RA2070	">AF083395_1(AF083395|pid:g4106818) Homo sapiens phospholipase   A2-activating protein mRNA, complete cds; PLAP; similar   to Rattus norvegicus PLAP: SwissProt Accession Number   P27612 and Mus musculus PLAP encoded by GenBank Accession   Number U17901; human PLAP is longer at its C terminus   when compared to Rattus norvegicus and Mus musculus PLAP.   "	DPlate 065	A12			D24502	AU173301			17	A23
8594	g_8594	RA2969		DPlate 067	A12			D25041				17	B23
8595	g_8595	RA2094	">ATAP22_40(Z99708|pid:g4006915) Arabidopsis thaliana DNA chromosome   4, ESSA I AP2 contig fragment No. 2; "	DPlate 065	B12			D24522	AU173306			17	C23
8596	g_8596	RA2985	">AF056027_1(AF056027|pid:g3377509) Oryza sativa auxin transport   protein REH1 (REH1) mRNA, complete cds; potential   membrane protein. "	DPlate 067	B12			D25054	AU173415			17	D23
8597	g_8597	RA2007	">F7G19_25(AC000106|pid:g2342690) Sequence of BAC F7G19 from   Arabidopsis thaliana chromosome 1, complete sequence;   Similar to Homo copine I (gb|U83246).. "	DPlate 065	C12			D24467	AU031832			17	E23
8598	g_8598	RA2993	>(P31924) SUCROSE SYNTHASE 2 (EC 2.4.1.13) (SUCROSE-UDP   GLUCOSYLTRANSFERASE 2). &ORRSS2_1(X59046|pid:g20095) 	DPlate 067	C12			AU176523				17	F23
8599	g_8599	RA2015	">RICP_1(D49551|pid:g1272505) Rice poxN gene for peroxidase, exon1-4,   complete cds. "	DPlate 065	D12			D24472	AU031833			17	G23
8600	g_8600	RA2954	">BOU15178_1(U15178|pid:g557472) Bacteroides ovatus arabinosidase   (asdI) gene, complete cds. "	DPlate 067	D12			D25027	AU031971			17	H23
8601	g_8601	RA2031	>(P41378) EUKARYOTIC INITIATION FACTOR 4A (EIF-4A). &JN0839(JN0839)   	DPlate 065	E12			D24486	AU173292			17	I23
8602	g_8602	RA2962		DPlate 067	E12			D25034	AU173411			17	J23
8603	g_8603	RA2055	">ATF22I13_17(AL035539|pid:g4539348) Arabidopsis thaliana DNA   chromosome 4, BAC clone F22I13 (ESSA project); strong   similarity to pollen allergen - Pinu. "	DPlate 065	F12			D24493	AU173294			17	K23
8604	g_8604	RA2986	">PTY13769_1(Y13769|pid:g3805956) Populus trichocarpa mRNA for   laccase, lac1 gene, partial. "	DPlate 067	F12			D25055	AU173416			17	L23
8605	g_8605	RA2063	>(Q06509) BISPECIFIC CAFFEIC ACID / 5-HYDROXYFERULIC ACID   O-METHYLTRANSFERASE (EC 2.1.1.-).   &MZEOMTH_1(M73235|pid:g168532) &S28612(S28612) 	DPlate 065	G12			D24498	AU173298			17	M23
8606	g_8606	RA2907		DPlate 067	G12			AU173402				17	N23
8607	g_8607	RA2071	">ATAP21_47(Z99707|pid:g4006882) Arabidopsis thaliana DNA chromosome   4, ESSA I AP2 contig fragment No. 1; similarity to   glycoprotein specific UDP-glucuronyltransferase - Rattus   norvegicus, PATchX:D1021387; contains EST gb:AA042349. "	DPlate 065	H12			D24503	AU101657			17	O23
8608	g_8608	RA2947		DPlate 067	H12			D25022				17	P23
8609	g_8609	RA3364	>(P52914) NUCLEOSIDE-TRIPHOSPHATASE (EC 3.6.1.15) (NUCLEOSIDE   TRIPHOSPHATE PHOSPHOHYDROLASE) (NTPASE).   &AB022319_1(AB022319|pid:g4519173)   &PSNTPASE_1(Z32743|pid:g563612) &S48859(S65147;S48859) 	DPlate 069	A06			AU181074				18	A11
8610	g_8610	RB0022	">YSC83N84O_2(L06795|pid:g600708) Saccharomyces cerevisiae open   reading frames YSC83 and YSC84, complete cds; YSC84   contains an SH3 (A box) domain (aa 329-382); putative. "	DPlate 071	A06			AU076219				18	B11
8611	g_8611	RA3372		DPlate 069	B06			AU181075				18	C11
8612	g_8612	RB0030		DPlate 071	B06			AU076221	AU095568			18	D11
8613	g_8613	RA3380	">AB017357_1(AB017357|pid:g3986289) Ipomoea batatas mRNA for   L-Galactono-1,4-lactone dehydrogenase, complete cds. "	DPlate 069	C06			D39346	AU032055			18	E11
8614	g_8614	RB0054	">ATU64905_1(U64905|pid:g4097545) Arabidopsis thaliana farnesylated   protein ATFP2 mRNA, partial cds; farnesylated protein. "	DPlate 071	C06			AU070673				18	F11
8615	g_8615	RA3396		DPlate 069	D06			D39357	AU173505			18	G11
8616	g_8616	RB0062		DPlate 071	D06			AU076226	AU173833			18	H11
8617	g_8617	RA3417	">F20P5_18(AC002062|pid:g2194142) Sequence of BAC F20P5 from   Arabidopsis thaliana chromosome 1, complete sequence;   ESTs gb|N38288,gb|T43486,gb|AA395242 come from this   gene.. "	DPlate 069	E06			AU101675	AU101676			18	I11
8618	g_8618	RB0086		DPlate 071	E06			AU070689	AU101688			18	J11
8619	g_8619	RA3473	">AF032974_1(AF032974|pid:g2655291) Oryza sativa germin-like protein   4 (GER4) mRNA, complete cds; similar to wheat and barley   oxalate oxidase. "	DPlate 069	F06			AU032081	AU173514			18	K11
8620	g_8620	RB0031	">ATAC005727_10(AC005727|pid:g3927831) Arabidopsis thaliana   chromosome II BAC F8N16 genomic sequence, complete   sequence; "	DPlate 071	F06			AU162563	AU070662			18	L11
8621	g_8621	RA3481	>(P14654) GLUTAMINE SYNTHETASE ROOT ISOZYME (EC 6.3.1.2)   (GLUTAMATE--AMMONIA LIGASE) (CLONE LAMBDA-GS8).   &AJRZQB(S07469) &OSRIGS8_1(X14244|pid:g20358) 	DPlate 069	G06			AU032085	AU173516			18	M11
8622	g_8622	RB0047	">ATU49072_1(U49072|pid:g2618721) Arabidopsis thaliana early   auxin-induced (IAA16) mRNA, complete cds; early   auxin-induced gene; member of a multigene family of   early auxin-induced genes isolated from Arabidopsis   using yeast two-hybrid system with IAA1. "	DPlate 071	G06			AU076222				18	N11
8623	g_8623	RA3410		DPlate 069	H06			AU032062	AU101672			18	O11
8624	g_8624	RB0040		DPlate 071	H06			AU070667	AU163456			18	P11
8625	g_8625	RA3625	">U97553_15(U97553|pid:g2317972) Murine herpesvirus 68 strain WUMS,   complete genome. "	DPlate 069	A12			AU162501	AU032141			18	A23
8626	g_8626	RB0238	">ATF19F18_10(AL035605|pid:g4468986) Arabidopsis thaliana DNA   chromosome 4, BAC clone F19F18 (ESSA project);   similarity to SPOP, Homo sapiens, AJ000644. "	DPlate 071	A12			AU162578	AU070785			18	B23
8627	g_8627	RA3641	">AC003970_12(AC003970|pid:g3482921) Arabidopsis thaliana chromosome   I BAC F14J9 genomic sequence contains phyA marker,   complete sequence; Unknown protein; Location of EST   192N12T7, gb|R90355. "	DPlate 069	B12			AU032158	AU175073			18	C23
8628	g_8628	RB0246		DPlate 071	B12			AU070789				18	D23
8629	g_8629	RA3673	>(P38992) SUR2 PROTEIN (SYRINGOMYCIN RESPONSE PROTEIN 2).   &S48533(S48533;S61183;S48540)   &SCU07171_1(U07171|pid:g458718)   &SCU10427_1(U10427|pid:g1786173)   &YSCD9740_3(U28374|pid:g849215) 	DPlate 069	C12			AU173530	AU173531			18	E23
8630	g_8630	RB0262		DPlate 071	C12			AU173845				18	F23
8631	g_8631	RA3602	">ZMU82200_1(U82200|pid:g3290004) Zea mays pathogenesis related   protein-1 (PR-1) mRNA, complete cds. "	DPlate 069	D12			AU032128	AU173521			18	G23
8632	g_8632	RB0215		DPlate 071	D12			AU070766	AU101692			18	H23
8633	g_8633	RA3610		DPlate 069	E12			AU065411	AU083495			18	I23
8634	g_8634	RB0223	">ATAC002387_27(AC002387|pid:g2583132) Arabidopsis thaliana   chromosome II BAC F4L23 genomic sequence, complete   sequence; unknown protein. "	DPlate 071	E12			AU083499	AU070771			18	J23
8635	g_8635	RA3626	>(P53492) ACTIN 2. &(P53495) ACTIN 7.   &ATU27811_1(U27811|pid:g1943863)   &ATU37281_1(U37281|pid:g1049307) &S68107(S68107;S71210) 	DPlate 069	F12			AU162502	AU032142			18	K23
8636	g_8636	RB0295	>(P14654) GLUTAMINE SYNTHETASE ROOT ISOZYME (EC 6.3.1.2)   (GLUTAMATE--AMMONIA LIGASE) (CLONE LAMBDA-GS8).   &AJRZQB(S07469) &OSRIGS8_1(X14244|pid:g20358) 	DPlate 071	F12			AU070815	AU092007			18	L23
8637	g_8637	RA3634		DPlate 069	G12			AU065413	AU101683			18	M23
8638	g_8638	RB0302		DPlate 071	G12			AU070817				18	N23
8639	g_8639	RA3642		DPlate 069	H12			AU032159	AU032160			18	O23
8640	g_8640	RB0310		DPlate 071	H12			AU070822	AU082741			18	P23
8641	g_8641	RB0831	">ATF28M11_2(AL049487|pid:g4538974) Arabidopsis thaliana DNA   chromosome 4, BAC clone F28M11 (ESSA project). "	DPlate 073	A06			AU071158				19	A11
8642	g_8642	SA0327	>HSPM5_1(X57398|pid:g1335273) Human mRNA for pM5 protein; Protein   sequence is in conflict with the conceptual translation..   &S21977(S21977) 	DPlate 075	A06			AU056143	AU056144			19	B11
8643	g_8643	RB0847		DPlate 073	B06			AU071165				19	C11
8644	g_8644	SA0335	>A53054(A53054)lipoxygenase L-2 - rice 	DPlate 075	B06			AU056155	AU056156			19	D11
8645	g_8645	RB0855		DPlate 073	C06			AU071172				19	E11
8646	g_8646	SA0359		DPlate 075	C06			AU056187				19	F11
8647	g_8647	RB0871	">T1G11_11(AC002376|pid:g2494127) Sequence of BAC T1G11 from   Arabidopsis thaliana chromosome 1, complete sequence;   Contains similarity to Mycobacterium LIPB gene   (gb|Q104041).. "	DPlate 073	D06			AU071186	AU101709			19	G11
8648	g_8648	SA0375	">ATAC003028_17(AC003028|pid:g3335372) Arabidopsis thaliana   chromosome II BAC F16M14 genomic sequence, complete   sequence; "	DPlate 075	D06			AU056205	AU056206			19	H11
8649	g_8649	RB0887	">ATF24G24_10(AL049488|pid:g4538959) Arabidopsis thaliana DNA   chromosome 4, BAC clone F24G24 (ESSA project);   similarity to predicted protein, Arabidopsis thaliana. "	DPlate 073	E06			AU071196				19	I11
8650	g_8650	SA0383	">AC002130_9(AC002130|pid:g2760324) The sequence of BAC F1N21 from   Arabidopsis thaliana chromosome 1, complete sequence;   similar to EST gb|T75851. "	DPlate 075	E06			AU056212	AU056213			19	J11
8651	g_8651	RB0840	>ATMYBR1_1(Z54136|pid:g1263095) A.thaliana mRNA for MYB-related   protein (1195 bp). &S71284(S71284) 	DPlate 073	F06			AU071160	AU081586			19	K11
8652	g_8652	SA0312	">ATF7H19_10(AL031018|pid:g3292817) Arabidopsis thaliana DNA   chromosome 4, BAC clone F7H19 (ESSAII project); "	DPlate 075	F06			AU070253	AU173879			19	L11
8653	g_8653	RB0856	>S28185(S28185)phenylalanine ammonia-lyase (EC 4.3.1.5) - rice 	DPlate 073	G06			AU071173				19	M11
8654	g_8654	SA0352	">AF080436_1(AF080436|pid:g3450842) Oryza sativa mitogen activated   protein kinase kinase (MEK1) mRNA, complete cds; MAP   kinase kinase. "	DPlate 075	G06			AU056176	AU056177			19	N11
8655	g_8655	RB0957	>CAA005348_1(AJ005348|pid:g3043432) Cicer arietinum mRNA for   ubiquitin conjugating enzyme. 	DPlate 073	H06			AU071246				19	O11
8656	g_8656	SA0368	">AC005275_33(AC005275|pid:g4262169) Arabidopsis thaliana BAC F4C21   from chromosome IV, top arm, near 17 cM, complete   sequence; identical to F9H3.2, GenBank accession number   AF071527; weakly similar to rodent 22 kD peroxisomal   membrane protein; functional catalog ID=99.   &AF071527_16(AF071527|pid:g4206195) "	DPlate 075	H06			AU181020				19	P11
8657	g_8657	SA0060	>(P23514) COATOMER BETA SUBUNIT (BETA-COAT PROTEIN) (BETA-COP).   &RNBCOP_1(X57228|pid:g55819) &S13520(S13520) 	DPlate 073	A12			AU055797	AU055798			19	A23
8658	g_8658	SA0491	">T8F5_2(AC004512|pid:g3335333) Arabidopsis thaliana chromosome 1 BAC   T8F5 sequence, complete sequence; Similar to chloroplast   membrane-associated 30KD protein precursor (IM30)   gb|M73744 from Pisum sativum. ESTs gb|N37557, gb|W43887   and gb|AA042479 come from this gene.. "	DPlate 075	A12			AU056345	AU056346			19	B23
8659	g_8659	SA0076		DPlate 073	B12			AU055817	AU055818			19	C23
8660	g_8660	SA0436	">ZMU43082_1(U43082|pid:g1421730) Zea mays T cytoplasm male sterility   restorer factor 2 (rf2) mRNA, complete cds; restorer   factor 2; Allele: Rf2+B73; putative aldehyde   dehydrogenase; T cytoplasm male sterility. "	DPlate 075	B12			AU075853	AU075854			19	D23
8661	g_8661	SA0037	">AF079503_1(AF079503|pid:g3386546) Arabidopsis thaliana H-protein   promoter binding factor-2a mRNA, complete cds; HPPBF-2a.   "	DPlate 073	C12			AU055754	AU055755			19	E23
8662	g_8662	SA0452		DPlate 075	C12			AU176529	AU176530			19	F23
8663	g_8663	SA0045		DPlate 073	D12			AU055769	AU055770			19	G23
8664	g_8664	SA0460	>(P53776) HOMEOBOX PROTEIN GSH-4 (FRAGMENT).   &S46332(S46332;D37290;D38809)   &S71659_1(S71659|pid:g558491) 	DPlate 075	D12			AU056307	AU056308			19	H23
8665	g_8665	SA0053	">ATF13C5_12(AL021711|pid:g2832623) Arabidopsis thaliana DNA   chromosome 4, BAC clone F13C5 (ESSAII project);   similarity to protein kinase 6, Glycine max.,   PIR2:S29851. "	DPlate 073	E12			AU055785	AU055786			19	I23
8666	g_8666	SA0476	">ATAC002335_6(AC002335|pid:g2289003) Arabidopsis thaliana chromosome   II BAC T01O24 genomic sequence, complete sequence; "	DPlate 075	E12			AU056327	AU056328			19	J23
8667	g_8667	SA0061	">SPBC23E6_4(AL023287|pid:g3116122) S.pombe chromosome II cosmid   c23E6; SPBC23E6.04c, unknown, len:1650aa, similar eg. to   YJL109C, YJK9_YEAST, P42945, hypothetical protein,   (1769aa),fasta scores, opt:406, E():0, (24.0% identity   in 1791 aa overlap). "	DPlate 073	F12			AU055799	AU055800			19	K23
8668	g_8668	SA0429		DPlate 075	F12			AU056259	AU056260			19	L23
8669	g_8669	SA0069	>TM017A05_3(AF024504|pid:g2435519) Arabidopsis thaliana BAC TM017A05;   similar to mouse MEM3 (GB:U47024 and S. cerevisiae   vacuolar sorting protein 35 (SW;P34110). 	DPlate 073	G12			AU055809	AU055810			19	M23
8670	g_8670	SA0437		DPlate 075	G12			AU056269	AU056270			19	N23
8671	g_8671	SA0077	>(P05814) BETA CASEIN PRECURSOR. &AF027807_1(AF027807|pid:g2695661)   &HSBCASR_1(X17070|pid:g29385)   &KBHU(I53730;S08040;S04049;S11072;A27219;A30773) 	DPlate 073	H12			AU055819	AU055820			19	O23
8672	g_8672	SA0469	">ATAC006135_18(AC006135|pid:g4218011) Arabidopsis thaliana   chromosome II BAC F24H14 genomic sequence, complete   sequence; &ATAC006439_2(AC006439|pid:g4309721) "	DPlate 075	H12			AU056321	AU056322			19	P23
8673	g_8673	SA0609	">AC002330_13(AC002330|pid:g3892049) Arabidopsis thaliana BAC T10P11   from chromosome IV, near 15 cM, complete sequence;   identical to protein encoded by cDNA Z95352; functional   catalog ID=11.05.03. &ATMLOH1_1(Z95352|pid:g2765817) "	DPlate 076	A06			AU056457	AU101715			20	A11
8674	g_8674	SA1449	">ATAC002337_16(AC002337|pid:g2275210) Arabidopsis thaliana   chromosome II BAC T08I13 genomic sequence, complete   sequence; "	DPlate 079	A06			AU078153	AU057445			20	B11
8675	g_8675	SA0665		DPlate 076	B06			AU056535	AU056536			20	C11
8676	g_8676	SA1489	>CELK03A1_3(U41625|pid:g1118128) Caenorhabditis elegans cosmid   K03A1; Similar to calmodulin calcium-binding sites.. 	DPlate 079	B06			AU162753	AU057494			20	D11
8677	g_8677	SA0602	>JE0184(JE0184)chitinase (EC 3.2.1.14) 2 - cone shell (Conus tulipa)   	DPlate 076	C06			AU056451				20	E11
8678	g_8678	SA1410		DPlate 079	C06			AU057395	AU057396			20	F11
8679	g_8679	SA0658		DPlate 076	D06			AU056525				20	G11
8680	g_8680	SA1418		DPlate 079	D06			AU173956	AU057408			20	H11
8681	g_8681	SA0666	">ATAC006260_3(AC006260|pid:g4371280) Arabidopsis thaliana chromosome   II BAC T2N18 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 076	E06			AU056537	AU056538			20	I11
8682	g_8682	SA1450	">AB011549_75(AB011549|pid:g3337072) Escherichia coli plasmid pO157   DNA, complete sequence; encoded in insertion sequence   IS91; similar to PIR accession number S23782. "	DPlate 079	E06			AU057446				20	J11
8683	g_8683	SA0674		DPlate 076	F06			AU056550				20	K11
8684	g_8684	SA1474	">ATT25K17_8(AL049171|pid:g4539423) Arabidopsis thaliana DNA   chromosome 4, BAC clone (ESSA project); strong   similarity to pyrophosphate-dependent   phosphofructo-1-kinase, Prunus armeniaca, U93272. "	DPlate 079	F06			AU057478	AU057479			20	L11
8685	g_8685	SA0627	">T12H20_1(AF080119|pid:g3600032) Arabidopsis thaliana BAC T12H20;   contains similarity to tropomyosin (Pfam:   Tropomyosin.hmm, score: 14.57) and ATP synthase (Pfam:   ATP-synt_B.hmm, score: 10.89). "	DPlate 076	G06			AU162689	AU056485			20	M11
8686	g_8686	SA1403	">AC003981_5(AC003981|pid:g3063444) Complete sequence of Arabidopsis   F22O13, complete sequence; putative thioredoxin; similar   to ESTs gb|T46281, gb|R83933, gb|N65879, emb|F14466,   gb|N96726, gb|AA042340, and emb|Z18150. "	DPlate 079	G06			AU057385	AU057386			20	N11
8687	g_8687	SA0635	">ATF26P21_18(AL031804|pid:g3688187) Arabidopsis thaliana DNA   chromosome 4, BAC clone F26P21 (ESSAII project);   similarity to peptidyl-prolyl cis-trans isomerase,   Schizosaccharomyces pombe, gb:SPBC16H5; Contains   Cyclophilin-type peptidyl-prolyl cis-trans isomerase   signature & profile, Csa_Ppiase_1 [FDNTIFHRVIPGFLVQGG]. "	DPlate 076	H06			AU162691	AU056495			20	O11
8688	g_8688	SA1419	>S39507(S39507)hypothetical protein - tomato 	DPlate 079	H06			AU057409				20	P11
8689	g_8689	SA0758		DPlate 076	A12			AU056647	AU056648			20	A23
8690	g_8690	SA1601		DPlate 079	A12			AU095651	AU057591			20	B23
8691	g_8691	SA0790		DPlate 076	B12			AU162707	AU056687			20	C23
8692	g_8692	SA1617	>F70811(F70811) hypothetical protein Rv0830 - Mycobacterium   tuberculosis (strain H37RV)   &MTV043_22(AL022004|pid:g2916888) 	DPlate 079	B12			AU162760	AU057613			20	D23
8693	g_8693	SA0703	">AF004213_1(AF004213|pid:g2224927) Arabidopsis thaliana   ethylene-insensitive3-like1 (EIL1) mRNA, complete cds. "	DPlate 076	C12			AU082744	AU056577			20	E23
8694	g_8694	SA1625	">ATAC005169_24(AC005169|pid:g3687251) Arabidopsis thaliana   chromosome II BAC F6F22 genomic sequence, complete   sequence; unknown protein. "	DPlate 079	C12			AU057622	AU057623			20	F23
8695	g_8695	SA0719		DPlate 076	D12			AU056596	AU056597			20	G23
8696	g_8696	SA1602		DPlate 079	D12			AU057592				20	H23
8697	g_8697	SA0727		DPlate 076	E12			AU056608	AU056609			20	I23
8698	g_8698	SA1610	">ATF13D4_3(AL031369|pid:g3482967) Arabidopsis thaliana DNA   chromosome 2, BAC clone F13D4 (ESSAII project);   similarity to protein phosphatase 2C,   Schizosaccharomyces pombe, PIR2:S54297; Contains Protein   phosphatase 2C signature [FFGVYDGHG]; contains EST   gb:T76114, AA041138. "	DPlate 079	E12			AU057604	AU057605			20	J23
8699	g_8699	SA0751	>STZ99770_1(Z99770|pid:g2894362) Solanum tuberosum cv. Desire mRNA   for P-protein. 	DPlate 076	F12			AU173914	AU173915			20	K23
8700	g_8700	SA1626	">PHVPVPR3A_1(M75856|pid:g169363) P.vulgaris PVPR3 protein mRNA,   complete cds. "	DPlate 079	F12			AU162761	AU057624			20	L23
8701	g_8701	SA0767	">AF082347_1(AF082347|pid:g4154281) Zea mays C13 endopeptidase NP1   precursor, mRNA, complete cds. "	DPlate 076	G12			AU056660	AU056661			20	M23
8702	g_8702	SA1642	">ATT12H17_13(AL021635|pid:g2827551) Arabidopsis thaliana DNA   chromosome 4, BAC clone T12H17 (ESSAII project);   contains EST gb:Z18415. "	DPlate 079	G12			AU082566	AU057642			20	N23
8703	g_8703	SA0704	>(P54152) PEPTIDE METHIONINE SULFOXIDE REDUCTASE (PEPTIDE MET(O)   REDUCTASE) (FRUIT-RIPENING PROTEIN E4) (FRAGMENT).   &FXAMSRPRT_1(Z69596|pid:g1310665) 	DPlate 076	H12			AU056578	AU082564			20	O23
8704	g_8704	SA1658	">AF094773_1(AF094773|pid:g3789948) Oryza sativa translation   initiation factor 5A (eIF-5A) mRNA, complete cds. "	DPlate 079	H12			AU057661	AU057662			20	P23
8705	g_8705	SS0742	>ATPROT2_1(X95738|pid:g1769903) A.thaliana mRNA for proline   transporter 2. 	DPlate 081	A06			D46210	AU032560			21	A11
8706	g_8706	SS4214		DPlate 083	A06			AU070398				21	B11
8707	g_8707	SS0774	">ATF18A5_3(AL035528|pid:g4455293) Arabidopsis thaliana DNA   chromosome 4, BAC clone F18A5 (ESSAII project);   contains EST gb:H76035, AA651479. "	DPlate 081	B06			D46235	AU173985			21	C11
8708	g_8708	SS4238	">HVU46003_1(U46003|pid:g1203832) Hordeum vulgare beta-D-glucan   exohydrolase, isoenzyme ExoII, mRNA, complete cds. "	DPlate 083	B06			AU174042				21	D11
8709	g_8709	SS0727	">ATAC005310_10(AC005310|pid:g3510256) Arabidopsis thaliana   chromosome II BAC F19D11 genomic sequence, complete   sequence; unknown protein. "	DPlate 081	C06			D46202	AU032549			21	E11
8710	g_8710	SS4246	">ATF23E12_14(AL022604|pid:g3080420) Arabidopsis thaliana DNA   chromosome 4, BAC clone F23E12 (ESSAII project); strong   similarity to sugar transporter, Arabidopsis thaliana,   db_xref=PID:g1495273; Contains Sugar transport proteins   signatures [SGGVADWLGRRPMLILS]   [LDGFGVGLVVTLVPIYISETAPPEIR]. "	DPlate 083	C06			D48171	AU174043			21	F11
8711	g_8711	SS0735	>NTO7789_1(AJ007789|pid:g3821254) Nicotiana tabacum mRNA for   geranylgeranyl reductase. 	DPlate 081	D06			D46208	AU032554			21	G11
8712	g_8712	SS4262	>ATCYP450D_1(X87368|pid:g871988) A.thaliana gene cytochrome P450;   cytochrome P450. &ATCYP450R_1(X87367|pid:g853719)   &S55379(S55379) 	DPlate 083	D06			D48181	AU032806			21	H11
8713	g_8713	SS0712	">(P12629) 50S RIBOSOMAL PROTEIN L13, CHLOROPLAST PRECURSOR (CL13).   &A32033(A32033;A30782;S17144)   &SPIRPL13_1(J04461|pid:g170133) "	DPlate 081	E06			D46193	AU032543			21	I11
8714	g_8714	SS4270	">HSAJ5016_1(AJ005016|pid:g3005931) Homo sapiens mRNA for putative   ABC transporter, partial; putative. "	DPlate 083	E06			D48186	AU032808			21	J11
8715	g_8715	SS0736	>S60660(S60660) hypothetical protein - maize   &ZMGLOSSY_1(X88779|pid:g949980) 	DPlate 081	F06			AU032555				21	K11
8716	g_8716	SS4286	">AF017751_1(AF017751|pid:g2852684) Lactuca sativa resistance protein   candidate (RGC1b) gene, partial cds. "	DPlate 083	F06			D48198	AU082070			21	L11
8717	g_8717	SS0752	">ATF22I13_3(AL035539|pid:g4539334) Arabidopsis thaliana DNA   chromosome 4, BAC clone F22I13 (ESSA project);   similarity to gene T10 protein - mouse, PIR2:S37488. "	DPlate 081	G06			D46217	AU032566			21	M11
8718	g_8718	SS4215	>S56684(S56684) histone H2B-6 - wheat   &WHTPH2B6A_1(D37942|pid:g531056) 	DPlate 083	G06			D48146	AU096554			21	N11
8719	g_8719	SS0760		DPlate 081	H06			D46223	AU032572			21	O11
8720	g_8720	SS4231		DPlate 083	H06			D48157				21	P11
8721	g_8721	SS2605		DPlate 081	A12			D47310	AU173988			21	A23
8722	g_8722	SS5021		DPlate 083	A12			AU174062				21	B23
8723	g_8723	SS2637	>(P23993) PHOTOSYSTEM I REACTION CENTRE SUBUNIT XI PRECURSOR   (SUBUNIT V) (PSI-L). &A39759(A39759)   &BLYPSAL_1(M61146|pid:g167087) 	DPlate 081	B12			D47330	AU174000			21	C23
8724	g_8724	SS5029	">U89959_18(U89959|pid:g3258575) Arabidopsis thaliana BAC T7I23,   complete sequence; Hypothetical protein. "	DPlate 083	B12			D48675	AU101805			21	D23
8725	g_8725	SS2669		DPlate 081	C12			D47351	AU162892			21	E23
8726	g_8726	SS5045		DPlate 083	C12			AU065871	AU096747			21	F23
8727	g_8727	SS2677	">ATAC003105_7(AC003105|pid:g2760836) Arabidopsis thaliana chromosome   II BAC F18A8 genomic sequence, complete sequence; "	DPlate 081	D12			D47359	AU078059			21	G23
8728	g_8728	SS5077	">PAU82219_1(U82219|pid:g2317874) Prunus armeniaca Rab7 GTP binding   protein mRNA, complete cds. "	DPlate 083	D12			AU174070	AU174071			21	H23
8729	g_8729	SS2614	>(Q00052) GALACTOKINASE (EC 2.7.1.6). &A47032(A47032)   &LHGALKTM_1(X57248|pid:g44000) 	DPlate 081	E12			D47317	AU173990			21	I23
8730	g_8730	SS5085	>GMADR11A_1(X69640|pid:g296443) G.max ADR11 mRNA; auxin down   regulated. &S33621(S33621) 	DPlate 083	E12			D48706	AU163071			21	J23
8731	g_8731	SS2638		DPlate 081	F12			D47331	AU101750			21	K23
8732	g_8732	SS5022		DPlate 083	F12			D48672	AU096746			21	L23
8733	g_8733	SS2654		DPlate 081	G12			AU070356				21	M23
8734	g_8734	SS5030		DPlate 083	G12			AU174063	AU174064			21	N23
8735	g_8735	SS2670		DPlate 081	H12			D47352				21	O23
8736	g_8736	SS5054	">ATAC007069_8(AC007069|pid:g4522012) Arabidopsis thaliana chromosome   II BAC T23K3 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 083	H12			D48683	AU101808			21	P23
8737	g_8737	SS6039	>(P36494) CHLOROPHYLL A-B BINDING PROTEIN CP24 PRECURSOR.   &CHSO20KCP_1(Z25886|pid:g437991) &S40210(S40210) 	DPlate 085	A06			C24873	AU162113			22	A11
8738	g_8738	ST0925	">ATAC006921_7(AC006921|pid:g4510345) Arabidopsis thaliana chromosome   II BAC F2H17 genomic sequence, complete sequence;   unknown protein. "	DPlate 087	A06			D39522	AU161582			22	B11
8739	g_8739	SS6047		DPlate 085	B06			AU162115	AU162116			22	C11
8740	g_8740	ST0965	>T14P8_8(AF069298|pid:g3193303) Arabidopsis thaliana BAC T14P8;   similar to several proteins containing a tandem repeat   region such as Plasmodium falciparum GGM tandem repeat   protein (GB:U27807); partial CDS; coded for by A.   thaliana cDNA T46208. 	DPlate 087	B06			D39548	AU161586			22	D11
8741	g_8741	SS6063	">ATF20D10_20(AL035538|pid:g4467114) Arabidopsis thaliana DNA   chromosome 4, BAC clone F20D10 (ESSA project); contains   EST gb:T04633, T04470, T46008, T14066, T43704, H36827,   T45817, T42130, T14170, R90155, Aa395740, AA597777. "	DPlate 085	C06			AU174109	AU174110			22	E11
8742	g_8742	ST0981	>DRVI18419_1(Y18419|pid:g3893118) Drosophila virilis mRNA for   t-complex polypeptide 20. 	DPlate 087	C06			D39555	AU174182			22	F11
8743	g_8743	SS6087	>S16585(S16585)phosphoribulokinase (EC 2.7.1.19) - wheat 	DPlate 085	D06			C24888	AU174112			22	G11
8744	g_8744	ST0958	>OSTA111_1(X91806|pid:g1136120) O.sativa mRNA for alpha-tubulin   (clone OSTA-111). 	DPlate 087	D06			D39542	AU174179			22	H11
8745	g_8745	SS6048	">ATT5J17_3(AL035708|pid:g4490737) Arabidopsis thaliana DNA   chromosome 4, BAC clone (ESSA project); contains EST   gb:R65531, Z35751, Z37494. "	DPlate 085	E06			AU162117	AU162118			22	I11
8746	g_8746	ST0974	">ATF17L22_16(AL035527|pid:g4455278) Arabidopsis thaliana DNA   chromosome 4, BAC clone F17L22 (ESSAII project);   Contains Copper amine oxidase signatures,   Copper_Amine_Oxid_1 [LILGARNTPLNYEY]. "	DPlate 087	E06			D39550	AU033009			22	J11
8747	g_8747	SS6064		DPlate 085	F06			C24879	AU162120			22	K11
8748	g_8748	ST0960		DPlate 087	F06			D39543	AU090580			22	L11
8749	g_8749	SS6072		DPlate 085	G06			C24881	AU101850			22	M11
8750	g_8750	ST0961	">AF004809_1(AF004809|pid:g2270994) Glycine max Ca+2-binding EF hand   protein (GmPM13) mRNA, complete cds; encodes EF-hand   motifs. "	DPlate 087	G06			D39544	AU174180			22	N11
8751	g_8751	SS6080	>ATTHIRED3_1(Z35475|pid:g992964) A.thaliana (Gif2) mRNA for   thioredoxin. &S58123(S58123) 	DPlate 085	H06			C24884	AU174111			22	O11
8752	g_8752	ST0985		DPlate 087	H06			D39556	AU033010			22	P11
8753	g_8753	SS6502		DPlate 085	A12			D49295	AU091484			22	A23
8754	g_8754	ST1142	">CAR6095_1(AJ006095|pid:g3135751) Cicer arietinum mRNA for putative   26S protease regulatory subunit 6, partial. "	DPlate 087	A12			AU058089				22	B23
8755	g_8755	SS6566	">D90904_63(D90904|pid:g1652288) Synechocystis sp. PCC6803 complete   genome, 6/27, 630555-781448; ORF_ID:slr1394.   &S75297(S75297) "	DPlate 085	B12			D49333	AU161492			22	C23
8756	g_8756	ST1158		DPlate 087	B12			AU181040				22	D23
8757	g_8757	SS6574		DPlate 085	C12			D49338	AU174134			22	E23
8758	g_8758	ST1190	">OSU63530_1(U63530|pid:g1488297) Oryza sativa osRAD23 mRNA, complete   cds; RAD23 homolog. "	DPlate 087	C12			D39646	AU161605			22	F23
8759	g_8759	SS6590		DPlate 085	D12			D49347	AU161498			22	G23
8760	g_8760	ST1111		DPlate 087	D12			D39602	AU161595			22	H23
8761	g_8761	SS6503	">ATAC003105_1(AC003105|pid:g2760830) Arabidopsis thaliana chromosome   II BAC F18A8 genomic sequence, complete sequence. "	DPlate 085	E12			AU174129				22	I23
8762	g_8762	ST1167		DPlate 087	E12			AU174205	AU076293			22	J23
8763	g_8763	SS6519	">AC002396_29(AC002396|pid:g2829889) Arabidopsis thaliana chromosome   I BAC F3I6 genomic sequence, complete sequence;   Hypothetical protein. "	DPlate 085	F12			D49307	AU161487			22	K23
8764	g_8764	ST1183	">AB011133_1(AB011133|pid:g3043646) Homo sapiens mRNA for KIAA0561   protein, partial cds. "	DPlate 087	F12			AU174207	AU174208			22	L23
8765	g_8765	SS6535		DPlate 085	G12			D49316	AU096920			22	M23
8766	g_8766	ST1144		DPlate 087	G12			D39622				22	N23
8767	g_8767	SS6551	">ATAC005851_12(AC005851|pid:g4063749) Arabidopsis thaliana   chromosome II BAC F24D13 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 085	H12			D49323	AU161491			22	O23
8768	g_8768	ST1176	">ATAC006929_14(AC006929|pid:g4510422) Arabidopsis thaliana   chromosome II BAC T1E2 genomic sequence, complete   sequence; "	DPlate 087	H12			D39640	AU101930			22	P23
8769	g_8769	ST2546	">D87819_1(D87819|pid:g2723471) Oryza sativa mRNA for sucrose   transporter, complete cds. "	DPlate 089	A06			D40515	AU033074			23	A11
8770	g_8770	ST4306		DPlate 091	A06			D41656	AU174315			23	B11
8771	g_8771	ST2562	">T7A14_2(AC005322|pid:g4056416) Arabidopsis thaliana chromosome 1   BAC T7A14 sequence, complete sequence; Strong similarity   to Dsor1 protein kinase gb|D13782 from Drosophila   melanogaster.. "	DPlate 089	B06			D40523				23	C11
8772	g_8772	ST4322	>(P46270) UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX 8.0 KD PROTEIN   (EC 1.10.2.2). &STCYTC8_1(X79274|pid:g633685) 	DPlate 091	B06			D41669	AU033166			23	D11
8773	g_8773	ST2578	">ATAC004261_2(AC004261|pid:g3402697) Arabidopsis thaliana chromosome   II BAC T3K9 genomic sequence, complete sequence. "	DPlate 089	C06			AU174264				23	E11
8774	g_8774	ST4354	">PFMAL3P6_7(Z98551|pid:g3758859) Plasmodium falciparum MAL3P6,   complete sequence; predicted using hexExon; MAL3P6.7   (PFC0730w), Hypothetical protein, len: 222 aa. "	DPlate 091	C06			D41690	AU174325			23	F11
8775	g_8775	ST2507	">ATF7L13_1(AL049524|pid:g4539403) Arabidopsis thaliana DNA   chromosome 4, BAC clone F7L13 (ESSA project); contains   EST gb:Z17447. "	DPlate 089	D06			D40485	AU174254			23	G11
8776	g_8776	ST4370	>ZMABP3_1(X97726|pid:g1419370) Z.mays ZmABP3 mRNA for actin   depolymerizing factor; expressed in every tissue except   pollen. 	DPlate 091	D06			AU174328	AU174329			23	H11
8777	g_8777	ST2515	">AF032972_1(AF032972|pid:g2655287) Oryza sativa germin-like protein   2 (GER2) mRNA, complete cds; similar to wheat and barley   oxalate oxidase. "	DPlate 089	E06			D40492	AU174256			23	I11
8778	g_8778	ST4315	">TAU86763_1(U86763|pid:g4099408) Triticum aestivum delta-type   tonoplast intrinsic protein mRNA, complete cds;   delta-TIP. "	DPlate 091	E06			D41663	AU174317			23	J11
8779	g_8779	ST2523	">ATAC005499_19(AC005499|pid:g3786011) Arabidopsis thaliana   chromosome II BAC T6A23 genomic sequence, complete   sequence; "	DPlate 089	F06			D40498	AU033072			23	K11
8780	g_8780	ST4347	">AB014595_1(AB014595|pid:g3327204) Homo sapiens mRNA for KIAA0695   protein, complete cds. "	DPlate 091	F06			AU174322	AU174323			23	L11
8781	g_8781	ST2579	>BVRNAEF2_1(Z97178|pid:g2369714) Beta vulgaris cDNA for elongation   factor 2. 	DPlate 089	G06			D40533	AU174265			23	M11
8782	g_8782	ST4371	">ATAC002335_14(AC002335|pid:g2288985) Arabidopsis thaliana   chromosome II BAC T01O24 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 091	G06			AU174330				23	N11
8783	g_8783	ST2532	">T31J12_3(AC006416|pid:g4337175) Arabidopsis thaliana chromosome 1   BAC T31J12 sequence, complete sequence; ESTs gb|T20589,   gb|T04648, gb|AA597906, gb|T04111, gb|R84180, gb|R65428,   gb|T44439, gb|T76570, gb|R90004, gb|T45020, gb|T42457,   gb|T20921, gb|AA042762 and gb|AA720210 come from this   gene.. "	DPlate 089	H06			D40505	AU174259			23	O11
8784	g_8784	ST4387	>(P53123) HYPOTHETICAL 37.4 KD PROTEIN IN SEC27-SSM1B INTERGENIC   REGION. &S64149(S64149;S71736)   &SCXII_4(X92670|pid:g1246842)   &SCYGL136C_1(Z72658|pid:g1322708) 	DPlate 091	H06			D41712				23	P11
8785	g_8785	ST3085	">ATAC003680_4(AC003680|pid:g2979544) Arabidopsis thaliana chromosome   II BAC F17K2 genomic sequence, complete sequence; "	DPlate 089	A12			AU175159	AU175158			23	A23
8786	g_8786	ST5185		DPlate 091	A12			AU161726				23	B23
8787	g_8787	ST3030		DPlate 089	B12			D40854				23	C23
8788	g_8788	ST5122	">GMU89693_1(U89693|pid:g2317900) Glycine max Sali3-2 mRNA, complete   cds; Al-induced; similar to ADR6. "	DPlate 091	B12			C25061				23	D23
8789	g_8789	ST3046	">ATF17M5_18(AL035678|pid:g4490309) Arabidopsis thaliana DNA   chromosome 4, BAC clone F17M5 (ESSA project); strong   similarity to peroxidase ATP17a -A.thaliana,   PID:e252638; Contains Peroxidases signatures:   Peroxidase_1 [DVVALSGAHTL], Peroxidases signatures:   Peroxidase_2 [AAGLIRMLFHDC]; contains EST   gb:AA041113;T46689. "	DPlate 089	C12			D40868	AU174279			23	E23
8790	g_8790	ST5146		DPlate 091	C12			C25068	AU102013			23	F23
8791	g_8791	ST3078	">ATFCA4_34(Z97339|pid:g2244935) Arabidopsis thaliana DNA chromosome   4, ESSA I contig fragment No. 4; hypothetical protein.   &C71423(C71423) "	DPlate 089	D12			D40895	AU174284			23	G23
8792	g_8792	ST5170		DPlate 091	D12			C25078	AU174351			23	H23
8793	g_8793	ST3086		DPlate 089	E12			D40901	AU033102			23	I23
8794	g_8794	ST5186	">ATAC006234_24(AC006234|pid:g4454470) Arabidopsis thaliana   chromosome II BAC F5H14 genomic sequence, complete   sequence; "	DPlate 091	E12			AU161727	AU174352			23	J23
8795	g_8795	ST3047		DPlate 089	F12			D40869				23	K23
8796	g_8796	ST5123	>A71403(A71403) probable transport protein - Arabidopsis thaliana   &ATFCA0_25(Z97335|pid:g2244772) 	DPlate 091	F12			C25062	AU161706			23	L23
8797	g_8797	ST3063		DPlate 089	G12			D40883	AU174282			23	M23
8798	g_8798	ST5147		DPlate 091	G12			AU174348	AU174349			23	N23
8799	g_8799	ST3079	">CAAJ5788_1(AJ005788|pid:g3123349) Cicer arietinum mRNA for   hypothetical protein, partial (clone Can61). "	DPlate 089	H12			AU174285	AU174286			23	O23
8800	g_8800	ST5179	">BTAJ11400_1(AJ011400|pid:g4006932) Bos taurus mRNA for b17.2   subunit of NADH:ubiquinone oxidoreductase complex   (complex I); N-terminal amino acid, methionine, is   modified by acetylation; has been proved directly by by   tandem mass spectrometry. "	DPlate 091	H12			C25080	AU097479			23	P23
8801	g_8801	ST6167		DPlate 093	A06			AU161880	AU161881			24	A11
8802	g_8802	Water										24	B11
8803	g_8803	ST6183	">ATAC005499_10(AC005499|pid:g3786002) Arabidopsis thaliana   chromosome II BAC T6A23 genomic sequence, complete   sequence; &ATH17593_1(Y17593|pid:g3250736)   &ATY14325_1(Y14325|pid:g2288887) "	DPlate 093	B06			AU077917	AU077918			24	C11
8804	g_8804	Water										24	D11
8805	g_8805	ST6120		DPlate 093	C06			AU102045	AU102046			24	E11
8806	g_8806	Water										24	F11
8807	g_8807	ST6144	">ATAC002337_11(AC002337|pid:g2275205) Arabidopsis thaliana   chromosome II BAC T08I13 genomic sequence, complete   sequence; unknown protein. "	DPlate 093	D06			AU174389	AU161868			24	G11
8808	g_8808	Water										24	H11
8809	g_8809	ST6160		DPlate 093	E06			AU098356	AU098357			24	I11
8810	g_8810	Water										24	J11
8811	g_8811	ST6192		DPlate 093	F06			AU161890				24	K11
8812	g_8812	Water										24	L11
8813	g_8813	ST6121	">ATF8F16_2(AL021633|pid:g2827516) Arabidopsis thaliana DNA chromosome   4, BAC clone F8F16 (ESSAII project); similarity to   Bacillus subtilis DNA Topoisomerase I; PATCHX:G520753. "	DPlate 093	G06			AU102047	AU102048			24	M11
8814	g_8814	Water										24	N11
8815	g_8815	ST6153	">ATAC004561_38(AC004561|pid:g3980411) Arabidopsis thaliana   chromosome II BAC F16P2 genomic sequence, complete   sequence; "	DPlate 093	H06			AU174390				24	O11
8816	g_8816	Water										24	P11
8817	g_8817	ST6391		DPlate 093	A12			AU066311	AU174413			24	A23
8818	g_8818	no clone										24	B23
8819	g_8819	ST6320	">AB004932_1(AB004932|pid:g2224731) Vigna radiata mRNA for Aux22d,   complete cds. "	DPlate 093	B12			C25414				24	C23
8820	g_8820	no clone										24	D23
8821	g_8821	ST6328		DPlate 093	C12			AU174405	AU174406			24	E23
8822	g_8822	no clone										24	F23
8823	g_8823	ST6360		DPlate 093	D12			AU174408				24	G23
8824	g_8824	no clone										24	H23
8825	g_8825	ST6305		DPlate 093	E12			AU174402				24	I23
8826	g_8826	no clone										24	J23
8827	g_8827	ST6329	">ATAC002388_8(AC002388|pid:g2344893) Arabidopsis thaliana chromosome   II BAC T13E15 genomic sequence, complete sequence;   &ATHB4_1(Y09582|pid:g1694713) "	DPlate 093	F12			AU181063				24	K23
8828	g_8828	no clone										24	L23
8829	g_8829	ST6322		DPlate 093	G12			AU181062				24	M23
8830	g_8830	no clone										24	N23
8831	g_8831	ST6330		DPlate 093	H12			AU076311				24	O23
8832	g_8832	no clone										24	P23
8833	g_8833	EG0547		DPlate 050	A06			AU101475	AU030042			13	A12
8834	g_8834	EH0046	">ATAC004238_7(AC004238|pid:g3033380) Arabidopsis thaliana chromosome   II BAC F19I3 genomic sequence, complete sequence; "	DPlate 052	A06			AU030641				13	B12
8835	g_8835	EG0587	">MEU72662_12(U72662|pid:g2160684) Methylobacterium extorquens   methylotrophy region containing malyl-CoA lyase (mclA),   putative ABC transporter subunit A (abcA), putative ABC   transporter subunit B (abcB), putative ABC transporter   ATP-binding subunit (abcC), methanol dyhydrogenase large   subunit homolog (mxaF'), cytochrome c (maxG'), mxaJ   homolog (mxaJ'), 6-hydroxymethyl-7,8-dihyropterin   pyrophosphokinase (folA), dihydroneopterin aldolase   (folB) and dihyrdoxypteroate synthase (folC) genes,   complete cds, and phosphoenolpyruvate carboxylate (ppcA)   gene, partial cds, and pyrroloquinoline quinone   biosynthesis gene cluster containing PqqE (pqqE) gene,   complete cds, and PqqC/D gene, partial cds; "	DPlate 050	B06			AU077699	AU166249			13	C12
8836	g_8836	EH0054		DPlate 052	B06			AU172982	AU075786			13	D12
8837	g_8837	EG0508	">RICSODAOA_1(L19436|pid:g349104) Rice mitochondrial   manganese-superoxide dismutase (sodAOs1) mRNA, complete   cds; precursor. "	DPlate 050	C06			AU077696	AU166248			13	E12
8838	g_8838	EH0070	">AC003981_5(AC003981|pid:g3063444) Complete sequence of Arabidopsis   F22O13, complete sequence; putative thioredoxin; similar   to ESTs gb|T46281, gb|R83933, gb|N65879, emb|F14466,   gb|N96726, gb|AA042340, and emb|Z18150. "	DPlate 052	C06			AU172985	AU172986			13	F12
8839	g_8839	EG0516	>(P34788) 40S RIBOSOMAL PROTEIN S18.   &ATF17A8_15(AL049482|pid:g4538910)   &ATRBPS18A_1(Z23165|pid:g405613)   &ATS18RP1_1(Z28701|pid:g434343)   &ATS18RP2_1(Z28702|pid:g434345)   &ATS18RP3_1(Z28962|pid:g434906)   &ATY12227_7(Y12227|pid:g2505871)   &S37496(S46223;S39263;S39265;S39264;S37496)   &T22J18_5(AC003979|pid:g3287678) 	DPlate 050	D06			AU164445	AU030025			13	G12
8840	g_8840	EH0078		DPlate 052	D06			AU065159	AU101488			13	H12
8841	g_8841	EG0548		DPlate 050	E06			AU058343	AU166193			13	I12
8842	g_8842	EH0086		DPlate 052	E06			AU030669	AU030670			13	J12
8843	g_8843	EG0580	>(P48502) UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX 14 KD PROTEIN (EC   1.10.2.2) (CR14). &STCR14_1(X79276|pid:g633681) 	DPlate 050	F06			AU065615	AU030066			13	K12
8844	g_8844	EH0047		DPlate 052	F06			AU162306	AU030642			13	L12
8845	g_8845	EG0588	">ATAC006069_16(AC006069|pid:g4220481) Arabidopsis thaliana   chromosome II BAC T8O11 genomic sequence, complete   sequence; unknown protein. "	DPlate 050	G06			AU065616	AU030069			13	M12
8846	g_8846	EH0063	">D87957_1(D87957|pid:g1620898) Homo sapiens gene for protein   involved in sexual development, complete cds; protein   involved in sexual development. "	DPlate 052	G06			AU172983	AU172984			13	N12
8847	g_8847	EG0596	">ZMU62753_1(U62753|pid:g2431771) Zea mays acidic ribosomal protein   P2b (rpp2b) mRNA, complete cds; P1 and P2 dimerize and   form a stalk structure that is present in the active   site of the large ribosomal subunit (60S); the stalk   structure is thought to assist in the late initiation   and elongation phases of translation via interactions   with tRNA, rRNA and translation factors. "	DPlate 050	H06			AU065617	AU030074			13	O12
8848	g_8848	EH0071	">TAU73216_1(U73216|pid:g1657855) Triticum aestivum cold acclimation   protein WCOR413 (Wcor413) mRNA, complete cds;   hydrophobic protein. "	DPlate 052	H06			AU162308	AU030660			13	P12
8849	g_8849	EG0776	">ATAC006403_21(AC006403|pid:g4337206) Arabidopsis thaliana   chromosome II BAC T28I24 genomic sequence, complete   sequence; "	DPlate 050	A12			AU162293	AU030219			13	A24
8850	g_8850	EH0228	>(P48608) DIAPHANOUS PROTEIN. &DMU11288_1(U11288|pid:g575927) 	DPlate 052	A12			AU090496	AU030781			13	B24
8851	g_8851	EG0721	>IG005I10_9(AF013293|pid:g2252841) Arabidopsis thaliana BAC   IG005I10; 	DPlate 050	B12			AU030178	AU030179			13	C24
8852	g_8852	EH0268		DPlate 052	B12			AU095151	AU030805			13	D24
8853	g_8853	EG0753	">ATT19P19_17(AL022605|pid:g3080447) Arabidopsis thaliana DNA   chromosome 4, BAC clone T19P19 (ESSAII project);   similarity to AP2 domain containing protein RAP2.4,   Arabidopsis thaliana; contains EST gb:T46584. "	DPlate 050	C12			AU058379	AU083485			13	E24
8854	g_8854	EH0221		DPlate 052	C12			AU091414	AU030774			13	F24
8855	g_8855	EG0777	">ATU88711_1(U88711|pid:g3168840) Arabidopsis thaliana copper   homeostasis factor (CCH) mRNA, complete cds; similar to   yeast ATX1; copper chaperone. "	DPlate 050	D12			AU030220	AU030221			13	G24
8856	g_8856	EH0229		DPlate 052	D12			AU030782	AU030783			13	H24
8857	g_8857	EG0746	">S82451_1(S82451|pid:g1699300) latent transforming growth   factor-beta-binding protein-2 [human, fibroblast cell   line CC102, mRNA, 7017 nt]; This sequence comes from FIG.   2; LTBP-2. "	DPlate 050	E12			AU030196	AU030197			13	I24
8858	g_8858	EH0237		DPlate 052	E12			AU030789	AU091416			13	J24
8859	g_8859	EG0786		DPlate 050	F12			AU172966	AU058384			13	K24
8860	g_8860	EH0253		DPlate 052	F12			AU095144	AU030796			13	L24
8861	g_8861	EG0794		DPlate 050	G12			AU065650	AU030231			13	M24
8862	g_8862	EH0269		DPlate 052	G12			AU065177	AU091428			13	N24
8863	g_8863	EG0771	">ATAC004077_16(AC004077|pid:g3128209) Arabidopsis thaliana   chromosome II BAC T31E10 genomic sequence, complete   sequence; unknown protein. "	DPlate 050	H12			AU166204	AU030217			13	O24
8864	g_8864	EH0277		DPlate 052	H12			C74839	AU172991			13	P24
8865	g_8865	EH0804		DPlate 054	A06			AU091459	AU031099			14	A12
8866	g_8866	EH1641	>(P46270) UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX 8.0 KD PROTEIN   (EC 1.10.2.2). &STCYTC8_1(X79274|pid:g633685) 	DPlate 056	A06			AU162363				14	B12
8867	g_8867	EH0820	>(P33278) PROTEIN TRANSLATION FACTOR SUI1 HOMOLOG (GOS2 PROTEIN).   &AF094774_1(AF094774|pid:g3789950)   &OSGOS2G_1(X51910|pid:g20238) &S21636(S21636) 	DPlate 054	B06			AU101502	AU101503			14	C12
8868	g_8868	EH1602		DPlate 056	B06			AU065318	AU101552			14	D12
8869	g_8869	EH0860	">ATF13C5_18(AL021711|pid:g2832629) Arabidopsis thaliana DNA   chromosome 4, BAC clone F13C5 (ESSAII project); strong   similarity to 4-coumarate-CoA ligase, Arabidopsis   thaliana, PIR2:S57784. "	DPlate 054	C06			AU173028	AU031119			14	E12
8870	g_8870	EH1658		DPlate 056	C06			AU095385	AU095386			14	F12
8871	g_8871	EH0892	>S55383(S55383) peptidylprolyl isomerase (EC 5.2.1.8) - wheat   &TAFKBP70_1(X86903|pid:g854626) 	DPlate 054	D06			AU065249	AU165955			14	G12
8872	g_8872	EH1690		DPlate 056	D06			AU101572	AU101573			14	H12
8873	g_8873	EH0813		DPlate 054	E06			AU165930	AU165931			14	I12
8874	g_8874	EH1603	">(Q02438) GLUCAN ENDO-1,3-BETA-GLUCOSIDASE GV (EC 3.2.1.39) ((1-   &3)-BETA-GLUCAN ENDOH   &3)-BETA-GLUCANASEISOENZYMEGV)(BETA-1,3-ENDOGLUCANASEGV)   &BLYGLCNHV_1(M96939|pid:g540580) &S46237(S46237) "	DPlate 056	E06			AU031457	AU031458			14	J12
8875	g_8875	EH0821	">ATU96613_1(U96613|pid:g2352084) Arabidopsis thaliana serine/threonine   kinase (SIK1) mRNA, complete cds; AtSIK1; stress induced   kinase. "	DPlate 054	F06			AU031105	AU031106			14	K12
8876	g_8876	EH1651	">ATAC005724_11(AC005724|pid:g4185139) Arabidopsis thaliana   chromosome II P1 MSF3 genomic sequence, complete   sequence; "	DPlate 056	F06			AU164861				14	L12
8877	g_8877	EH0853	>NTPDIGENE_1(Y11209|pid:g1848212) N.tabacum mRNA for protein   disulfide-isomerase precursor. 	DPlate 054	G06			AU173026	AU165942			14	M12
8878	g_8878	EH1667		DPlate 056	G06			AU164871				14	N12
8879	g_8879	EH0861		DPlate 054	H06			AU065235	AU101512			14	O12
8880	g_8880	EH1628	">ATF1N20_2(AL022140|pid:g2961337) Arabidopsis thaliana DNA   chromosome 4, BAC clone F1N20 (ESSAII project);   predicted. &ATT8O5_13(AL021890|pid:g2894570) "	DPlate 056	H06			AU101558	AU101559			14	P12
8881	g_8881	EH1002		DPlate 054	A12			AU031150				14	A24
8882	g_8882	EH1825	">ATF4D11_4(AL022537|pid:g3063694) Arabidopsis thaliana DNA   chromosome 4, BAC clone F4D11 (ESSAII project);   similarity to tom-1B protein, Gallus gallus; contains   EST gb:Z33951. "	DPlate 056	A12			AU031545	AU031546			14	B24
8883	g_8883	EH1018	">D86854_1(D86854|pid:g1486265) Catharanthus roseus cyc17 mRNA for   extensin, complete cds. "	DPlate 054	B12			AU164728	AU164729			14	C24
8884	g_8884	EH1857		DPlate 056	B12			AU095400	AU031564			14	D24
8885	g_8885	EH1026		DPlate 054	C12			AU031157				14	E24
8886	g_8886	EH1810		DPlate 056	C12			AU031536	AU031537			14	F24
8887	g_8887	EH1082	">ATAC005824_34(AC005824|pid:g3860277) Arabidopsis thaliana   chromosome II BAC F15K20 genomic sequence, complete   sequence; &ATAC006232_21(AC006232|pid:g4314394) "	DPlate 054	D12			AU065281	AU101537			14	G24
8888	g_8888	EH1826		DPlate 056	D12			AU031547				14	H24
8889	g_8889	EH1003		DPlate 054	E12			AU076193	AU076194			14	I24
8890	g_8890	EH1834	>CELC15H9_2(U56965|pid:g1293835) Caenorhabditis elegans cosmid   C15H9; 	DPlate 056	E12			AU164938	AU031550			14	J24
8891	g_8891	EH1011		DPlate 054	F12			AU076201				14	K24
8892	g_8892	EH1842	>CELC15H9_2(U56965|pid:g1293835) Caenorhabditis elegans cosmid   C15H9; 	DPlate 056	F12			AU164942	AU031555			14	L24
8893	g_8893	EH1019		DPlate 054	G12			AU031154				14	M24
8894	g_8894	EH1866	>(P49211) 60S RIBOSOMAL PROTEIN L32 (FRAGMENT). 	DPlate 056	G12			AU164951	AU164952			14	N24
8895	g_8895	EH1027		DPlate 054	H12			AU076211	AU076212			14	O24
8896	g_8896	EH1890	>CELF08F8_2(U28991|pid:g861366) Caenorhabditis elegans cosmid F08F8;   coded for by C. elegans cDNA cm21c7. 	DPlate 056	H12			AU164966	AU031584			14	P24
8897	g_8897	FE0226	">(P41349) FERREDOXIN-THIOREDOXIN REDUCTASE, CATALYTIC CHAIN   PRECURSOR (EC 1.18.-.-) (FTR-C) (FERREDOXIN-THIOREDOXIN   REDUCTASE SUBUNIT B) (FTR-B) (B1).   &SOFTRB_1(X77164|pid:g505189) "	DPlate 058	A06			AU174698	AU174697			15	A12
8898	g_8898	FL0122		DPlate 060	A06			AU174982				15	B12
8899	g_8899	FE0234		DPlate 058	B06			AU174705	AU174704			15	C12
8900	g_8900	FL0130		DPlate 060	B06			AU174987				15	D12
8901	g_8901	FE0258		DPlate 058	C06			AU174717				15	E12
8902	g_8902	FL0138		DPlate 060	C06			AU174993	AU174992			15	F12
8903	g_8903	FE0290		DPlate 058	D06			AU174740	AU174739			15	G12
8904	g_8904	FL0146		DPlate 060	D06			AU175000	AU174999			15	H12
8905	g_8905	FE0219	">ATT12H17_10(AL021635|pid:g2827548) Arabidopsis thaliana DNA   chromosome 4, BAC clone T12H17 (ESSAII project); strong   similarity to flavonoid 3', 5'-hydroxylase Hf1, Petunia   x hybrida, PIR2:S38985; contains EST gb:T46392, N65907,   T76384, AA5975, AA3958, AA5976, T21057, Z17996. "	DPlate 058	E06			AU174693	AU174692			15	I12
8906	g_8906	FL0154		DPlate 060	E06			AU175006				15	J12
8907	g_8907	FE0227	">ATAC002332_32(AC002332|pid:g2459437) Arabidopsis thaliana   chromosome II BAC F4P9 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 058	F06			AU174700	AU174699			15	K12
8908	g_8908	FL0170	">D90914_36(D90914|pid:g1653513) Synechocystis sp. PCC6803 complete   genome, 16/27, 1991550-2137258; ORF_ID:slr0959.   &S76167(S76167) "	DPlate 060	F06			AU175021	AU175020			15	L12
8909	g_8909	FE0259		DPlate 058	G06			AU174719	AU174718			15	M12
8910	g_8910	FL0178	>CHOSXX_108(X15901|pid:g1213601) Rice complete chloroplast genome;   gtg start. 	DPlate 060	G06			AU175032	AU175031			15	N12
8911	g_8911	FE0267	>(P14655) GLUTAMINE SYNTHETASE SHOOT ISOZYME PRECURSOR (EC 6.3.1.2)   (GLUTAMATE-- AMMONIA LIGASE) (CLONE LAMBDA-GS31).   &AJRZQD(S07471) &OSSIGS31_1(X14246|pid:g20370) 	DPlate 058	H06			AU174724	AU174723			15	O12
8912	g_8912	FL0147	>TM017A05_3(AF024504|pid:g2435519) Arabidopsis thaliana BAC TM017A05;   similar to mouse MEM3 (GB:U47024 and S. cerevisiae   vacuolar sorting protein 35 (SW;P34110). 	DPlate 060	H06			AU175001	AU175002			15	P12
8913	g_8913	FE0376	">ATAC006260_3(AC006260|pid:g4371280) Arabidopsis thaliana chromosome   II BAC T2N18 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 058	A12			AU174796	AU174797			15	A24
8914	g_8914	RA0153	">CEK01H12_1(Z68218|pid:g3878134) Caenorhabditis elegans cosmid   K01H12, complete sequence. "	DPlate 060	A12			D23786				15	B24
8915	g_8915	FE0392		DPlate 058	B12			AU174805	AU174804			15	C24
8916	g_8916	RA0169	">ATAC006232_5(AC006232|pid:g4314379) Arabidopsis thaliana chromosome   II BAC F10A12 genomic sequence, complete sequence;   unknown protein. "	DPlate 060	B12			D38986	AU164510			15	D24
8917	g_8917	FE0305	">AF008651_1(AF008651|pid:g2735764) Solanum tuberosum MADS   transcriptional factor (Stmads16) mRNA, complete cds;   contains mads box; STMADS16. "	DPlate 058	C12			AU174747	AU174746			15	E24
8918	g_8918	RA0106	>I56573(I56573) SC2 - rat &S45663_1(S45663|pid:g256994) 	DPlate 060	C12			D23767	AU031642			15	F24
8919	g_8919	FE0321	>(P05636) APAG PROTEIN. &AE000115_5(AE000115|pid:g1786235)   &BVECAG(A30273;S40571;B64726)   &ECAPAH_2(X04711|pid:g40918)   &ECO110K_41(D10483|pid:g216475) 	DPlate 058	D12			AU174756	AU174755			15	G24
8920	g_8920	RA0114		DPlate 060	D12			AU173061				15	H24
8921	g_8921	FE0329		DPlate 058	E12							15	I24
8922	g_8922	RA0194		DPlate 060	E12			AU164515	AU164516			15	J24
8923	g_8923	FE0345	">TAU81318_1(U81318|pid:g1737492) Triticum aestivum poly(A)-binding   protein (wheatpab) mRNA, complete cds. "	DPlate 058	F12			AU174774	AU174773			15	K24
8924	g_8924	RA0155	">XLU37373_1(U37373|pid:g1234787) Xenopus laevis tail-specific   thyroid hormone up-regulated (gene 5) mRNA, complete   cds; up-regulated by thyroid hormone in tadpoles;   expressed specifically in the tail and only at   metamorphosis; membrane bound or extracellular protein;   C-terminal basic region. "	DPlate 060	F12			AU173063	AU173064			15	L24
8925	g_8925	FE0353	">D45066_1(D45066|pid:g1669341) Cucurbita maxima mRNA for AOBP   (ascorbate oxidase promoter-binding protein), complete   cds; Pumpkin cDNA for protein that binds to AT-rich   direct repeat sequence of pumpkin ascorbate oxidase   promoter.. "	DPlate 058	G12			AU174777				15	M24
8926	g_8926	RA0171		DPlate 060	G12			D23794	AU173065			15	N24
8927	g_8927	FE0369	>(P79141) MAJOR PRION PROTEIN PRECURSOR (PRP).   &CDPRPCELF_1(Y09760|pid:g1711298) 	DPlate 058	H12			AU176497				15	O24
8928	g_8928	RA0108		DPlate 060	H12			D23768				15	P24
8929	g_8929	RA0791		DPlate 062	A06			AU082556				16	A12
8930	g_8930	RA1663	>NTP450GEN_1(X96784|pid:g1237250) N.tabacum cytochrome P-450 gene. 	DPlate 064	A06			AU173197	AU173198			16	B12
8931	g_8931	RA0704	>CELF46F11_2(U88173|pid:g1825645) Caenorhabditis elegans cosmid   F46F11; weak similarity to Arabidopsis thaliana   ubiquitin-like protein 8. 	DPlate 062	B06			AU164608				16	C12
8932	g_8932	RA1679	">ATF17M5_25(AL035678|pid:g4490316) Arabidopsis thaliana DNA   chromosome 4, BAC clone F17M5 (ESSA project); strong   similarity to nucellin - Hordeum vulgare, PIR:G2290202;   Contains Eukaryotic and viral aspartyl proteases active   site [LDLDTGSDLTWL]. "	DPlate 064	B06			D24296	AU031777			16	D12
8933	g_8933	RA0712	">AF037454_1(AF037454|pid:g2827198) Mus musculus ubiquitin protein   ligase (Itch) mRNA, complete cds; Itchy. "	DPlate 062	C06			D23980	AU031710			16	E12
8934	g_8934	RA1687		DPlate 064	C06			D24299	AU031780			16	F12
8935	g_8935	RA0728	>AE000766_6(AE000766|pid:g2984225) Aquifex aeolicus section 98 of   109 of the complete genome. &F70469(F70469) 	DPlate 062	D06			D23987	AU031713			16	G12
8936	g_8936	RA1608		DPlate 064	D06			D24264	AU031772			16	H12
8937	g_8937	RA0760		DPlate 062	E06			AU173107				16	I12
8938	g_8938	RA1616		DPlate 064	E06			AU173176				16	J12
8939	g_8939	RA0784	>(P08772) LEAF-SPECIFIC THIONIN PRECURSOR (CLONE DB4).   &HVTHIOR1_1(X05576|pid:g19113)   &S07648(S07648;S06349;S00825;A38776) 	DPlate 062	F06			AU101637	AU101638			16	K12
8940	g_8940	RA1648		DPlate 064	F06			AU173191	AU173192			16	L12
8941	g_8941	RA0705	">ATFCA8_35(Z97343|pid:g2245108) Arabidopsis thaliana DNA chromosome   4, ESSA I contig fragment No. 8; similarity to EREBP-4   (Ethylene-inducible DNA binding proteins that interact   with anethylene-responsive element) - Nicotiana tabacum.   &E71444(E71444) "	DPlate 062	G06			D23976	AU101632			16	M12
8942	g_8942	RA1664	">AF083395_1(AF083395|pid:g4106818) Homo sapiens phospholipase   A2-activating protein mRNA, complete cds; PLAP; similar   to Rattus norvegicus PLAP: SwissProt Accession Number   P27612 and Mus musculus PLAP encoded by GenBank Accession   Number U17901; human PLAP is longer at its C terminus   when compared to Rattus norvegicus and Mus musculus PLAP.   "	DPlate 064	G06			AU173199	AU173200			16	N12
8943	g_8943	RA0721		DPlate 062	H06			D23984	AU162387			16	O12
8944	g_8944	RA1680	">ATAC005397_18(AC005397|pid:g3702332) Arabidopsis thaliana   chromosome II BAC T3F17 genomic sequence, complete   sequence; unknown protein. "	DPlate 064	H06			D39066	AU173206			16	P12
8945	g_8945	RA0930	">T8F5_23(AC004512|pid:g3335350) Arabidopsis thaliana chromosome 1   BAC T8F5 sequence, complete sequence; Similar to   gb|Z84386 anthranilat. "	DPlate 062	A12			D24036	AU031727			16	A24
8946	g_8946	RA1809	>(P19951) 40S RIBOSOMAL PROTEIN S14 (CLONE MCH2). &B30097(B30097) 	DPlate 064	A12			D24377	AU031799			16	B24
8947	g_8947	RA0954	>(P49200) 40S RIBOSOMAL PROTEIN S20 (S22). 	DPlate 062	B12			D24039	AU164651			16	C24
8948	g_8948	RA1817	">ATAC005396_7(AC005396|pid:g3650033) Arabidopsis thaliana chromosome   II BAC T26I20 genomic sequence, complete sequence;   unknown protein. "	DPlate 064	B12			D24383	AU173236			16	D24
8949	g_8949	RA0970	">ATU38916_1(U38916|pid:g1145627) Arabidopsis thaliana lipase mRNA,   complete cds. &S68410(S68410) "	DPlate 062	C12			AU070181	AU075830			16	E24
8950	g_8950	RA1833	">ATU97684_1(U97684|pid:g2738254) Arabidopsis thaliana peroxidase   precursor (RCI3A) mRNA, complete cds.   &YUP8H12_13(AC000098|pid:g2388571) "	DPlate 064	C12			D24395	C20492			16	F24
8951	g_8951	RA0939	">AC003027_17(AC003027|pid:g4204313) Arabidopsis thaliana chromosome   I BAC F21M11 genomic sequence, complete sequence;   Hypothetical protein. "	DPlate 062	D12			AU173118	AU173119			16	G24
8952	g_8952	RA1841	">ATAC004665_12(AC004665|pid:g3386619) Arabidopsis thaliana   chromosome II BAC F4I18 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 064	D12			D24401	AU031804			16	H24
8953	g_8953	RA0908		DPlate 062	E12			D24031	AU101639			16	I24
8954	g_8954	RA1857	">CEC12C8_4(Z81467|pid:g3874271) Caenorhabditis elegans cosmid C12C8,   complete sequence; predicted using Genefinder; Similarity   to Drosophila UDP-glucose:glycoprotein   glucosyltransferase (TR:Q09332); cDNA EST yk250b10.3   comes from this gene; cDNA EST yk250b10.5 comes from this   gene. &CEF26H9_7(Z81516|pid:g3876437) "	DPlate 064	E12			D24414	AU173243			16	J24
8955	g_8955	RA0932		DPlate 062	F12			AU173115				16	K24
8956	g_8956	RA1865	">AB021746_1(AB021746|pid:g4220610) Oryza sativa osnas1 mRNA for   nicotianamine synthase 1, complete cds. "	DPlate 064	F12			D24418	AU031809			16	L24
8957	g_8957	RA0964		DPlate 062	G12			AU164652				16	M24
8958	g_8958	RA1873	>(P23957) VACUOLAR ATP SYNTHASE 16 KD PROTEOLIPID SUBUNIT (EC   3.6.1.34). &A40814(A40814)   &ASTATPASEH_1(M73232|pid:g166549) 	DPlate 064	G12			D24424	AU173251			16	N24
8959	g_8959	RA1017		DPlate 062	H12			AU162394				16	O24
8960	g_8960	RA1810		DPlate 064	H12			AU173233				16	P24
8961	g_8961	RA2235	>CELF53G12_4(AF003139|pid:g2088717) Caenorhabditis elegans cosmid   F53G12; 	DPlate 066	A06			D24601	AU101659			17	A12
8962	g_8962	RA3149		DPlate 068	A06			D28324	AU032013			17	B12
8963	g_8963	RA2259	>S56685(S56685) histone H2B-8 - wheat   &WHTPH2B8B_1(D37943|pid:g531058) 	DPlate 066	B06			D24618	AU097682			17	C12
8964	g_8964	RA3110	">U89959_18(U89959|pid:g3258575) Arabidopsis thaliana BAC T7I23,   complete sequence; Hypothetical protein. "	DPlate 068	B06			D25073	AU032004			17	D12
8965	g_8965	RA2291	>LEAJ728_1(AJ000728|pid:g2661412) Lycopersicon esculentum mRNA for   MAP kinase kinase. 	DPlate 066	C06			D24638	C22591			17	E12
8966	g_8966	RA3126	">AC005882_2(AC005882|pid:g4508069) Arabidopsis thaliana chromosome I   BAC T13M11 genomic sequence, complete sequence;   Hypothetical protein. "	DPlate 068	C06			D25083	AU032008			17	F12
8967	g_8967	RA2204	>JE0156(JE0156)end-xyloglucan transferase (EC 2.4.1.-) - rice 	DPlate 066	D06			D24580	AU173330			17	G12
8968	g_8968	RA3134		DPlate 068	D06			D25089	AU032011			17	H12
8969	g_8969	RA2212	">AF007109_1(AF007109|pid:g3169719) Arabidopsis thaliana mRNA,   similar to yeast dcp1, complete cds; similar to yeast   dcp1. "	DPlate 066	E06			AU173334				17	I12
8970	g_8970	RA3166		DPlate 068	E06			D25102	AU162455			17	J12
8971	g_8971	RA2220	">ATAC005727_3(AC005727|pid:g3927825) Arabidopsis thaliana chromosome   II BAC F8N16 genomic sequence, complete sequence. "	DPlate 066	F06			D24589	AU173335			17	K12
8972	g_8972	RA3190	">ATF14M19_11(AL049480|pid:g4539301) Arabidopsis thaliana DNA   chromosome 4, BAC clone F14M19 (ESSA project);   similarity to Homo sapiens h-bcs1 (BCS1) mRNA, nuclear   gene encoding mitochondrial protein which is involved in   the expression of functional mitochondrial   ubiquinol-cytochrome c reductase complex probably via   the control of expression of Rieske iron-sulphur   protein. "	DPlate 068	F06			AU173454	AU173455			17	L12
8973	g_8973	RA2244	>(P38828) HYPOTHETICAL 21.3 KD PROTEIN IN MSH1-EPT1 INTERGENIC   REGION. &S48963(S48963)   &YSCH8263_22(U00059|pid:g529138) 	DPlate 066	G06			D24607	AU173337			17	M12
8974	g_8974	RA3127	">ATAC005560_8(AC005560|pid:g3785975) Arabidopsis thaliana chromosome   II BAC F2I9 genomic sequence, complete sequence;   hypothetical protein. "	DPlate 068	G06			D25084	AU173439			17	N12
8975	g_8975	RA2252	">SPBC25B2_5(AL031853|pid:g3738208) S.pombe chromosome II cosmid   c25B2; SPBC25B2.05, len:327, SIMILARITY:Saccharomyces   cerevisiae, YCL059C, YCF9_YEAST, strong similarity to   human Rev interacting protein Rip-1, (316 aa), fasta   scores: opt: 1510, E():0, (74.0% identity in 308 aa). "	DPlate 066	H06			D24612	AU031865			17	O12
8976	g_8976	RA3143	">AB012228_1(AB012228|pid:g3132310) Zea mays mRNA for   phosphoenolpyruvate carboxylase, complete cds; synonymous   gene name: Pep2 in maize linkage map. "	DPlate 068	H06			D25095	AU173441			17	P12
8977	g_8977	RA2417	">GHU58283_1(U58283|pid:g1706956) Gossypium hirsutum cellulose synthase   (celA1) mRNA, complete cds. "	DPlate 066	A12			D24711	AU031890			17	A24
8978	g_8978	RA3228	">AB011116_1(AB011116|pid:g3043612) Homo sapiens mRNA for KIAA0544   protein, partial cds. "	DPlate 068	A12			D39275	AU032025			17	B24
8979	g_8979	RA2433		DPlate 066	B12			D24720	AU031894			17	C24
8980	g_8980	RA3276	">ATAC006072_1(AC006072|pid:g4249418) Arabidopsis thaliana chromosome   II BAC T9J23 genomic sequence, complete sequence. "	DPlate 068	B12			D25133	AU032037			17	D24
8981	g_8981	RA2473	>GMACIDPHO_1(AJ223074|pid:g3341443) Glycine max mRNA for root nodule   acid phosphatase. 	DPlate 066	C12			D24742	AU173378			17	E24
8982	g_8982	RA3229		DPlate 068	C12			AU173467	AU173468			17	F24
8983	g_8983	RA2489	">AC005034_3(AC005034|pid:g3947439) Homo sapiens BAC clone NH0342K06   from 2, complete sequence; match to P16383   (PID:g121059); note frameshift at base 115266;   H_NH0342K06.2. "	DPlate 066	D12			D24749	AU162439			17	G24
8984	g_8984	RA3253	">ATAC004138_10(AC004138|pid:g3461820) Arabidopsis thaliana   chromosome II BAC T17M13 genomic sequence, complete   sequence; unknown protein. "	DPlate 068	D12			D25120	AU173470			17	H24
8985	g_8985	RA2402	>(P36049) HYPOTHETICAL 49.7 KD PROTEIN IN GIN2-STE3 INTERGENIC   REGION. &S38002(S38002;S44589;S38409)   &SCDCHRL11_7(Z26878|pid:g407510)   &SCYKL172W_1(Z28172|pid:g486302) 	DPlate 066	E12			D24701	AU173354			17	I24
8986	g_8986	RA3262	">ATAC003672_26(AC003672|pid:g3341697) Arabidopsis thaliana   chromosome II BAC F16B22 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 068	E12			D25127	AU032033			17	J24
8987	g_8987	RA2418	>CELC17G10_9(U28739|pid:g2731377) Caenorhabditis elegans cosmid   C17G10; similar to alcohol dehydrogenase/ribitol   dehydrogenase; coded for by C. elegans cDNA yk24d12.5;   coded for by C. elegans cDNA yk130f7.3; coded for by C.   elegans cDNA yk130f7.5. 	DPlate 066	F12			D24712	AU173357			17	K24
8988	g_8988	RA3270	">CEH13N06_5(Z99942|pid:g3878059) Caenorhabditis elegans cosmid   H13N06, complete sequence; cDNA EST EMBL:D73444 comes   from this gene; cDNA EST EMBL:D70905 comes from this   gene; cDNA EST EMBL:D72208 comes from this gene; cDNA   EST EMBL:D75030 comes from this gene; cDNA EST   EMBL:D72944 comes from this gene; cDNA EST EMBL:D75907   comes from this gene; cDNA EST yk204d2.3 comes from this   gene; cDNA EST yk204d2.5 comes from this gene; cDNA EST   yk256c12.3 comes from this gene; cDNA EST yk256c12.5   comes from this gene; cDNA EST yk291a7.3 comes from this   gene; cDNA EST yk291a7.5 comes from this gene; cDNA EST   yk300e9.3 comes from this gene; cDNA EST yk300e9.5 comes   from this gene; cDNA EST yk309c4.3 comes from this gene;   cDNA EST yk309c4.5 comes from this gene; cDNA EST   yk309h9.3 comes from this gene; cDNA EST yk309h9.5 comes   from this gene; cDNA EST yk314d6.3 comes from this gene;   cDNA EST yk314d6.5 comes from this gene; cDNA EST   yk374c4.3 comes from this gene; cDNA EST yk374c4.5 comes   from this gene; cDNA EST yk417a11.5 comes from this   gene; cDNA EST yk448a11.3 comes from this gene; cDNA EST   yk448a11.5 comes from this gene; cDNA EST yk458h6.3   comes from this gene; cDNA EST yk458h6.5 comes from this   gene; cDNA EST yk462b1.3 comes from this gene; cDNA EST   yk462b1.5 comes from this gene; cDNA EST yk466b11.3   comes from this gene; cDNA EST yk466b11.5 comes from   this gene; cDNA EST yk467d5.5 comes from this gene; cDNA   EST yk476a7.3 comes from this gene; cDNA EST yk476a7.5   comes from this gene; cDNA EST EMBL:Z14746 comes from   this gene; cDNA EST EMBL:M88821 comes from this gene. "	DPlate 068	F12			AU173471	AU173472			17	L24
8989	g_8989	RA2482	">ATF20M13_16(AL035540|pid:g4467147) Arabidopsis thaliana DNA   chromosome 4, BAC clone F20M13 (ESSA project);   similarity to ubiquitin fusion degradation protein -   Schizosaccharomyces pombe, PID:e1132723; contains EST   gb:T88393, F15115, AA712663, AA713098, H36576. "	DPlate 066	G12			AU173381	AU173382			17	M24
8990	g_8990	RA3223		DPlate 068	G12			D39271	AU173465			17	N24
8991	g_8991	RA2411	">ATAC006067_6(AC006067|pid:g4263818) Arabidopsis thaliana chromosome   II BAC T13P21 genomic sequence, complete sequence;   unknown protein. "	DPlate 066	H12			D24706	AU173355			17	O24
8992	g_8992	RA3239	>S33812(S33812)myosin-like protein ATM - Arabidopsis thaliana 	DPlate 068	H12			D39283	AU032027			17	P24
8993	g_8993	RA3746	">RICRCC3_1(L27208|pid:g786132) Oryza sativa root-specific RCc3 mRNA,   complete cds. &S53012(S53012) "	DPlate 070	A06			AU065430	AU173792			18	A12
8994	g_8994	RB0592		DPlate 072	A06			AU071002				18	B12
8995	g_8995	RA3762		DPlate 070	B06			AU162521				18	C12
8996	g_8996	RB0577	">HPU23857_2(U23857|pid:g775215) Herpesvirus papio BRRF2 homolog   gene, partial cds, EBNA1, BKRF2 homolog and BKRF3   homolog genes, complete cds, and BKRF4 homolog gene,   partial cds; similar to EBNA1 of Epstein-Barr virus,   Swiss-Prot Accession Number P03211. "	DPlate 072	B06			AU070989				18	D12
8997	g_8997	RA3794	">CRO011862_1(AJ011862|pid:g3954807) Catharanthus roseus mRNA for   flavonoid 3',5'-hydroxylase. "	DPlate 070	C06			AU032242				18	E12
8998	g_8998	RB0506		DPlate 072	C06			AU078364	AU070944			18	F12
8999	g_8999	RA3739	">ATF1C12_24(AL022224|pid:g3046696) Arabidopsis thaliana DNA   chromosome 4, BAC clone F1C12 (ESSAII project); strong   similarity to CTP synthase, Methanococcus jannaschii,   PIR2:E64446; Contains Glutamine amidotransferases   class-I active site [PYLGICLGMQLA]. "	DPlate 070	D06			AU032225	AU173791			18	G12
9000	g_9000	RB0522	">ATAC006284_19(AC006284|pid:g4335761) Arabidopsis thaliana   chromosome II BAC T4M8 genomic sequence, complete   sequence; unknown protein. "	DPlate 072	D06			AU070953	AU108935			18	H12
9001	g_9001	RA3763	">AF069442_6(AF069442|pid:g3924598) Arabidopsis thaliana BAC T4I9,   chromosome IV, near 17 cM, complete sequence; similar to   P. vulgaris gibberellin 20-oxidase, GenBank accession   number U70530; similar to P. sativum gibberellin   20-oxidase, GenBank accession number U58830; similar to   O. sativa gibberellin C-20 oxidase, GenBank accession   number U50333; most similar to T4I9.5 an. "	DPlate 070	E06			AU032229	AU173799			18	I12
9002	g_9002	RB0530		DPlate 072	E06			AU077762	AU077763			18	J12
9003	g_9003	RA3795		DPlate 070	F06			AU173803				18	K12
9004	g_9004	RB0538		DPlate 072	F06			AU070964				18	L12
9005	g_9005	RA3724	>(P25866) UBIQUITIN-CONJUGATING ENZYME E2-17 KD (EC 6.3.2.19)   (UBIQUITIN-PROTEIN LIGASE) (UBIQUITIN CARRIER PROTEIN).    &WHTUCP1A_1(M62720|pid:g170785) 	DPlate 070	G06			AU032220	AU162519			18	M12
9006	g_9006	RB0562		DPlate 072	G06			AU070980	AU078150			18	N12
9007	g_9007	RA3748	>(Q08752) 40 KD PEPTIDYL-PROLYL CIS-TRANS ISOMERASE (EC 5.2.1.8)   (PPIASE) (ROTAMASE) (CYCLOPHILIN-40) (CYP-40)   (CYCLOPHILIN-RELATED PROTEIN).   &A45981(A45981;S36372;S33658)   &D63861_1(D63861|pid:g1769812)   &HUMCYC40A_1(L11667|pid:g348910) 	DPlate 070	H06			AU070213	AU173793			18	O12
9008	g_9008	RB0547	">TOBBY4B_1(D38124|pid:g1208496) Tobacco mRNA for EREBP-3, complete   cds. "	DPlate 072	H06			AU070969	AU083505			18	P12
9009	g_9009	RA3959	">D88460_1(D88460|pid:g2116984) Homo sapiens mRNA for N-WASP,   complete cds. "	DPlate 070	A12			AU032372				18	A24
9010	g_9010	RB0725		DPlate 072	A12			AU071091				18	B24
9011	g_9011	RA3967		DPlate 070	B12			AU070234	AU173829			18	C24
9012	g_9012	RB0741	">AF004358_1(AF004358|pid:g2190992) Aegilops squarrosa glutathione   S-transferase TSI-1 mRNA, complete cds; GST isozyme. "	DPlate 072	B12			AU078259				18	D24
9013	g_9013	RA3912	>(Q03104) HYPOTHETICAL 59.6 KD PROTEIN IN COX14-HMGS INTERGENIC   REGION. &S58200(S58200) &SC4987_7(Z50178|pid:g927534) 	DPlate 070	C12			AU032337	AU173819			18	E24
9014	g_9014	RB0749	>SDTUBERPR_1(X98304|pid:g1370589) S.demissum mRNA for protein   induced upon tuberization; putative transit peptide. 	DPlate 072	C12			AU078041	AU078042			18	F24
9015	g_9015	RA3936	">AC002560_2(AC002560|pid:g2809233) Arabidopsis thaliana BAC F21B7   chromosome 1, complete sequence; unknown; similar to   ESTs gb|AA605440 and gb|H37232. "	DPlate 070	D12			AU162552				18	G24
9016	g_9016	RB0718	">AC002328_7(AC002328|pid:g3953462) Genomic sequence for Arabidopsis   thaliana BAC F20N2, complete sequence; hypothetical   protein. "	DPlate 072	D12			AU071085	AU163487			18	H24
9017	g_9017	RA3960	>ART223802_1(AJ223802|pid:g4210330) Arabidopsis thaliana mRNA for   2-oxoglutarate dehydrogenase E1 subunit. 	DPlate 070	E12			AU162557	AU032373			18	I24
9018	g_9018	RB0742	">AF041046_1(AF041046|pid:g2911364) Zea mays NADPH HC toxin reductase   (hm1) gene, hm1-MO21A allele, complete cds. "	DPlate 072	E12			AU071102				18	J24
9019	g_9019	RA3984		DPlate 070	F12			AU032392	AU173830			18	K24
9020	g_9020	RB0774	">RICOSH45S2_1(D49704|pid:g1805617) Rice OSH45 gene for OSH42, OSH44   and OSH45 transcripts, exon 2, 3, 4, 5, 6 and 7,   complete cds; OSH44 transcript; homeobox gene. "	DPlate 072	F12			AU173856				18	L24
9021	g_9021	RA3992	>RNMAP01_1(X02299|pid:g758263) Rat mRNA for major acute phase   alpha-1 protein (MAP). 	DPlate 070	G12			AU032398	AU032399			18	M24
9022	g_9022	RB0711		DPlate 072	G12			AU071080	AU095604			18	N24
9023	g_9023	RA3905	>(P28032) ALCOHOL DEHYDROGENASE 2 (EC 1.1.1.1).   &LEADH2_1(X77233|pid:g623249)   &S51826(S51826;JT0618;S20613;S16038)   &TOMADH2A_1(M86724|pid:g170368) 	DPlate 070	H12			AU173817	AU173818			18	O24
9024	g_9024	RB0735	>OSLIP19_1(X57325|pid:g394736) Rice lip19 mRNA for basic/leucine   zipper protein. &S35193(S35193) 	DPlate 072	H12			AU091466	AU091467			18	P24
9025	g_9025	SA0128	">AF059484_1(AF059484|pid:g3420239) Gossypium hirsutum actin gene,   complete cds. "	DPlate 074	A06			AU055888	AU055889			19	A12
9026	g_9026	SA1133	">ATAC002332_13(AC002332|pid:g2459419) Arabidopsis thaliana   chromosome II BAC F4P9 genomic sequence, complete   sequence; hypothetical protein. "	DPlate 078	A06			AU057081	AU057082			19	B12
9027	g_9027	SA0160	>A38840_1(A38840|pid:g2295264) Sequence 1 from Patent WO9413814;   unnamed protein product. &S52645(S52645)   &ZM1AG3PAT_1(Z29518|pid:g575960) 	DPlate 074	B06			AU055932	AU055933			19	C12
9028	g_9028	SA1141	">PEAGTPBP05_1(D12544|pid:g303742) Pea mRNA for GTP-binding protein,   complete cds. "	DPlate 078	B06			AU057091	AU057092			19	D12
9029	g_9029	SA0168	>(P09229) CYSTEINE PROTEINASE INHIBITOR-I (ORYZACYSTATIN-I).   &A28464(B28464;A28464) &OSU54702_1(U54702|pid:g1280613)   &RICCPI_1(J03469|pid:g169784)   &RICOCS_1(M29259|pid:g169807)   &S49967_1(S49967|pid:g259137) 	DPlate 074	C06			AU055940	AU055941			19	E12
9030	g_9030	SA1149		DPlate 078	C06			AU057104				19	F12
9031	g_9031	SA0176	">AC002294_7(AC002294|pid:g2443881) Arabidopsis thaliana chromosome I   BAC F11P17 genomic sequence, complete sequence; contains   beta-transducin motif. "	DPlate 074	D06			AU055952	AU055953			19	G12
9032	g_9032	SA1157	>(P42762) ERD1 PROTEIN PRECURSOR. &ATHERD1_1(D17582|pid:g497629)   &JN0901(JN0901) 	DPlate 078	D06			AU162737	AU057110			19	H12
9033	g_9033	SA0184	>SPAC3G9_9(AL021046|pid:g2706460) S.pombe chromosome I cosmid c3G9;   SPAC3G9.09c; len:306aa. 	DPlate 074	E06			AU055966	AU055967			19	I12
9034	g_9034	SA1165		DPlate 078	E06			AU057115	AU173941			19	J12
9035	g_9035	SA0105	>CELF10G7_9(U40029|pid:g1055161) Caenorhabditis elegans cosmid   F10G7; similar to human 100 kDa coactivator (U22055). 	DPlate 074	F06			AU078722	AU055859			19	K12
9036	g_9036	SA1181	">AF045458_1(AF045458|pid:g3435114) Homo sapiens serine/threonine   kinase ULK1 (ULK1) mRNA, complete cds; unc-51   (Caenorhabditis elegans)-like kinase 1. "	DPlate 078	F06			AU057133				19	L12
9037	g_9037	SA0121	">ATAC005397_26(AC005397|pid:g3702339) Arabidopsis thaliana   chromosome II BAC T3F17 genomic sequence, complete   sequence; unknown protein. "	DPlate 074	G06			AU055880	AU055881			19	M12
9038	g_9038	SA1189		DPlate 078	G06			AU057143	AU173943			19	N12
9039	g_9039	SA0129	">(P50433) SERINE HYDROXYMETHYLTRANSFERASE, MITOCHONDRIAL PRECURSOR   (EC 2.1.2.1) (SERINE METHYLASE) (GLYCINE   HYDROXYMETHYLTRANSFERASE) (SHMT). &S40218(S40218)   &STGHMT_1(Z25863|pid:g438247) "	DPlate 074	H06			AU055890	AU055891			19	O12
9040	g_9040	SA1102		DPlate 078	H06			AU057056				19	P12
9041	g_9041	SA0227		DPlate 074	A12			AU056020	AU056021			19	A24
9042	g_9042	SA1237		DPlate 078	A12			AU057199				19	B24
9043	g_9043	SA0235	">PFMAL3P5_2(AL034556|pid:g4493932) Plasmodium falciparum MAL3P5,   complete sequence; predicted using hexExon; MAL3P5.2   (PFC0580c), Hypothetical protein, len: 1097 aa. "	DPlate 074	B12			AU162645	AU056029			19	C24
9044	g_9044	SA1245		DPlate 078	B12			AU057208				19	D24
9045	g_9045	SA0243	>TAFKBP77_1(Y07636|pid:g1915960) T.aestivum mRNA for peptidylprolyl   isomerase. 	DPlate 074	C12			AU056043	AU056044			19	E24
9046	g_9046	SA1246	>STPLATDTR_1(Y10821|pid:g4138583) Solanum tuberosum mRNA for plastidic   ATP/ADP-transporter. 	DPlate 078	C12			AU057209	AU057210			19	F24
9047	g_9047	SA0251	>(Q03200) LIGHT REGULATED PROTEIN PRECURSOR.   &OSLIAA_1(X68807|pid:g20263) &S33632(S33632) 	DPlate 074	D12			AU075847	AU056052			19	G24
9048	g_9048	SA1262		DPlate 078	D12			AU173946	AU057231			19	H24
9049	g_9049	SA0283	">RICGR_1(D78136|pid:g1841894) Rice mRNA for cytosolic glutathione   reductase, complete cds; putative. "	DPlate 074	E12			AU056093	AU162649			19	I24
9050	g_9050	SA1270	>DMC87B1_4(Z98269|pid:g2894096) Drosophila melanogaster cosmid 87B1;   	DPlate 078	E12			AU057242	AU057243			19	J24
9051	g_9051	SA0291		DPlate 074	F12			AU056106	AU077769			19	K24
9052	g_9052	SA1286		DPlate 078	F12			AU057266				19	L24
9053	g_9053	SA0228		DPlate 074	G12			AU173868	AU056022			19	M24
9054	g_9054	SA1207	>(Q03554) HYPOTHETICAL 15.4 KD PROTEIN IN MSU1-JNM1 INTERGENIC   REGION. &S47453(S47453) &SC8175_4(X80836|pid:g530349) 	DPlate 078	G12			AU057155	AU057156			19	N24
9055	g_9055	SA0236	">T12M4_19(AC003114|pid:g3249109) Arabidopsis thaliana chromosome 1   BAC T12M4 sequence, complete sequence; Contains   similarity to pre-mRNA splicing factor (SF2), P33   subunit gb|M72709 from Homo sapiens. ESTs gb|T42588 and   gb|R65514 come from this gene.. "	DPlate 074	H12			AU056030	AU056031			19	O24
9056	g_9056	SA1223		DPlate 078	H12			AU057179				19	P24
9057	g_9057	SA0868	">ATAC005967_7(AC005967|pid:g4115377) Arabidopsis thaliana chromosome   II BAC F27D4 genomic sequence, complete sequence;   unknown protein. "	DPlate 077	A06			AU162719	AU056777			20	A12
9058	g_9058	SA1753		DPlate 080	A06			AU057749				20	B12
9059	g_9059	SA0829	">CEY11D7A_13(AL032632|pid:g3880731) Caenorhabditis elegans cosmid   Y11D7A, complete sequence; predicted using Genefinder;   similar to Myosin head (motor domain); cDNA EST   yk209b12.5 comes from this gene; cDNA EST yk248g5.3 comes   from this gene; cDNA EST yk248g5.5 comes from this gene;   cDNA EST yk398h10.3 comes from this gene; cDNA EST   yk398h10.5 comes from this gene; cDNA EST yk209b12.3   comes from this gene; cDNA EST yk429e8.3 comes from this   gene; cDNA EST yk429e8.5 comes from this gene; cDNA EST   yk270g7.3 comes from this gene; cDNA EST yk270g7.5 comes   from this gene. "	DPlate 077	B06			AU173921	AU173922			20	C12
9060	g_9060	SA1769		DPlate 080	B06			AU057770	AU057771			20	D12
9061	g_9061	SA0837	">ATAC002332_18(AC002332|pid:g2459445) Arabidopsis thaliana   chromosome II BAC F4P9 genomic sequence, complete   sequence; "	DPlate 077	C06			AU056735	AU056736			20	E12
9062	g_9062	SA1777	">STU72489_1(U72489|pid:g1881585) Solanum tuberosum remorin mRNA,   complete cds; plasma-membrane associated phosphoprotein.   "	DPlate 080	C06			AU173969	AU057779			20	F12
9063	g_9063	SA0845	">ATAC006587_10(AC006587|pid:g4510407) Arabidopsis thaliana   chromosome II BAC T17D12 genomic sequence, complete   sequence; unknown protein. "	DPlate 077	D06			AU056748	AU056749			20	G12
9064	g_9064	SA1754	">AF051240_1(AF051240|pid:g2982311) Picea mariana probable   ubiquitin-conjugating enzyme E2 (Sb55) mRNA, complete   cds; similar to Saccharomyces cerevisiae   ubiquitin-conjugating enzyme Ubc6p encoded by GenBank   Accession Number U18839. "	DPlate 080	D06			AU082746	AU057750			20	H12
9065	g_9065	SA0869		DPlate 077	E06			AU162720	AU056778			20	I12
9066	g_9066	SA1770	>A61183(A61183;S27643)hypothetical protein (sdsB region) -   Pseudomonas sp. 	DPlate 080	E06			AU057772	AU057773			20	J12
9067	g_9067	SA0814	">AB013448_1(AB013448|pid:g4521190) Oryza sativa gene for Pib, complete   cds. &AB013449_1(AB013449|pid:g4521192) "	DPlate 077	F06			AU056707	AU056708			20	K12
9068	g_9068	SA1732		DPlate 080	F06			AU077808	AU077809			20	L12
9069	g_9069	SA0822		DPlate 077	G06			AU162714	AU056718			20	M12
9070	g_9070	SA1756		DPlate 080	G06			AU173967	AU173968			20	N12
9071	g_9071	SA0838		DPlate 077	H06			AU056737	AU056738			20	O12
9072	g_9072	SA1764	>(P48504) UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX 7.8 KD PROTEIN   (EC 1.10.2.2) (MITOCHONDRIAL HINGE PROTEIN) (CR7). 	DPlate 080	H06			AU057763				20	P12
9073	g_9073	SA0985	">PFAMMSA_1(M34047|pid:g160411) P.chabaudi major merozoite surface   antigen gene, partial cds; major merozoite surface   antigen. "	DPlate 077	A12			AU173936	AU173937			20	A24
9074	g_9074	SA1913	>(P19950) 40S RIBOSOMAL PROTEIN S14 (CLONE MCH1). &A30097(A30097) 	DPlate 080	A12			AU075866	AU057926			20	B24
9075	g_9075	SA0922	">F9K20_3(AC005679|pid:g3834303) Arabidopsis thaliana chromosome 1   BAC F9K20 sequence, complete sequence; "	DPlate 077	B12			AU056842	AU056843			20	C24
9076	g_9076	SA1961	">ATAC005727_15(AC005727|pid:g3927836) Arabidopsis thaliana   chromosome II BAC F8N16 genomic sequence, complete   sequence; unknown protein. "	DPlate 080	B12			AU057979	AU057980			20	D24
9077	g_9077	SA0962	">AC002292_31(AC002292|pid:g2462749) Genomic sequence of Arabidopsis   BAC F8A5, complete sequence; "	DPlate 077	C12			AU056895	AU056896			20	E24
9078	g_9078	SA1906		DPlate 080	C12			AU057917				20	F24
9079	g_9079	SA0970	">AF097667_1(AF097667|pid:g4206122) Mesembryanthemum crystallinum   protein phosphatase 2C homolog (PP2C) mRNA, complete   cds. "	DPlate 077	D12			AU162725	AU056909			20	G24
9080	g_9080	SA1914		DPlate 080	D12			AU057927	AU057928			20	H24
9081	g_9081	SA0978	>(P37727) RAB PROTEINS GERANYLGERANYLTRANSFERASE COMPONENT A 1 (RAB   ESCORT PROTEIN 1) (REP-1). &A40686(A40686)   &RATRABGERT_1(L13722|pid:g347439) 	DPlate 077	E12			AU056915	AU056916			20	I24
9082	g_9082	SA1970	>S49325(S53486;S49325) ADP-ribosylation factor - maize   &ZMADPRF_1(X80042|pid:g556686) 	DPlate 080	E12			AU057993	AU057994			20	J24
9083	g_9083	SA0986	">A57676(A57676) protein kinase Xa21 (EC 2.7.1.-), receptor type   precursor - rice &OLU72723_1(U72723|pid:g2586085)   &OSU37133_1(U37133|pid:g1122443) "	DPlate 077	F12			AU056925	AU056926			20	K24
9084	g_9084	SA1978	">AF042839_1(AF042839|pid:g2809481) Oryza sativa calmodulin (CaM2)   mRNA, complete cds. "	DPlate 080	F12			AU173975	AU173976			20	L24
9085	g_9085	SA0907	">T14P8_11(AF069298|pid:g3193290) Arabidopsis thaliana BAC T14P8;   contains similarity to a protein kinase domain (Pfam:   pkinase.hmm, score: 165.48), to legume lectins beta   domain (Pfam: lectin_legB.hmm, score: 125.64) and legume   lectins alpha domain (Pfam: lectin_legA.hmm, score:   16.72). "	DPlate 077	G12			AU173928	AU056821			20	M24
9086	g_9086	SA1994		DPlate 080	G12			AU058015				20	N24
9087	g_9087	SA0915	>AE000745_3(AE000745|pid:g2983919) Aquifex aeolicus section 77 of   109 of the complete genome. &G70433(G70433) 	DPlate 077	H12			AU056832				20	O24
9088	g_9088	SA1931	">ATF6G17_12(AL035601|pid:g4468813) Arabidopsis thaliana DNA   chromosome 4, BAC clone F6G17 (ESSA project);   similarity to beta-ketoadipate enol-lactone hydrolase,   Acinetobacter sp., L05770; contains EST gb:T45314,   AA586098, R90091. "	DPlate 080	H12			AU057946	AU057947			20	P24
9089	g_9089	SS3235	">AF067185_1(AF067185|pid:g3158476) Samanea saman aquaporin 2 (Aqp2)   mRNA, complete cds. "	DPlate 082	A06			D47629	AU032672			21	A12
9090	g_9090	SS5528		DPlate 084	A06			AU163105				21	B12
9091	g_9091	SS3251	">AC002534_10(AC002534|pid:g2392772) Arabidopsis thaliana BAC T32N15   from chromsome V, complete sequence; similar to   bacterial PheA gene products; the lack of similarity in   the N-terminal region between T32N15.11 and bacterial   PheA gene products may indicate the presence of a   targeting sequence that routes T32N15.11 to the   chloroplast; in E. coli this enzyme catalyzes the   decarboxylation of prephenate to phenylpyruvate in the   penultimate step of phenylalanine biosynthesis; protein   motifs for prephenate dehydratase are located from   residue 279 to 301 [YNLQI..RFLML] (region includes a   conserved threonine found to be essential for E. coli   enzyme activity) and around a conserved glutamate, from   residue 345 to 352 [LTKIESRP]. "	DPlate 082	B06			D47635	AU174014			21	C12
9092	g_9092	SS5536		DPlate 084	B06			AU032868				21	D12
9093	g_9093	SS3204		DPlate 082	C06			D47608	AU174012			21	E12
9094	g_9094	SS5552		DPlate 084	C06			D48957	AU075886			21	F12
9095	g_9095	SS3261	">SPCC1223_8(AL031579|pid:g3618214) S.pombe chromosome III cosmid   c1223; SPCC1223.08c, len:460. "	DPlate 082	D06			D47643	AU174016			21	G12
9096	g_9096	SS5513		DPlate 084	D06			D48933	AU101818			21	H12
9097	g_9097	SS3277	">ATF10M23_1(AL035440|pid:g4455190) Arabidopsis thaliana DNA   chromosome 4, BAC clone F10M23 (ESSAII project); weak   similarity to probable membrane protein YDL217c - yeast,   EMBL:Z74265; contains EST gb:T46407, AA404844. "	DPlate 082	E06			D47654	AU174018			21	I12
9098	g_9098	SS5561	">ATAC005851_14(AC005851|pid:g4063751) Arabidopsis thaliana   chromosome II BAC F24D13 genomic sequence, complete   sequence; &ATAC006929_1(AC006929|pid:g4510409) "	DPlate 084	E06			D48964				21	J12
9099	g_9099	SS3238		DPlate 082	F06			D47630	AU174013			21	K12
9100	g_9100	SS5593		DPlate 084	F06			D48992	AU101823			21	L12
9101	g_9101	SS3262	>(P09415) 50S RIBOSOMAL PROTEIN L18. &R5BS8F(B29102;D39085) 	DPlate 082	G06			D47644	AU101770			21	M12
9102	g_9102	SS5506		DPlate 084	G06			D48928	AU101817			21	N12
9103	g_9103	SS3270		DPlate 082	H06			D47649	AU174017			21	O12
9104	g_9104	SS5530	">ATAC002561_18(AC002561|pid:g2673918) Arabidopsis thaliana   chromosome II BAC T24P15 genomic sequence, complete   sequence; "	DPlate 084	H06			D48943	AU101819			21	P12
9105	g_9105	SS3917	">AB003521_1(AB003521|pid:g2077900) Saccharomyces cerevisiae gene for   flocculin, partial cds. "	DPlate 082	A12			D48009				21	A24
9106	g_9106	SS5876		DPlate 084	A12			AU101838	AU101839			21	B24
9107	g_9107	SS3973	>EGCCR_1(X79566|pid:g2058311) E.gunnii CCR mRNA. 	DPlate 082	B12			D48045				21	C24
9108	g_9108	SS5884		DPlate 084	B12			AU162082	AU032886			21	D24
9109	g_9109	SS3918	>GMACIDPHO_1(AJ223074|pid:g3341443) Glycine max mRNA for root nodule   acid phosphatase. 	DPlate 082	C12			D48010	AU174028			21	E24
9110	g_9110	SS5892	">AB018587_1(AB018587|pid:g4240033) Zea mays ZmGR1a mRNA, complete   cds. "	DPlate 084	C12			D49184	AU032887			21	F24
9111	g_9111	SS3926	">ZMU23188_1(U23188|pid:g733454) Zea mays chlorophyll a/b-binding   apoprotein CP26 (Lhcb5-1) mRNA, complete cds. "	DPlate 082	D12			D48016	AU174030			21	G24
9112	g_9112	SS5813		DPlate 084	D12			D49127				21	H24
9113	g_9113	SS3974	">AF088281_1(AF088281|pid:g4093155) Arabidopsis thaliana   phytochrome-associated protein 1 (PAP1) mRNA, complete   cds; IAA/AXR family member. "	DPlate 082	E12			D48046				21	I24
9114	g_9114	SS5893		DPlate 084	E12			D49185	AU162086			21	J24
9115	g_9115	SS3983	">GHU58284_1(U58284|pid:g1706958) Gossypium hirsutum cellulose   synthase (celA2) mRNA, partial cds. "	DPlate 082	F12			D48053	AU174036			21	K24
9116	g_9116	SS5822	">ATF24G24_7(AL049488|pid:g4538956) Arabidopsis thaliana DNA   chromosome 4, BAC clone F24G24 (ESSA project);   similarity to wound-induced protein, Lycopersicon   esculentum, PIR2:S19773. &T9A4_3(AF096373|pid:g3695408)   "	DPlate 084	F12			AU175148				21	L24
9117	g_9117	SS3912	">(P12782) PHOSPHOGLYCERATE KINASE, CHLOROPLAST PRECURSOR (EC   2.7.2.3). &TAPGKCHL_1(X15233|pid:g21833)   &TAPHOK_1(X73528|pid:g3293043) &TVWTGC(S05967) "	DPlate 082	G12			D48005	AU174027			21	M24
9118	g_9118	SS5886	">LEPT52_1(X59882|pid:g19320) L.esculentum pT52 mRNA for   wound-induced gene, partial cds. &S19773(S19773) "	DPlate 084	G12			D49178	AU089783			21	N24
9119	g_9119	SS3944		DPlate 082	H12			AU181026				21	O24
9120	g_9120	SS5815	">AB018412_1(AB018412|pid:g3738261) Populus nigra PnChlPGK mRNA for   chloroplast phosphoglycerate kinase, complete cds. "	DPlate 084	H12			AU174089				21	P24
9121	g_9121	ST0078	">OSU33283_1(U33283|pid:g1109672) Oryza sativa Ca2+ sensitive   3'(2'),5-diphosphonucleoside 3'(2') phosphohydrolase   mRNA, complete cds; similar to yeast HAL2 product. "	DPlate 086	A06			D39372	AU101896			22	A12
9122	g_9122	ST1749		DPlate 088	A06			D40028	AU174221			22	B12
9123	g_9123	ST0086	">D88434_1(D88434|pid:g4519507) Malus domestica mRNA for protein   abundantly expressed during apple fruit development,   complete cds; similar to Garden Pea turgor-responsive   protein 26g. "	DPlate 086	B06			AU032971	AU101898			22	C12
9124	g_9124	ST1765	">ATAC004218_3(AC004218|pid:g3355466) Arabidopsis thaliana chromosome   II BAC F12L6 genomic sequence, complete sequence;   unknown protein. "	DPlate 088	B06			D40040	AU161624			22	D12
9125	g_9125	ST0094	">ATAC004401_3(AC004401|pid:g3169172) Arabidopsis thaliana chromosome   II BAC F21P24 genomic sequence, complete sequence.   &ATAC004786_18(AC004786|pid:g3445214) "	DPlate 086	C06			AU161513	AU058085			22	E12
9126	g_9126	ST1781		DPlate 088	C06			AU033053				22	F12
9127	g_9127	ST0007		DPlate 086	D06			AU066033	AU075534			22	G12
9128	g_9128	ST1702		DPlate 088	D06			AU174218				22	H12
9129	g_9129	ST0015	">T1G11_13(AC002376|pid:g2494116) Sequence of BAC T1G11 from   Arabidopsis thaliana chromosome 1, complete sequence;   Similar to Synechocystis hypothetical protein   (gb|D90915).. "	DPlate 086	E06			AU066035	AU032948			22	I12
9130	g_9130	ST1782	">ATFCA0_18(Z97335|pid:g2244765) Arabidopsis thaliana DNA chromosome   4, ESSA I contig fragment No. 0; similarity to   proton-coupled peptide transporter PEPT - Rattus   norvegicus. &B71402(B71402) "	DPlate 088	E06			D40053	AU174223			22	J12
9131	g_9131	ST0023	>HSFAA_1(X51728|pid:g31291) Human mRNA for fumarylacetoacetase (EC   3.7.1.2); fumarylacetoacetase (AA 1-349). 	DPlate 086	F06			AU066037	AU032951			22	K12
9132	g_9132	ST1711		DPlate 088	F06			D39999	AU101933			22	L12
9133	g_9133	ST0039	>I75615(I75615;I75614)mammary tumor integration site 6 oncogene   protein - mouse 	DPlate 086	G06			D39363	AU174139			22	M12
9134	g_9134	ST1759	">AB012766_1(AB012766|pid:g3298476) Oryza sativa gene for ovp2,   complete cds. &D45384_1(D45384|pid:g1747296)   &S72527(S72527) "	DPlate 088	G06			AU033051				22	N12
9135	g_9135	ST0047	>OSRSS1A_1(X64770|pid:g20366) O.sativa RSs1 gene for sucrose synthase.   &S23543(S23543;S25526) 	DPlate 086	H06			D39365	AU163158			22	O12
9136	g_9136	ST1704	">ATAC005313_13(AC005313|pid:g3548810) Arabidopsis thaliana   chromosome II BAC T18E12 genomic sequence, complete   sequence; "	DPlate 088	H06			AU161617				22	P12
9137	g_9137	ST0687	>ZMAC1_1(X05424|pid:g22113) Maize transposable element Activator   (Ac) major transcript. 	DPlate 086	A12			AU101917	AU101918			22	A24
9138	g_9138	ST1946	">AB024712_1(AB024712|pid:g4521159) Arabidopsis thaliana ATC   (centroradialis) gene, complete cds, strain:Landsberg.   &AB024714_1(AB024714|pid:g4521161)   &AB024715_1(AB024715|pid:g4521163)   &ATAC005824_32(AC005824|pid:g3860275)   &ATAC006232_22(AC006232|pid:g4314395) "	DPlate 088	A12			D40166	AU174233			22	B24
9139	g_9139	ST0733		DPlate 086	B12			D39421	AU101922			22	C24
9140	g_9140	ST1986	>NT22KDPOP_1(X95957|pid:g1592812) N.tabacum mRNA for 22kDa   polypeptide; accumulates transiently in plasma membrane   at floral induction. 	DPlate 088	B12			D40192				22	D24
9141	g_9141	ST0765		DPlate 086	C12			D39440	AU078161			22	E24
9142	g_9142	ST1971		DPlate 088	C12			D40183				22	F24
9143	g_9143	ST0789		DPlate 086	D12			D39454	AU032994			22	G24
9144	g_9144	ST1908		DPlate 088	D12			AU174227				22	H24
9145	g_9145	ST0774	">OSU72255_1(U72255|pid:g4097948) Oryza sativa beta-1,3-glucanase   precursor (Gns9) gene, complete cds. "	DPlate 086	E12			D39445	AU032993			22	I24
9146	g_9146	ST1932	">D31700_1(D31700|pid:g1944319) Glycine max mRNA for cysteine   proteinase inhibitor, complete cds; cystatin.   &D64115_1(D64115|pid:g1944342) "	DPlate 088	E12			D40157	AU174231			22	J24
9147	g_9147	ST0782		DPlate 086	F12			D39451	C22663			22	K24
9148	g_9148	ST1964	>JQ1060(JQ1060) glycine-rich protein 1 - Arabidopsis thaliana   (fragment) &S47405_1(S47405|pid:g259443) 	DPlate 088	F12			AU181043				22	L24
9149	g_9149	ST0775	">AB012116_1(AB012116|pid:g4115538) Vigna mungo UFGlyT mRNA for   UDP-glycose:flavonoid glycosyltransferase, partial cds. "	DPlate 086	G12			D39446	AU174153			22	M24
9150	g_9150	ST1980	>I49635(I49635) mouse Dhm1 protein - mouse   &MUSDHM1P_1(D38517|pid:g1060921) 	DPlate 088	G12			D40189	AU174241			22	N24
9151	g_9151	ST0776	>(P31924) SUCROSE SYNTHASE 2 (EC 2.4.1.13) (SUCROSE-UDP   GLUCOSYLTRANSFERASE 2). &ORRSS2_1(X59046|pid:g20095) 	DPlate 086	H12			D39447	AU174154			22	O24
9152	g_9152	ST2125	>(P32698) HYPOTHETICAL 15.7 KD PROTEIN IN APHA-UVRA INTERGENIC   REGION (O138). &AE000479_2(AE000479|pid:g1790491)   &ECOUW89_103(U00006|pid:g396391) &G65213(G65213) 	DPlate 088	H12			AU174247	AU101941			22	P24
9153	g_9153	ST3638		DPlate 090	A06			D41267	AU082454			23	A12
9154	g_9154	ST5434		DPlate 092	A06			AU097507				23	B12
9155	g_9155	ST3654	>GGARBP_1(Y14166|pid:g2388805) Gallus gallus mRNA for attachment   region binding protein (ARBP). 	DPlate 090	B06			D41280	AU108398			23	C12
9156	g_9156	ST5442	">RICRCC2_1(L27209|pid:g786130) Oryza sativa root-specific RCc2 mRNA,   complete cds. &RICRCG2_1(L27210|pid:g786134)   &S53011(S53011) "	DPlate 092	B06			C25152	AU161776			23	D12
9157	g_9157	ST3670	>NTA18209_1(Y18209|pid:g4160292) Nicotiana tabacum mRNA for   alpha-N-acetylglucosaminidase; putative. 	DPlate 090	C06			D41288	AU108403			23	E12
9158	g_9158	ST5450	">ATAC004484_3(AC004484|pid:g3075386) Arabidopsis thaliana chromosome   II BAC T1D16 genomic sequence, complete sequence;   &ATHER_1(D83257|pid:g1389566)   &ATU47029_1(U47029|pid:g1345132) "	DPlate 092	C06			C22691	C22692			23	F12
9159	g_9159	ST3686	">AF073926_1(AF073926|pid:g4234774) Homo sapiens cis-Golgi SNARE p28   (GS28) mRNA, complete cds; Golgi membrane protein. "	DPlate 090	D06			D41297	AU101980			23	G12
9160	g_9160	ST5458		DPlate 092	D06			AU066179	AU161780			23	H12
9161	g_9161	ST3623	">CEY48E1C_3(Z93394|pid:g3925265) Caenorhabditis elegans cosmid   Y48E1C, complete sequence; similar to Probable rabGAP   domains. "	DPlate 090	E06			D41255	AU101977			23	I12
9162	g_9162	ST5482		DPlate 092	E06			AU058134				23	J12
9163	g_9163	ST3695		DPlate 090	F06			AU108412				23	K12
9164	g_9164	ST5490		DPlate 092	F06			AU161793				23	L12
9165	g_9165	ST3624		DPlate 090	G06			AU174294	AU033123			23	M12
9166	g_9166	ST5443		DPlate 092	G06			AU066177				23	N12
9167	g_9167	ST3632	">BFU64312_2(U64312|pid:g1813489) Bacillus firmus phosphotransferase   enzyme II (FruA) gene, partial cds, and amidase gene,   complete cds; "	DPlate 090	H06			D41262	AU174296			23	O12
9168	g_9168	ST5459		DPlate 092	H06			AU181053				23	P12
9169	g_9169	ST3979		DPlate 090	A12			D41465	AU108456			23	A24
9170	g_9170	ST5820	>(P46279) DNA-DIRECTED RNA POLYMERASE II 19 KD POLYPEPTIDE (EC   2.7.7.6) (RNA POLYMERASE II SUBUNIT 5). &B44457(B44457)   &SOYRNAPOLA_1(M90504|pid:g170052) 	DPlate 092	A12			AU066236	AU174372			23	B24
9171	g_9171	ST3916	">SPAC2H10_2(AL034486|pid:g4007776) S.pombe chromosome I cosmid   c2H10; SPAC2H10.02c, len:213, SIMILARITY:Caenorhabditis   elegans., PSD9_CAEEL, probable 26s proteasome regulatory   subunit p27., (264 aa), fasta scores: opt: 186,   E():3.5e-19, (30.0% identity in 213 aa). "	DPlate 090	B12			D41423	AU108440			23	C24
9172	g_9172	ST5836		DPlate 092	B12			C25296	AU174373			23	D24
9173	g_9173	ST3932		DPlate 090	C12			AU174304				23	E24
9174	g_9174	ST5860		DPlate 092	C12			C25302	AU174374			23	F24
9175	g_9175	ST3940	>OSENOYLAC_1(AJ003025|pid:g2653285) Oryza sativa mRNA for enoyl-ACP   reductase. 	DPlate 090	D12			D41437	AU174306			23	G24
9176	g_9176	ST5853	">ATAC003028_2(AC003028|pid:g3335378) Arabidopsis thaliana chromosome   II BAC F16M14 genomic sequence, complete sequence. "	DPlate 092	D12			C25300				23	H24
9177	g_9177	ST3948		DPlate 090	E12			AU174308				23	I24
9178	g_9178	ST5869		DPlate 092	E12			AU033251				23	J24
9179	g_9179	ST4065	">JQ2252(JQ2252) peroxidase (EC 1.11.1.7), cationic - adzuki bean   &VIRPRX_1(D11337|pid:g218328) "	DPlate 090	F12			AU163227				23	K24
9180	g_9180	ST5877		DPlate 092	F12			AU161830	AU176551			23	L24
9181	g_9181	ST4026		DPlate 090	G12			D41495	AU033140			23	M24
9182	g_9182	ST5885		DPlate 092	G12			C25310	AU174376			23	N24
9183	g_9183	ST4042	">ATAC002392_17(AC002392|pid:g3176725) Arabidopsis thaliana   chromosome II BAC T20K24 genomic sequence, complete   sequence; unknown protein. "	DPlate 090	H12			D41505	AU161664			23	O24
9184	g_9184	ST5830		DPlate 092	H12			AU161822				23	P24
9185	g_9185	ST6575	">AF064456_1(AF064456|pid:g3171148) Oryza sativa subsp. indica   calmodulin-like protein gene, complete cds; CAM-like.   &OSU37936_1(U37936|pid:g1235664) "	DPlate 094	A06			AU033314	AU081386			24	A12
9186	g_9186	Water										24	B12
9187	g_9187	ST6583		DPlate 094	B06			AU102073	AU102074			24	C12
9188	g_9188	Water										24	D12
9189	g_9189	ST6504		DPlate 094	C06			AU070642				24	E12
9190	g_9190	Water										24	F12
9191	g_9191	ST6520		DPlate 094	D06			AU033306				24	G12
9192	g_9192	Water										24	H12
9193	g_9193	ST6552	">AF088281_1(AF088281|pid:g4093155) Arabidopsis thaliana   phytochrome-associated protein 1 (PAP1) mRNA, complete   cds; IAA/AXR family member. "	DPlate 094	E06			C25485	AU174421			24	I12
9194	g_9194	Water										24	J12
9195	g_9195	ST6560	">A48018(A48018;S29115;S29116;S29114)mucin 7 precursor, salivary -   human "	DPlate 094	F06			AU082285	AU174423			24	K12
9196	g_9196	Water										24	L12
9197	g_9197	ST6584		DPlate 094	G06			AU175176	AU176556			24	M12
9198	g_9198	Water										24	N12
9199	g_9199	ST6537		DPlate 094	H06			AU066339	AU097560			24	O12
9200	g_9200	Water										24	P12
9201	g_9201	D94Water+D		DPlate 094	A12							24	A24
9202	g_9202	no clone										24	B24
9203	g_9203	D94Water+D		DPlate 094	B12							24	C24
9204	g_9204	no clone										24	D24
9205	g_9205	D94Water+D		DPlate 094	C12							24	E24
9206	g_9206	no clone										24	F24
9207	g_9207	D94Water+D		DPlate 094	D12							24	G24
9208	g_9208	no clone										24	H24
9209	g_9209	D94Water+D		DPlate 094	E12							24	I24
9210	g_9210	no clone										24	J24
9211	g_9211	D94Water+D		DPlate 094	F12							24	K24
9212	g_9212	no clone										24	L24
9213	g_9213	D94Water+D		DPlate 094	G12							24	M24
9214	g_9214	no clone										24	N24
9215	g_9215 	Posi33										24	O24
9216	g_9216	Posi34										24	P24
