ERX1270342	ERA549954	Illumina_HiSeq_2000_sequencing;_ChIPSeq_profiling_of_LIR3_binding_sites_in_C.elegans	Illumina_HiSeq_2000_sequencing;_ChIPSeq_profili...	ERS1026566	ERS1026566	ERS1026566	ERS1026566	ChIP-Seq
ERX1270343	ERA549954	Illumina_HiSeq_2000_sequencing;_ChIPSeq_profiling_of_LIR3_binding_sites_in_C.elegans	Illumina_HiSeq_2000_sequencing;_ChIPSeq_profili...	ERS1026567	ERS1026567	ERS1026567	ERS1026567	ChIP-Seq
ERX1270344	ERA549954	Illumina_HiSeq_2000_sequencing;_ChIPSeq_profiling_of_LIR3_binding_sites_in_C.elegans	Illumina_HiSeq_2000_sequencing;_ChIPSeq_profili...	ERS1026568	ERS1026568	ERS1026568	ERS1026568	ChIP-Seq
ERX1485062	ERA624518	Illumina_HiSeq_2000_paired_end_sequencing;_ChIP-Seq_of_LET-418::3xFLAG_in_mixed_stage_early_C.elegans_embryos	Illumina_HiSeq_2000_paired_end_sequencing;_ChIP...	ERS1162600	ERS1162600	ERS1162600|mixed stage, early embryos	ERS1162600	ChIP-Seq
ERX1485063	ERA624518	Illumina_HiSeq_2000_paired_end_sequencing;_ChIP-Seq_of_LET-418::3xFLAG_in_mixed_stage_early_C.elegans_embryos	Illumina_HiSeq_2000_paired_end_sequencing;_ChIP...	ERS1162601	ERS1162601	ERS1162601|mixed stage, early embryos	ERS1162601	ChIP-Seq
ERX1485064	ERA624518	Illumina_HiSeq_2000_paired_end_sequencing;_ChIP-Seq_of_LET-418::3xFLAG_in_mixed_stage_early_C.elegans_embryos	Illumina_HiSeq_2000_paired_end_sequencing;_ChIP...	Input_DNA|ERS1162602	Input_DNA	Input_DNA|ERS1162602|mixed stage, early embryos	Input_DNA	ChIP-Seq
ERX1999196	ERA886710	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3_ChIP-seq_of_young_adult_C._elegans_wildtype,_and_mutants_emb-4_(qm31)_and_hrde-1_(tm1200)	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3...	SX1316-ChIP-1|ERS1671236	SX1316-ChIP-1	SX1316-ChIP-1|ERS1671236	SX1316-ChIP-1	ChIP-Seq
ERX1999197	ERA886710	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3_ChIP-seq_of_young_adult_C._elegans_wildtype,_and_mutants_emb-4_(qm31)_and_hrde-1_(tm1200)	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3...	SX1316-ChIP-2|ERS1671237	SX1316-ChIP-2	SX1316-ChIP-2|ERS1671237	SX1316-ChIP-2	ChIP-Seq
ERX1999198	ERA886710	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3_ChIP-seq_of_young_adult_C._elegans_wildtype,_and_mutants_emb-4_(qm31)_and_hrde-1_(tm1200)	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3...	SX1316-ChIP-3|ERS1671238	SX1316-ChIP-3	SX1316-ChIP-3|ERS1671238	SX1316-ChIP-3	ChIP-Seq
ERX1999199	ERA886710	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3_ChIP-seq_of_young_adult_C._elegans_wildtype,_and_mutants_emb-4_(qm31)_and_hrde-1_(tm1200)	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3...	ERS1671239	ERS1671239	ERS1671239	ERS1671239	ChIP-Seq
ERX1999200	ERA886710	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3_ChIP-seq_of_young_adult_C._elegans_wildtype,_and_mutants_emb-4_(qm31)_and_hrde-1_(tm1200)	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3...	ERS1671240	ERS1671240	ERS1671240	ERS1671240	ChIP-Seq
ERX1999201	ERA886710	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3_ChIP-seq_of_young_adult_C._elegans_wildtype,_and_mutants_emb-4_(qm31)_and_hrde-1_(tm1200)	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3...	ERS1671241	ERS1671241	ERS1671241	ERS1671241	ChIP-Seq
ERX1999202	ERA886710	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3_ChIP-seq_of_young_adult_C._elegans_wildtype,_and_mutants_emb-4_(qm31)_and_hrde-1_(tm1200)	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3...	ERS1671242	ERS1671242	ERS1671242	ERS1671242	ChIP-Seq
ERX1999203	ERA886710	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3_ChIP-seq_of_young_adult_C._elegans_wildtype,_and_mutants_emb-4_(qm31)_and_hrde-1_(tm1200)	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3...	ERS1671243	ERS1671243	ERS1671243	ERS1671243	ChIP-Seq
ERX1999204	ERA886710	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3_ChIP-seq_of_young_adult_C._elegans_wildtype,_and_mutants_emb-4_(qm31)_and_hrde-1_(tm1200)	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3...	ERS1671244	ERS1671244	ERS1671244	ERS1671244	ChIP-Seq
ERX1999205	ERA886710	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3_ChIP-seq_of_young_adult_C._elegans_wildtype,_and_mutants_emb-4_(qm31)_and_hrde-1_(tm1200)	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3...	ERS1671245	ERS1671245	ERS1671245	ERS1671245	ChIP-Seq
ERX1999206	ERA886710	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3_ChIP-seq_of_young_adult_C._elegans_wildtype,_and_mutants_emb-4_(qm31)_and_hrde-1_(tm1200)	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3...	ERS1671246	ERS1671246	ERS1671246	ERS1671246	ChIP-Seq
ERX1999207	ERA886710	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3_ChIP-seq_of_young_adult_C._elegans_wildtype,_and_mutants_emb-4_(qm31)_and_hrde-1_(tm1200)	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3...	SX2000-input-2|ERS1671247	SX2000-input-2	SX2000-input-2|ERS1671247	SX2000-input-2	ChIP-Seq
ERX1999208	ERA886710	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3_ChIP-seq_of_young_adult_C._elegans_wildtype,_and_mutants_emb-4_(qm31)_and_hrde-1_(tm1200)	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3...	SX2000-input-3|ERS1671248	SX2000-input-3	SX2000-input-3|ERS1671248	SX2000-input-3	ChIP-Seq
ERX1999209	ERA886710	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3_ChIP-seq_of_young_adult_C._elegans_wildtype,_and_mutants_emb-4_(qm31)_and_hrde-1_(tm1200)	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3...	SX2000-input-4|ERS1671249	SX2000-input-4	SX2000-input-4|ERS1671249	SX2000-input-4	ChIP-Seq
ERX1999210	ERA886710	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3_ChIP-seq_of_young_adult_C._elegans_wildtype,_and_mutants_emb-4_(qm31)_and_hrde-1_(tm1200)	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3...	ERS1671250	ERS1671250	ERS1671250	ERS1671250	ChIP-Seq
ERX1999211	ERA886710	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3_ChIP-seq_of_young_adult_C._elegans_wildtype,_and_mutants_emb-4_(qm31)_and_hrde-1_(tm1200)	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3...	ERS1671251	ERS1671251	ERS1671251	ERS1671251	ChIP-Seq
ERX1999212	ERA886710	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3_ChIP-seq_of_young_adult_C._elegans_wildtype,_and_mutants_emb-4_(qm31)_and_hrde-1_(tm1200)	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3...	ERS1671252	ERS1671252	ERS1671252	ERS1671252	ChIP-Seq
ERX1999213	ERA886710	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3_ChIP-seq_of_young_adult_C._elegans_wildtype,_and_mutants_emb-4_(qm31)_and_hrde-1_(tm1200)	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3...	ERS1671253	ERS1671253	ERS1671253	ERS1671253	ChIP-Seq
ERX1999214	ERA886710	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3_ChIP-seq_of_young_adult_C._elegans_wildtype,_and_mutants_emb-4_(qm31)_and_hrde-1_(tm1200)	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3...	ERS1671254	ERS1671254	ERS1671254	ERS1671254	ChIP-Seq
ERX1999215	ERA886710	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3_ChIP-seq_of_young_adult_C._elegans_wildtype,_and_mutants_emb-4_(qm31)_and_hrde-1_(tm1200)	Illumina_HiSeq_2500_sequencing;_Histone_H3K9me3...	ERS1671255	ERS1671255	ERS1671255	ERS1671255	ChIP-Seq
SRX002673	SRA008173	ND	ND	GFP	GFP	OP37|embyro	OP37	ChIP-Seq
SRX002674	SRA008173	ND	ND	none|pha-4 transgenic worm OP37	none	OP37|pha-4 transgenic worm OP37|emrbyo	OP37	ChIP-Seq
SRX002675	SRA008173	ND	ND	GFP	GFP	OP37|L1	OP37	ChIP-Seq
SRX002676	SRA008173	ND	ND	none|pha-4 transgenic worm OP37	none	OP37|pha-4 transgenic worm OP37|L1	OP37	ChIP-Seq
SRX003816	SRA008378	ND	ND	S2 (ab5095)	S2 (ab5095)	wild-type N2	wild-type N2	ChIP-Seq
SRX003817	SRA008378	ND	ND	S2 (ab5095)	S2 (ab5095)	wild-type N2	wild-type N2	ChIP-Seq
SRX003818	SRA008378	ND	ND	S2 (ab5095)	S2 (ab5095)	wild-type N2	wild-type N2	ChIP-Seq
SRX003819	SRA008378	ND	ND	4H8 (ab5046)	4H8 (ab5046)	wild-type N2	wild-type N2	ChIP-Seq
SRX003820	SRA008378	ND	ND	4H8 (ab5046)	4H8 (ab5046)	wild-type N2	wild-type N2	ChIP-Seq
SRX003821	SRA008378	ND	ND	8WG16 (ab817)	8WG16 (ab817)	wild-type N2	wild-type N2	ChIP-Seq
SRX003822	SRA008378	ND	ND	S2 (ab5095)	S2 (ab5095)	wild-type N2	wild-type N2	ChIP-Seq
SRX003823	SRA008378	ND	ND	4H8 (ab5046)	4H8 (ab5046)	wild-type N2	wild-type N2	ChIP-Seq
SRX003824	SRA008378	ND	ND	4H8 (ab5046)	4H8 (ab5046)	wild-type N2	wild-type N2	ChIP-Seq
SRX003825	SRA008378	ND	ND	8WG16 (ab817)	8WG16 (ab817)	wild-type N2	wild-type N2	ChIP-Seq
SRX003826	SRA008378	ND	ND	Input	Input	wild-type N2	wild-type N2	ChIP-Seq
SRX003827	SRA008378	ND	ND	Input	Input	wild-type N2	wild-type N2	ChIP-Seq
SRX003828	SRA008378	ND	ND	Input	Input	wild-type N2	wild-type N2	ChIP-Seq
SRX003829	SRA008378	ND	ND	Input	Input	wild-type N2	wild-type N2	ChIP-Seq
SRX003830	SRA008379	ND	ND	anti-GFP	anti-GFP	OP32|embryo	OP32	ChIP-Seq
SRX003831	SRA008379	ND	ND	none, input DNA	none, input DNA	OP32|embryo	OP32	ChIP-Seq
SRX003832	SRA008379	ND	ND	anti-GFP	anti-GFP	OP32|embryo	OP32	ChIP-Seq
SRX003833	SRA008379	ND	ND	none, input DNA	none, input DNA	OP32|embryo	OP32	ChIP-Seq
SRX005625	SRA008408	ND	ND	anti-GFP to AMA-1	anti-GFP to AMA-1	OP34|L4/young adult	OP34	ChIP-Seq
SRX005626	SRA008408	ND	ND	POL II	POL II	OP34|L4/young adult	OP34	ChIP-Seq
SRX005627	SRA008408	ND	ND	none, input DNA	none, input DNA	OP34|L4/young adult	OP34	ChIP-Seq
SRX005628	SRA008408	ND	ND	anti-GFP to AMA-1	anti-GFP to AMA-1	OP34|L4/young adult	OP34	ChIP-Seq
SRX005629	SRA008408	ND	ND	POL II	POL II	OP34|L4/young adult	OP34	ChIP-Seq
SRX005630	SRA008408	ND	ND	none, input DNA	none, input DNA	OP34|L4/young adult	OP34	ChIP-Seq
SRX005631	SRA008407	ND	ND	anti-GFP to DAF-16	anti-GFP to DAF-16	TJ356|L4/Young adult	TJ356	ChIP-Seq
SRX005632	SRA008407	ND	ND	POL II	POL II	TJ356|L4/Young adult	TJ356	ChIP-Seq
SRX005633	SRA008407	ND	ND	none, input DNA	none, input DNA	TJ356|L4/Young adult	TJ356	ChIP-Seq
SRX005634	SRA008407	ND	ND	anti-GFP to DAF-16	anti-GFP to DAF-16	TJ356|L4/Young adult	TJ356	ChIP-Seq
SRX005635	SRA008407	ND	ND	POL II	POL II	TJ356|L4/Young adult	TJ356	ChIP-Seq
SRX005636	SRA008407	ND	ND	none, input DNA	none, input DNA	TJ356|L4/Young adult	TJ356	ChIP-Seq
SRX005637	SRA008406	ND	ND	anti-GFP to MAB-5	anti-GFP to MAB-5	OP26|L3	OP26	ChIP-Seq
SRX005638	SRA008406	ND	ND	none, input DNA	none, input DNA	OP26|L3	OP26	ChIP-Seq
SRX005639	SRA008406	ND	ND	anti-GFP to MAB-5	anti-GFP to MAB-5	OP26|L3	OP26	ChIP-Seq
SRX005640	SRA008406	ND	ND	none, input DNA	none, input DNA	OP26|L3	OP26	ChIP-Seq
SRX005648	SRA008405	ND	ND	POL II	POL II	OP37|embryo	OP37	ChIP-Seq
SRX005649	SRA008405	ND	ND	POL II	POL II	OP37|embryo	OP37	ChIP-Seq
SRX005650	SRA008405	ND	ND	POL II	POL II	OP37|starved L1	OP37	ChIP-Seq
SRX005651	SRA008405	ND	ND	POL II	POL II	OP37|starved L1	OP37	ChIP-Seq
SRX012296	SRA009975	Total_Nucleosome_N2_seq	Total_Nucleosome_N2_seq	IP input|synchronized young adult population of wild type strain N2	IP input	N2|synchronized young adult population of wild type strain N2|young adult	N2	ChIP-Seq
SRX012297	SRA009975	H3K4me2/3_N2_chipSeq	H3K4me2/3_N2_chipSeq	anti-H3K4me2/3|synchronized young adult population of wild type strain N2	anti-H3K4me2/3	N2|synchronized young adult population of wild type strain N2|young adult	N2	ChIP-Seq
SRX012298	SRA009975	H3K9me3_N2_chipSeq	H3K9me3_N2_chipSeq	anti-H3K9me3|synchronized young adult population of wild type strain N2	anti-H3K9me3	N2|synchronized young adult population of wild type strain N2|young adult	N2	ChIP-Seq
SRX012299	SRA009975	Total_Nucleosome_zim2_seq	Total_Nucleosome_zim2_seq	IP input|synchronized young adult population of mutant strain zim-2(tm574)	IP input	zim-2(tm574)|synchronized young adult population of mutant strain zim-2(tm574)|young adult	zim-2(tm574)	ChIP-Seq
SRX012300	SRA009975	H3K9me3_zim2_chipSeq	H3K9me3_zim2_chipSeq	anti-H3K9me3|synchronized young adult population of mutant strain zim-2(tm574)	anti-H3K9me3	zim-2(tm574)|synchronized young adult population of mutant strain zim-2(tm574)|young adult	zim-2(tm574)	ChIP-Seq
SRX013986	SRA010185	Pha-4_emb_input	Pha-4_emb_input	none|pha-4 transgenic worm OP37	none	OP37|pha-4 transgenic worm OP37|emrbyo	OP37	ChIP-Seq
SRX013987	SRA010185	Pha-4_starved_L1_input	Pha-4_starved_L1_input	none|pha-4 transgenic worm OP37	none	OP37|pha-4 transgenic worm OP37|L1	OP37	ChIP-Seq
SRX015093	SRA010335	CEH-14_L2_replicate_1_GFP	CEH-14_L2_replicate_1_GFP	anti-GFP|OP73, CEH-14:GFP:3xFLAG animals	anti-GFP	OP73|OP73, CEH-14:GFP:3xFLAG animals|L2	OP73	ChIP-Seq
SRX015094	SRA010335	CEH-14_L2_replicate_2_GFP	CEH-14_L2_replicate_2_GFP	anti-GFP|OP73, CEH-14:GFP:3xFLAG animals	anti-GFP	OP73|OP73, CEH-14:GFP:3xFLAG animals|L2	OP73	ChIP-Seq
SRX015095	SRA010335	CEH-14_L2_replicate_2_Input	CEH-14_L2_replicate_2_Input	none|OP73, CEH-14:GFP:3xFLAG animals	none	OP73|OP73, CEH-14:GFP:3xFLAG animals|L2	OP73	ChIP-Seq
SRX015096	SRA010336	EOR-1_L3_replicate_1_GFP	EOR-1_L3_replicate_1_GFP	anti-GFP|OP81, EOR-1:GFP:3xFLAG animals	anti-GFP	OP81|OP81, EOR-1:GFP:3xFLAG animals|L3	OP81	ChIP-Seq
SRX015097	SRA010336	EOR-1_L3_replicate_1_Input	EOR-1_L3_replicate_1_Input	none|OP81, EOR-1:GFP:3xFLAG animals	none	OP81|OP81, EOR-1:GFP:3xFLAG animals|L3	OP81	ChIP-Seq
SRX015098	SRA010336	EOR-1_L3_replicate_2_GFP	EOR-1_L3_replicate_2_GFP	anti-GFP|OP81, EOR-1:GFP:3xFLAG animals	anti-GFP	OP81|OP81, EOR-1:GFP:3xFLAG animals|L3	OP81	ChIP-Seq
SRX015099	SRA010336	EOR-1_L3_replicate_2_Input	EOR-1_L3_replicate_2_Input	none|OP81, EOR-1:GFP:3xFLAG animals	none	OP81|OP81, EOR-1:GFP:3xFLAG animals|L3	OP81	ChIP-Seq
SRX015100	SRA010337	HLH-8_L3_replicate_1_GFP	HLH-8_L3_replicate_1_GFP	anti-GFP|OP74, HLH-8:GFP:3xFLAG animals	anti-GFP	OP74|OP74, HLH-8:GFP:3xFLAG animals|L3	OP74	ChIP-Seq
SRX015101	SRA010337	HLH-8_L3_replicate_1_Input	HLH-8_L3_replicate_1_Input	none|OP74, HLH-8:GFP:3xFLAG animals	none	OP74|OP74, HLH-8:GFP:3xFLAG animals|L3	OP74	ChIP-Seq
SRX015102	SRA010337	HLH-8_L3_replicate_2_GFP	HLH-8_L3_replicate_2_GFP	anti-GFP|OP74, HLH-8:GFP:3xFLAG animals	anti-GFP	OP74|OP74, HLH-8:GFP:3xFLAG animals|L3	OP74	ChIP-Seq
SRX015103	SRA010337	HLH-8_L3_replicate_2_Input	HLH-8_L3_replicate_2_Input	none|OP74, HLH-8:GFP:3xFLAG animals	none	OP74|OP74, HLH-8:GFP:3xFLAG animals|L3	OP74	ChIP-Seq
SRX027097	SRA024249	seq-AB46540_NIgG_N2_MXemb_2_A_EE1432	seq-AB46540_NIgG_N2_MXemb_2_A_EE1432	NIgG|Caenorhabditis elegans_N2_MXemb	NIgG	N2|Caenorhabditis elegans_N2_MXemb|MXemb	N2	ChIP-Seq
SRX027098	SRA024249	seq-SDQ3891_LEM2_N2_MXemb_1_A_EE8_KI021	seq-SDQ3891_LEM2_N2_MXemb_1_A_EE8_KI021	LEM2|Caenorhabditis elegans_N2_MXemb	LEM2	N2|Caenorhabditis elegans_N2_MXemb|MXemb	N2	ChIP-Seq
SRX027210	SRA024332	seq-WA30534819_H3K4me3_N2_MXemb_1	seq-WA30534819_H3K4me3_N2_MXemb_1	WA30534819_H3K4me3|Caenorhabditis elegans_N2_MXemb	WA30534819_H3K4me3	N2|Caenorhabditis elegans_N2_MXemb|MXemb	N2	ChIP-Seq
SRX027211	SRA024332	seq-WA30534819_H3K4me3_N2_MXemb_2	seq-WA30534819_H3K4me3_N2_MXemb_2	WA30534819_H3K4me3|Caenorhabditis elegans_N2_MXemb	WA30534819_H3K4me3	N2|Caenorhabditis elegans_N2_MXemb|MXemb	N2	ChIP-Seq
SRX043843	SRA030352	Snyder_MAB5_POLII_L3_rep1_extraction1_seq1_aliquote_1	Snyder_MAB5_POLII_L3_rep1_extraction1_seq1_aliq...	Snyder_MAB5_POLII_L3_rep1 extraction1_seq1 channel_1	Snyder_MAB5_POLII_L3_r...	OP26(made_by : R. Waterston and S. Kim description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The MAB-5::EGFP fusion protein is expressed in the correct mab-5 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the MAB-5 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119(ed3) III; wgIs26 unc-119(+) mab-5::TY1::EGFP::3xFLAG official name : OP26 )|Snyder_MAB5_POLII_L3_rep1 extraction1_seq1 channel_1|L3	OP26(made_by : R. Wate...	ChIP-Seq
SRX043844	SRA030352	Snyder_MAB5_POLII_L3_rep1_extraction1_seq1_aliquote_2	Snyder_MAB5_POLII_L3_rep1_extraction1_seq1_aliq...	Snyder_MAB5_POLII_L3_rep1 extraction1_seq1 channel_2	Snyder_MAB5_POLII_L3_r...	OP26(made_by : R. Waterston and S. Kim description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The MAB-5::EGFP fusion protein is expressed in the correct mab-5 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the MAB-5 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119(ed3) III; wgIs26 unc-119(+) mab-5::TY1::EGFP::3xFLAG official name : OP26 )|Snyder_MAB5_POLII_L3_rep1 extraction1_seq1 channel_2|L3	OP26(made_by : R. Wate...	ChIP-Seq
SRX043845	SRA030352	Snyder_MAB5_POLII_L3_rep2_extraction2_seq1_aliquote_1	Snyder_MAB5_POLII_L3_rep2_extraction2_seq1_aliq...	Snyder_MAB5_POLII_L3_rep2 extraction2_seq1 channel_1	Snyder_MAB5_POLII_L3_r...	OP26(made_by : R. Waterston and S. Kim description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The MAB-5::EGFP fusion protein is expressed in the correct mab-5 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the MAB-5 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119(ed3) III; wgIs26 unc-119(+) mab-5::TY1::EGFP::3xFLAG official name : OP26 )|Snyder_MAB5_POLII_L3_rep2 extraction2_seq1 channel_1|L3	OP26(made_by : R. Wate...	ChIP-Seq
SRX043846	SRA030352	Snyder_MAB5_POLII_L3_rep2_extraction2_seq1_aliquote_2	Snyder_MAB5_POLII_L3_rep2_extraction2_seq1_aliq...	Snyder_MAB5_POLII_L3_rep2 extraction2_seq1 channel_2	Snyder_MAB5_POLII_L3_r...	OP26(made_by : R. Waterston and S. Kim description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The MAB-5::EGFP fusion protein is expressed in the correct mab-5 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the MAB-5 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119(ed3) III; wgIs26 unc-119(+) mab-5::TY1::EGFP::3xFLAG official name : OP26 )|Snyder_MAB5_POLII_L3_rep2 extraction2_seq1 channel_2|L3	OP26(made_by : R. Wate...	ChIP-Seq
SRX043847	SRA030353	Snyder_LIN-11_GFP_L2_rep1_extraction1_seq1_aliquote_1	Snyder_LIN-11_GFP_L2_rep1_extraction1_seq1_aliq...	Snyder_LIN-11_GFP_L2_rep1 extraction1_seq1 channel_1	Snyder_LIN-11_GFP_L2_r...	OP62(made_by : R Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-11::EGFP fusion protein is expressed in the correct lin-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-11 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119(ed3) III; wgIs62 unc-119(+) lin-11::TY1::EGFP::3xFLAG official name : OP62 )|Snyder_LIN-11_GFP_L2_rep1 extraction1_seq1 channel_1|L2	OP62(made_by : R Water...	ChIP-Seq
SRX043848	SRA030353	Snyder_LIN-11_GFP_L2_rep1_extraction1_seq1_aliquote_2	Snyder_LIN-11_GFP_L2_rep1_extraction1_seq1_aliq...	Snyder_LIN-11_GFP_L2_rep1 extraction1_seq1 channel_2	Snyder_LIN-11_GFP_L2_r...	OP62(made_by : R Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-11::EGFP fusion protein is expressed in the correct lin-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-11 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119(ed3) III; wgIs62 unc-119(+) lin-11::TY1::EGFP::3xFLAG official name : OP62 )|Snyder_LIN-11_GFP_L2_rep1 extraction1_seq1 channel_2|L2	OP62(made_by : R Water...	ChIP-Seq
SRX043849	SRA030353	Snyder_LIN-11_GFP_L2_rep2_extraction2_seq1_aliquote_1	Snyder_LIN-11_GFP_L2_rep2_extraction2_seq1_aliq...	Snyder_LIN-11_GFP_L2_rep2 extraction2_seq1 channel_1	Snyder_LIN-11_GFP_L2_r...	OP62(made_by : R Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-11::EGFP fusion protein is expressed in the correct lin-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-11 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119(ed3) III; wgIs62 unc-119(+) lin-11::TY1::EGFP::3xFLAG official name : OP62 )|Snyder_LIN-11_GFP_L2_rep2 extraction2_seq1 channel_1|L2	OP62(made_by : R Water...	ChIP-Seq
SRX043850	SRA030353	Snyder_LIN-11_GFP_L2_rep2_extraction2_seq1_aliquote_2	Snyder_LIN-11_GFP_L2_rep2_extraction2_seq1_aliq...	Snyder_LIN-11_GFP_L2_rep2 extraction2_seq1 channel_2	Snyder_LIN-11_GFP_L2_r...	OP62(made_by : R Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-11::EGFP fusion protein is expressed in the correct lin-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-11 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119(ed3) III; wgIs62 unc-119(+) lin-11::TY1::EGFP::3xFLAG official name : OP62 )|Snyder_LIN-11_GFP_L2_rep2 extraction2_seq1 channel_2|L2	OP62(made_by : R Water...	ChIP-Seq
SRX043851	SRA030354	Snyder_UNC-130_GFP_L1_rep1_extraction1_seq1_aliquote_1	Snyder_UNC-130_GFP_L1_rep1_extraction1_seq1_ali...	Snyder_UNC-130_GFP_L1_rep1 extraction1_seq1 channel_1	Snyder_UNC-130_GFP_L1_...	OP77(made_by : R. Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-130::EGFP fusion protein is expressed in the correct unc-130 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-130 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119(ed3) III; wgIs77 unc-119(+) unc-130::TY1::EGFP::3xFLAG official name : OP77 )|Snyder_UNC-130_GFP_L1_rep1 extraction1_seq1 channel_1|fed L1	OP77(made_by : R. Wate...	ChIP-Seq
SRX043852	SRA030354	Snyder_UNC-130_GFP_L1_rep1_extraction1_seq1_aliquote_2	Snyder_UNC-130_GFP_L1_rep1_extraction1_seq1_ali...	Snyder_UNC-130_GFP_L1_rep1 extraction1_seq1 channel_2	Snyder_UNC-130_GFP_L1_...	OP77(made_by : R. Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-130::EGFP fusion protein is expressed in the correct unc-130 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-130 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119(ed3) III; wgIs77 unc-119(+) unc-130::TY1::EGFP::3xFLAG official name : OP77 )|Snyder_UNC-130_GFP_L1_rep1 extraction1_seq1 channel_2|fed L1	OP77(made_by : R. Wate...	ChIP-Seq
SRX043853	SRA030354	Snyder_UNC-130_GFP_L1_rep2_extraction2_seq1_aliquote_1	Snyder_UNC-130_GFP_L1_rep2_extraction2_seq1_ali...	Snyder_UNC-130_GFP_L1_rep2 extraction2_seq1 channel_1	Snyder_UNC-130_GFP_L1_...	OP77(made_by : R. Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-130::EGFP fusion protein is expressed in the correct unc-130 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-130 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119(ed3) III; wgIs77 unc-119(+) unc-130::TY1::EGFP::3xFLAG official name : OP77 )|Snyder_UNC-130_GFP_L1_rep2 extraction2_seq1 channel_1|fed L1	OP77(made_by : R. Wate...	ChIP-Seq
SRX043854	SRA030354	Snyder_UNC-130_GFP_L1_rep2_extraction2_seq1_aliquote_2	Snyder_UNC-130_GFP_L1_rep2_extraction2_seq1_ali...	Snyder_UNC-130_GFP_L1_rep2 extraction2_seq1 channel_2	Snyder_UNC-130_GFP_L1_...	OP77(made_by : R. Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-130::EGFP fusion protein is expressed in the correct unc-130 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-130 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119(ed3) III; wgIs77 unc-119(+) unc-130::TY1::EGFP::3xFLAG official name : OP77 )|Snyder_UNC-130_GFP_L1_rep2 extraction2_seq1 channel_2|fed L1	OP77(made_by : R. Wate...	ChIP-Seq
SRX043855	SRA030355	Snyder_HLH-1_GFP_emb_rep1_extraction1_seq1_aliquote_1	Snyder_HLH-1_GFP_emb_rep1_extraction1_seq1_aliq...	Snyder_HLH-1_GFP_emb_rep1 extraction1_seq1 channel_1	Snyder_HLH-1_GFP_emb_r...	OP64(made_by : R. Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The HLH-1::EGFP fusion protein is expressed in the correct hlh-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the HLH-1 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119(ed3) III; wgIs64 unc-119(+) hlh-1::TY1::EGFP::3xFLAG official name : OP64 )|Snyder_HLH-1_GFP_emb_rep1 extraction1_seq1 channel_1|embryo	OP64(made_by : R. Wate...	ChIP-Seq
SRX043856	SRA030355	Snyder_HLH-1_GFP_emb_rep1_extraction1_seq1_aliquote_2	Snyder_HLH-1_GFP_emb_rep1_extraction1_seq1_aliq...	Snyder_HLH-1_GFP_emb_rep1 extraction1_seq1 channel_2	Snyder_HLH-1_GFP_emb_r...	OP64(made_by : R. Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The HLH-1::EGFP fusion protein is expressed in the correct hlh-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the HLH-1 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119(ed3) III; wgIs64 unc-119(+) hlh-1::TY1::EGFP::3xFLAG official name : OP64 )|Snyder_HLH-1_GFP_emb_rep1 extraction1_seq1 channel_2|embryo	OP64(made_by : R. Wate...	ChIP-Seq
SRX043857	SRA030355	Snyder_HLH-1_GFP_emb_rep2_extraction2_seq1_aliquote_1	Snyder_HLH-1_GFP_emb_rep2_extraction2_seq1_aliq...	Snyder_HLH-1_GFP_emb_rep2 extraction2_seq1 channel_1	Snyder_HLH-1_GFP_emb_r...	OP64(made_by : R. Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The HLH-1::EGFP fusion protein is expressed in the correct hlh-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the HLH-1 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119(ed3) III; wgIs64 unc-119(+) hlh-1::TY1::EGFP::3xFLAG official name : OP64 )|Snyder_HLH-1_GFP_emb_rep2 extraction2_seq1 channel_1|embryo	OP64(made_by : R. Wate...	ChIP-Seq
SRX043858	SRA030355	Snyder_HLH-1_GFP_emb_rep2_extraction2_seq1_aliquote_2	Snyder_HLH-1_GFP_emb_rep2_extraction2_seq1_aliq...	Snyder_HLH-1_GFP_emb_rep2 extraction2_seq1 channel_2	Snyder_HLH-1_GFP_emb_r...	OP64(made_by : R. Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The HLH-1::EGFP fusion protein is expressed in the correct hlh-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the HLH-1 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119(ed3) III; wgIs64 unc-119(+) hlh-1::TY1::EGFP::3xFLAG official name : OP64 )|Snyder_HLH-1_GFP_emb_rep2 extraction2_seq1 channel_2|embryo	OP64(made_by : R. Wate...	ChIP-Seq
SRX043859	SRA030358	Snyder_NHR-6_GFP_L2_rep1_extraction1_seq1_aliquote_1	Snyder_NHR-6_GFP_L2_rep1_extraction1_seq1_aliqu...	Snyder_NHR-6_GFP_L2_rep1 extraction1_seq1 channel_1	Snyder_NHR-6_GFP_L2_re...	OP90(made_by : R. Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-6::EGFP fusion protein is expressed in the correct nhr-6 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-6 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119(ed3) III; wgIs90 unc-119(+) nhr-6::TY1::EGFP::3xFLAG official name : OP90 )|Snyder_NHR-6_GFP_L2_rep1 extraction1_seq1 channel_1|L2	OP90(made_by : R. Wate...	ChIP-Seq
SRX043860	SRA030358	Snyder_NHR-6_GFP_L2_rep1_extraction1_seq1_aliquote_2	Snyder_NHR-6_GFP_L2_rep1_extraction1_seq1_aliqu...	Snyder_NHR-6_GFP_L2_rep1 extraction1_seq1 channel_2	Snyder_NHR-6_GFP_L2_re...	OP90(made_by : R. Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-6::EGFP fusion protein is expressed in the correct nhr-6 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-6 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119(ed3) III; wgIs90 unc-119(+) nhr-6::TY1::EGFP::3xFLAG official name : OP90 )|Snyder_NHR-6_GFP_L2_rep1 extraction1_seq1 channel_2|L2	OP90(made_by : R. Wate...	ChIP-Seq
SRX043861	SRA030358	Snyder_NHR-6_GFP_L2_rep2_extraction2_seq1_aliquote_1	Snyder_NHR-6_GFP_L2_rep2_extraction2_seq1_aliqu...	Snyder_NHR-6_GFP_L2_rep2 extraction2_seq1 channel_1	Snyder_NHR-6_GFP_L2_re...	OP90(made_by : R. Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-6::EGFP fusion protein is expressed in the correct nhr-6 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-6 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119(ed3) III; wgIs90 unc-119(+) nhr-6::TY1::EGFP::3xFLAG official name : OP90 )|Snyder_NHR-6_GFP_L2_rep2 extraction2_seq1 channel_1|L2	OP90(made_by : R. Wate...	ChIP-Seq
SRX043862	SRA030358	Snyder_NHR-6_GFP_L2_rep2_extraction2_seq1_aliquote_2	Snyder_NHR-6_GFP_L2_rep2_extraction2_seq1_aliqu...	Snyder_NHR-6_GFP_L2_rep2 extraction2_seq1 channel_2	Snyder_NHR-6_GFP_L2_re...	OP90(made_by : R. Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-6::EGFP fusion protein is expressed in the correct nhr-6 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-6 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119(ed3) III; wgIs90 unc-119(+) nhr-6::TY1::EGFP::3xFLAG official name : OP90 )|Snyder_NHR-6_GFP_L2_rep2 extraction2_seq1 channel_2|L2	OP90(made_by : R. Wate...	ChIP-Seq
SRX043863	SRA030359	Snyder_N2_POLII_eemb_rep1_extraction1_seq1_aliquote_1	Snyder_N2_POLII_eemb_rep1_extraction1_seq1_aliq...	Snyder_N2_POLII_eemb_rep1 extraction1_seq1 channel_1	Snyder_N2_POLII_eemb_r...	N2(genotype : wild type genotype : DR subclone of DB original (Tc1 pattern I) official name : N2 )|Snyder_N2_POLII_eemb_rep1 extraction1_seq1 channel_1|early embryo	N2(genotype : wild typ...	ChIP-Seq
SRX043864	SRA030359	Snyder_N2_POLII_eemb_rep1_extraction1_seq1_aliquote_2	Snyder_N2_POLII_eemb_rep1_extraction1_seq1_aliq...	Snyder_N2_POLII_eemb_rep1 extraction1_seq1 channel_2	Snyder_N2_POLII_eemb_r...	N2(genotype : wild type genotype : DR subclone of DB original (Tc1 pattern I) official name : N2 )|Snyder_N2_POLII_eemb_rep1 extraction1_seq1 channel_2|early embryo	N2(genotype : wild typ...	ChIP-Seq
SRX043865	SRA030359	Snyder_N2_POLII_eemb_rep2_extraction2_seq1_aliquote_1	Snyder_N2_POLII_eemb_rep2_extraction2_seq1_aliq...	Snyder_N2_POLII_eemb_rep2 extraction2_seq1 channel_1	Snyder_N2_POLII_eemb_r...	N2(genotype : wild type genotype : DR subclone of DB original (Tc1 pattern I) official name : N2 )|Snyder_N2_POLII_eemb_rep2 extraction2_seq1 channel_1|early embryo	N2(genotype : wild typ...	ChIP-Seq
SRX043866	SRA030359	Snyder_N2_POLII_eemb_rep2_extraction2_seq1_aliquote_2	Snyder_N2_POLII_eemb_rep2_extraction2_seq1_aliq...	Snyder_N2_POLII_eemb_rep2 extraction2_seq1 channel_2	Snyder_N2_POLII_eemb_r...	N2(genotype : wild type genotype : DR subclone of DB original (Tc1 pattern I) official name : N2 )|Snyder_N2_POLII_eemb_rep2 extraction2_seq1 channel_2|early embryo	N2(genotype : wild typ...	ChIP-Seq
SRX043867	SRA030361	Snyder_N2_POLII_lemb_rep1_extraction1_seq1_aliquote_1	Snyder_N2_POLII_lemb_rep1_extraction1_seq1_aliq...	Snyder_N2_POLII_lemb_rep1 extraction1_seq1 channel_1	Snyder_N2_POLII_lemb_r...	N2(genotype : wild type genotype : DR subclone of DB original (Tc1 pattern I) official name : N2 )|Snyder_N2_POLII_lemb_rep1 extraction1_seq1 channel_1|late embryo 20dC 4.5 hrs post-early embryo	N2(genotype : wild typ...	ChIP-Seq
SRX043868	SRA030361	Snyder_N2_POLII_lemb_rep1_extraction1_seq1_aliquote_2	Snyder_N2_POLII_lemb_rep1_extraction1_seq1_aliq...	Snyder_N2_POLII_lemb_rep1 extraction1_seq1 channel_2	Snyder_N2_POLII_lemb_r...	N2(genotype : wild type genotype : DR subclone of DB original (Tc1 pattern I) official name : N2 )|Snyder_N2_POLII_lemb_rep1 extraction1_seq1 channel_2|late embryo 20dC 4.5 hrs post-early embryo	N2(genotype : wild typ...	ChIP-Seq
SRX043869	SRA030361	Snyder_N2_POLII_lemb_rep2_extraction2_seq1_aliquote_1	Snyder_N2_POLII_lemb_rep2_extraction2_seq1_aliq...	Snyder_N2_POLII_lemb_rep2 extraction2_seq1 channel_1	Snyder_N2_POLII_lemb_r...	N2(genotype : wild type genotype : DR subclone of DB original (Tc1 pattern I) official name : N2 )|Snyder_N2_POLII_lemb_rep2 extraction2_seq1 channel_1|late embryo 20dC 4.5 hrs post-early embryo	N2(genotype : wild typ...	ChIP-Seq
SRX043870	SRA030361	Snyder_N2_POLII_lemb_rep2_extraction2_seq1_aliquote_2	Snyder_N2_POLII_lemb_rep2_extraction2_seq1_aliq...	Snyder_N2_POLII_lemb_rep2 extraction2_seq1 channel_2	Snyder_N2_POLII_lemb_r...	N2(genotype : wild type genotype : DR subclone of DB original (Tc1 pattern I) official name : N2 )|Snyder_N2_POLII_lemb_rep2 extraction2_seq1 channel_2|late embryo 20dC 4.5 hrs post-early embryo	N2(genotype : wild typ...	ChIP-Seq
SRX043871	SRA030368	Snyder_N2_POLII_L1_rep1_extraction1_seq1_aliquote_1	Snyder_N2_POLII_L1_rep1_extraction1_seq1_aliquo...	Snyder_N2_POLII_L1_rep1 extraction1_seq1 channel_1	Snyder_N2_POLII_L1_rep...	N2(genotype : wild type genotype : DR subclone of DB original (Tc1 pattern I) official name : N2 )|Snyder_N2_POLII_L1_rep1 extraction1_seq1 channel_1|fed L1	N2(genotype : wild typ...	ChIP-Seq
SRX043872	SRA030368	Snyder_N2_POLII_L1_rep1_extraction1_seq1_aliquote_2	Snyder_N2_POLII_L1_rep1_extraction1_seq1_aliquo...	Snyder_N2_POLII_L1_rep1 extraction1_seq1 channel_2	Snyder_N2_POLII_L1_rep...	N2(genotype : wild type genotype : DR subclone of DB original (Tc1 pattern I) official name : N2 )|Snyder_N2_POLII_L1_rep1 extraction1_seq1 channel_2|fed L1	N2(genotype : wild typ...	ChIP-Seq
SRX043873	SRA030368	Snyder_N2_POLII_L1_rep2_extraction2_seq1_aliquote_1	Snyder_N2_POLII_L1_rep2_extraction2_seq1_aliquo...	Snyder_N2_POLII_L1_rep2 extraction2_seq1 channel_1	Snyder_N2_POLII_L1_rep...	N2(genotype : wild type genotype : DR subclone of DB original (Tc1 pattern I) official name : N2 )|Snyder_N2_POLII_L1_rep2 extraction2_seq1 channel_1|fed L1	N2(genotype : wild typ...	ChIP-Seq
SRX043874	SRA030368	Snyder_N2_POLII_L1_rep2_extraction2_seq1_aliquote_2	Snyder_N2_POLII_L1_rep2_extraction2_seq1_aliquo...	Snyder_N2_POLII_L1_rep2 extraction2_seq1 channel_2	Snyder_N2_POLII_L1_rep...	N2(genotype : wild type genotype : DR subclone of DB original (Tc1 pattern I) official name : N2 )|Snyder_N2_POLII_L1_rep2 extraction2_seq1 channel_2|fed L1	N2(genotype : wild typ...	ChIP-Seq
SRX043875	SRA030371	Snyder_N2_POLII_L2_rep1_extraction1_seq1_aliquote_1	Snyder_N2_POLII_L2_rep1_extraction1_seq1_aliquo...	Snyder_N2_POLII_L2_rep1 extraction1_seq1 channel_1	Snyder_N2_POLII_L2_rep...	N2(genotype : wild type genotype : DR subclone of DB original (Tc1 pattern I) official name : N2 )|Snyder_N2_POLII_L2_rep1 extraction1_seq1 channel_1|L2	N2(genotype : wild typ...	ChIP-Seq
SRX043876	SRA030371	Snyder_N2_POLII_L2_rep1_extraction1_seq1_aliquote_2	Snyder_N2_POLII_L2_rep1_extraction1_seq1_aliquo...	Snyder_N2_POLII_L2_rep1 extraction1_seq1 channel_2	Snyder_N2_POLII_L2_rep...	N2(genotype : wild type genotype : DR subclone of DB original (Tc1 pattern I) official name : N2 )|Snyder_N2_POLII_L2_rep1 extraction1_seq1 channel_2|L2	N2(genotype : wild typ...	ChIP-Seq
SRX043877	SRA030371	Snyder_N2_POLII_L2_rep2_extraction2_seq1_aliquote_1	Snyder_N2_POLII_L2_rep2_extraction2_seq1_aliquo...	Snyder_N2_POLII_L2_rep2 extraction2_seq1 channel_1	Snyder_N2_POLII_L2_rep...	N2(genotype : wild type genotype : DR subclone of DB original (Tc1 pattern I) official name : N2 )|Snyder_N2_POLII_L2_rep2 extraction2_seq1 channel_1|L2	N2(genotype : wild typ...	ChIP-Seq
SRX043878	SRA030371	Snyder_N2_POLII_L2_rep2_extraction2_seq1_aliquote_2	Snyder_N2_POLII_L2_rep2_extraction2_seq1_aliquo...	Snyder_N2_POLII_L2_rep2 extraction2_seq1 channel_2	Snyder_N2_POLII_L2_rep...	N2(genotype : wild type genotype : DR subclone of DB original (Tc1 pattern I) official name : N2 )|Snyder_N2_POLII_L2_rep2 extraction2_seq1 channel_2|L2	N2(genotype : wild typ...	ChIP-Seq
SRX043879	SRA030373	Snyder_N2_POLII_L3_rep1_extraction1_seq1_aliquote_1	Snyder_N2_POLII_L3_rep1_extraction1_seq1_aliquo...	Snyder_N2_POLII_L3_rep1 extraction1_seq1 channel_1	Snyder_N2_POLII_L3_rep...	N2(genotype : wild type genotype : DR subclone of DB original (Tc1 pattern I) official name : N2 )|Snyder_N2_POLII_L3_rep1 extraction1_seq1 channel_1|L3	N2(genotype : wild typ...	ChIP-Seq
SRX043880	SRA030373	Snyder_N2_POLII_L3_rep1_extraction1_seq1_aliquote_2	Snyder_N2_POLII_L3_rep1_extraction1_seq1_aliquo...	Snyder_N2_POLII_L3_rep1 extraction1_seq1 channel_2	Snyder_N2_POLII_L3_rep...	N2(genotype : wild type genotype : DR subclone of DB original (Tc1 pattern I) official name : N2 )|Snyder_N2_POLII_L3_rep1 extraction1_seq1 channel_2|L3	N2(genotype : wild typ...	ChIP-Seq
SRX043881	SRA030373	Snyder_N2_POLII_L3_rep2_extraction2_seq1_aliquote_1	Snyder_N2_POLII_L3_rep2_extraction2_seq1_aliquo...	Snyder_N2_POLII_L3_rep2 extraction2_seq1 channel_1	Snyder_N2_POLII_L3_rep...	N2(genotype : wild type genotype : DR subclone of DB original (Tc1 pattern I) official name : N2 )|Snyder_N2_POLII_L3_rep2 extraction2_seq1 channel_1|L3	N2(genotype : wild typ...	ChIP-Seq
SRX043882	SRA030373	Snyder_N2_POLII_L3_rep2_extraction2_seq1_aliquote_2	Snyder_N2_POLII_L3_rep2_extraction2_seq1_aliquo...	Snyder_N2_POLII_L3_rep2 extraction2_seq1 channel_2	Snyder_N2_POLII_L3_rep...	N2(genotype : wild type genotype : DR subclone of DB original (Tc1 pattern I) official name : N2 )|Snyder_N2_POLII_L3_rep2 extraction2_seq1 channel_2|L3	N2(genotype : wild typ...	ChIP-Seq
SRX043963	SRA030383	Snyder_N2_POLII_YA_rep1_extraction1_seq1_aliquote_1	Snyder_N2_POLII_YA_rep1_extraction1_seq1_aliquo...	Snyder_N2_POLII_YA_rep1 extraction1_seq1 channel_1	Snyder_N2_POLII_YA_rep...	N2(genotype : wild type genotype : DR subclone of DB original (Tc1 pattern I) official name : N2 )|Snyder_N2_POLII_YA_rep1 extraction1_seq1 channel_1|Young Adult	N2(genotype : wild typ...	ChIP-Seq
SRX043964	SRA030383	Snyder_N2_POLII_YA_rep1_extraction1_seq1_aliquote_2	Snyder_N2_POLII_YA_rep1_extraction1_seq1_aliquo...	Snyder_N2_POLII_YA_rep1 extraction1_seq1 channel_2	Snyder_N2_POLII_YA_rep...	N2(genotype : wild type genotype : DR subclone of DB original (Tc1 pattern I) official name : N2 )|Snyder_N2_POLII_YA_rep1 extraction1_seq1 channel_2|Young Adult	N2(genotype : wild typ...	ChIP-Seq
SRX043965	SRA030383	Snyder_N2_POLII_YA_rep2_extraction2_seq1_aliquote_1	Snyder_N2_POLII_YA_rep2_extraction2_seq1_aliquo...	Snyder_N2_POLII_YA_rep2 extraction2_seq1 channel_1	Snyder_N2_POLII_YA_rep...	N2(genotype : wild type genotype : DR subclone of DB original (Tc1 pattern I) official name : N2 )|Snyder_N2_POLII_YA_rep2 extraction2_seq1 channel_1|Young Adult	N2(genotype : wild typ...	ChIP-Seq
SRX043966	SRA030383	Snyder_N2_POLII_YA_rep2_extraction2_seq1_aliquote_2	Snyder_N2_POLII_YA_rep2_extraction2_seq1_aliquo...	Snyder_N2_POLII_YA_rep2 extraction2_seq1 channel_2	Snyder_N2_POLII_YA_rep...	N2(genotype : wild type genotype : DR subclone of DB original (Tc1 pattern I) official name : N2 )|Snyder_N2_POLII_YA_rep2 extraction2_seq1 channel_2|Young Adult	N2(genotype : wild typ...	ChIP-Seq
SRX043967	SRA030384	Snyder_N2_POLII_L4_rep1_extraction1_seq1_aliquote_1	Snyder_N2_POLII_L4_rep1_extraction1_seq1_aliquo...	Snyder_N2_POLII_L4_rep1 extraction1_seq1 channel_1	Snyder_N2_POLII_L4_rep...	N2(genotype : wild type genotype : DR subclone of DB original (Tc1 pattern I) official name : N2 )|Snyder_N2_POLII_L4_rep1 extraction1_seq1 channel_1|L4	N2(genotype : wild typ...	ChIP-Seq
SRX043968	SRA030384	Snyder_N2_POLII_L4_rep1_extraction1_seq1_aliquote_2	Snyder_N2_POLII_L4_rep1_extraction1_seq1_aliquo...	Snyder_N2_POLII_L4_rep1 extraction1_seq1 channel_2	Snyder_N2_POLII_L4_rep...	N2(genotype : wild type genotype : DR subclone of DB original (Tc1 pattern I) official name : N2 )|Snyder_N2_POLII_L4_rep1 extraction1_seq1 channel_2|L4	N2(genotype : wild typ...	ChIP-Seq
SRX043969	SRA030384	Snyder_N2_POLII_L4_rep2_extraction2_seq1_aliquote_1	Snyder_N2_POLII_L4_rep2_extraction2_seq1_aliquo...	Snyder_N2_POLII_L4_rep2 extraction2_seq1 channel_1	Snyder_N2_POLII_L4_rep...	N2(genotype : wild type genotype : DR subclone of DB original (Tc1 pattern I) official name : N2 )|Snyder_N2_POLII_L4_rep2 extraction2_seq1 channel_1|L4	N2(genotype : wild typ...	ChIP-Seq
SRX043970	SRA030384	Snyder_N2_POLII_L4_rep2_extraction2_seq1_aliquote_2	Snyder_N2_POLII_L4_rep2_extraction2_seq1_aliquo...	Snyder_N2_POLII_L4_rep2 extraction2_seq1 channel_2	Snyder_N2_POLII_L4_rep...	N2(genotype : wild type genotype : DR subclone of DB original (Tc1 pattern I) official name : N2 )|Snyder_N2_POLII_L4_rep2 extraction2_seq1 channel_2|L4	N2(genotype : wild typ...	ChIP-Seq
SRX043971	SRA030385	Snyder_GEI11_GFP_L4_rep1_extraction1_seq1_aliquote_1	Snyder_GEI11_GFP_L4_rep1_extraction1_seq1_aliqu...	Snyder_GEI11_GFP_L4_rep1 extraction1_seq1 channel_1	Snyder_GEI11_GFP_L4_re...	OP179(made_by : R. Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The GEI-11::EGFP fusion protein is expressed in the correct gei-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the GEI-11 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119(ed3) III; wgIs179 unc-119(+) gei-11::TY1::EGFP::3xFLAG official name : OP179 )|Snyder_GEI11_GFP_L4_rep1 extraction1_seq1 channel_1|L4	OP179(made_by : R. Wat...	ChIP-Seq
SRX043972	SRA030385	Snyder_GEI11_GFP_L4_rep1_extraction1_seq1_aliquote_2	Snyder_GEI11_GFP_L4_rep1_extraction1_seq1_aliqu...	Snyder_GEI11_GFP_L4_rep1 extraction1_seq1 channel_2	Snyder_GEI11_GFP_L4_re...	OP179(made_by : R. Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The GEI-11::EGFP fusion protein is expressed in the correct gei-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the GEI-11 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119(ed3) III; wgIs179 unc-119(+) gei-11::TY1::EGFP::3xFLAG official name : OP179 )|Snyder_GEI11_GFP_L4_rep1 extraction1_seq1 channel_2|L4	OP179(made_by : R. Wat...	ChIP-Seq
SRX043973	SRA030385	Snyder_GEI11_GFP_L4_rep2_extraction2_seq1_aliquote_1	Snyder_GEI11_GFP_L4_rep2_extraction2_seq1_aliqu...	Snyder_GEI11_GFP_L4_rep2 extraction2_seq1 channel_1	Snyder_GEI11_GFP_L4_re...	OP179(made_by : R. Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The GEI-11::EGFP fusion protein is expressed in the correct gei-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the GEI-11 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119(ed3) III; wgIs179 unc-119(+) gei-11::TY1::EGFP::3xFLAG official name : OP179 )|Snyder_GEI11_GFP_L4_rep2 extraction2_seq1 channel_1|L4	OP179(made_by : R. Wat...	ChIP-Seq
SRX043974	SRA030385	Snyder_GEI11_GFP_L4_rep2_extraction2_seq1_aliquote_2	Snyder_GEI11_GFP_L4_rep2_extraction2_seq1_aliqu...	Snyder_GEI11_GFP_L4_rep2 extraction2_seq1 channel_2	Snyder_GEI11_GFP_L4_re...	OP179(made_by : R. Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The GEI-11::EGFP fusion protein is expressed in the correct gei-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the GEI-11 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119(ed3) III; wgIs179 unc-119(+) gei-11::TY1::EGFP::3xFLAG official name : OP179 )|Snyder_GEI11_GFP_L4_rep2 extraction2_seq1 channel_2|L4	OP179(made_by : R. Wat...	ChIP-Seq
SRX043975	SRA030386	Snyder_PHA4_GFP_lemb_rep1_extraction1_seq1_aliquote_1	Snyder_PHA4_GFP_lemb_rep1_extraction1_seq1_aliq...	Snyder_PHA4_GFP_lemb_rep1 extraction1_seq1 channel_1	Snyder_PHA4_GFP_lemb_r...	OP37(made_by : R. Waterston and S. Kim description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PHA-4::EGFP fusion protein is expressed in the correct pha-4 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PHA-4 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119(ed3) III; wgIs37 unc-119(+) pha-4::TY1::EGFP::3xFLAG official name : OP37 )|Snyder_PHA4_GFP_lemb_rep1 extraction1_seq1 channel_1|late embryo	OP37(made_by : R. Wate...	ChIP-Seq
SRX043976	SRA030386	Snyder_PHA4_GFP_lemb_rep1_extraction1_seq1_aliquote_2	Snyder_PHA4_GFP_lemb_rep1_extraction1_seq1_aliq...	Snyder_PHA4_GFP_lemb_rep1 extraction1_seq1 channel_2	Snyder_PHA4_GFP_lemb_r...	OP37(made_by : R. Waterston and S. Kim description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PHA-4::EGFP fusion protein is expressed in the correct pha-4 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PHA-4 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119(ed3) III; wgIs37 unc-119(+) pha-4::TY1::EGFP::3xFLAG official name : OP37 )|Snyder_PHA4_GFP_lemb_rep1 extraction1_seq1 channel_2|late embryo	OP37(made_by : R. Wate...	ChIP-Seq
SRX043977	SRA030386	Snyder_PHA4_GFP_lemb_rep2_extraction2_seq1_aliquote_1	Snyder_PHA4_GFP_lemb_rep2_extraction2_seq1_aliq...	Snyder_PHA4_GFP_lemb_rep2 extraction2_seq1 channel_1	Snyder_PHA4_GFP_lemb_r...	OP37(made_by : R. Waterston and S. Kim description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PHA-4::EGFP fusion protein is expressed in the correct pha-4 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PHA-4 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119(ed3) III; wgIs37 unc-119(+) pha-4::TY1::EGFP::3xFLAG official name : OP37 )|Snyder_PHA4_GFP_lemb_rep2 extraction2_seq1 channel_1|late embryo	OP37(made_by : R. Wate...	ChIP-Seq
SRX043978	SRA030386	Snyder_PHA4_GFP_lemb_rep2_extraction2_seq1_aliquote_2	Snyder_PHA4_GFP_lemb_rep2_extraction2_seq1_aliq...	Snyder_PHA4_GFP_lemb_rep2 extraction2_seq1 channel_2	Snyder_PHA4_GFP_lemb_r...	OP37(made_by : R. Waterston and S. Kim description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PHA-4::EGFP fusion protein is expressed in the correct pha-4 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PHA-4 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119(ed3) III; wgIs37 unc-119(+) pha-4::TY1::EGFP::3xFLAG official name : OP37 )|Snyder_PHA4_GFP_lemb_rep2 extraction2_seq1 channel_2|late embryo	OP37(made_by : R. Wate...	ChIP-Seq
SRX043979	SRA030387	Snyder_MEP-1_GFP_emb_rep1_extraction1_seq1_aliquote_1	Snyder_MEP-1_GFP_emb_rep1_extraction1_seq1_aliq...	Snyder_MEP-1_GFP_emb_rep1 extraction1_seq1 channel_1	Snyder_MEP-1_GFP_emb_r...	OP70(made_by : R Waterston tags : GFP::3xFlag mutagen : Bombard genotype : unc119(ed3); wgIs70(mep-1::TY1 EGFP FLAG C; unc119) official name : WBGene00003218 )|Snyder_MEP-1_GFP_emb_rep1 extraction1_seq1 channel_1|embryo	OP70(made_by : R Water...	ChIP-Seq
SRX043980	SRA030387	Snyder_MEP-1_GFP_emb_rep1_extraction1_seq1_aliquote_2	Snyder_MEP-1_GFP_emb_rep1_extraction1_seq1_aliq...	Snyder_MEP-1_GFP_emb_rep1 extraction1_seq1 channel_2	Snyder_MEP-1_GFP_emb_r...	OP70(made_by : R Waterston tags : GFP::3xFlag mutagen : Bombard genotype : unc119(ed3); wgIs70(mep-1::TY1 EGFP FLAG C; unc119) official name : WBGene00003218 )|Snyder_MEP-1_GFP_emb_rep1 extraction1_seq1 channel_2|embryo	OP70(made_by : R Water...	ChIP-Seq
SRX043981	SRA030387	Snyder_MEP-1_GFP_emb_rep2_extraction2_seq1_aliquote_1	Snyder_MEP-1_GFP_emb_rep2_extraction2_seq1_aliq...	Snyder_MEP-1_GFP_emb_rep2 extraction2_seq1 channel_1	Snyder_MEP-1_GFP_emb_r...	OP70(made_by : R Waterston tags : GFP::3xFlag mutagen : Bombard genotype : unc119(ed3); wgIs70(mep-1::TY1 EGFP FLAG C; unc119) official name : WBGene00003218 )|Snyder_MEP-1_GFP_emb_rep2 extraction2_seq1 channel_1|embryo	OP70(made_by : R Water...	ChIP-Seq
SRX043982	SRA030387	Snyder_MEP-1_GFP_emb_rep2_extraction2_seq1_aliquote_2	Snyder_MEP-1_GFP_emb_rep2_extraction2_seq1_aliq...	Snyder_MEP-1_GFP_emb_rep2 extraction2_seq1 channel_2	Snyder_MEP-1_GFP_emb_r...	OP70(made_by : R Waterston tags : GFP::3xFlag mutagen : Bombard genotype : unc119(ed3); wgIs70(mep-1::TY1 EGFP FLAG C; unc119) official name : WBGene00003218 )|Snyder_MEP-1_GFP_emb_rep2 extraction2_seq1 channel_2|embryo	OP70(made_by : R Water...	ChIP-Seq
SRX043983	SRA030388	Snyder_MDL-1_GFP_L1_rep1_extraction1_seq1_aliquote_1	Snyder_MDL-1_GFP_L1_rep1_extraction1_seq1_aliqu...	Snyder_MDL-1_GFP_L1_rep1 extraction1_seq1 channel_1	Snyder_MDL-1_GFP_L1_re...	OP106(made_by : R Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The MDL-1::EGFP fusion protein is expressed in the correct mdl-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the MDL-1 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119 (ed3) III; wgIs106 mdl-1::TY1::EGFP::FLAG; unc-119(+)) official name : OP106 )|Snyder_MDL-1_GFP_L1_rep1 extraction1_seq1 channel_1|fed L1	OP106(made_by : R Wate...	ChIP-Seq
SRX043984	SRA030388	Snyder_MDL-1_GFP_L1_rep1_extraction1_seq1_aliquote_2	Snyder_MDL-1_GFP_L1_rep1_extraction1_seq1_aliqu...	Snyder_MDL-1_GFP_L1_rep1 extraction1_seq1 channel_2	Snyder_MDL-1_GFP_L1_re...	OP106(made_by : R Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The MDL-1::EGFP fusion protein is expressed in the correct mdl-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the MDL-1 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119 (ed3) III; wgIs106 mdl-1::TY1::EGFP::FLAG; unc-119(+)) official name : OP106 )|Snyder_MDL-1_GFP_L1_rep1 extraction1_seq1 channel_2|fed L1	OP106(made_by : R Wate...	ChIP-Seq
SRX043985	SRA030388	Snyder_MDL-1_GFP_L1_rep2_extraction2_seq1_aliquote_1	Snyder_MDL-1_GFP_L1_rep2_extraction2_seq1_aliqu...	Snyder_MDL-1_GFP_L1_rep2 extraction2_seq1 channel_1	Snyder_MDL-1_GFP_L1_re...	OP106(made_by : R Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The MDL-1::EGFP fusion protein is expressed in the correct mdl-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the MDL-1 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119 (ed3) III; wgIs106 mdl-1::TY1::EGFP::FLAG; unc-119(+)) official name : OP106 )|Snyder_MDL-1_GFP_L1_rep2 extraction2_seq1 channel_1|fed L1	OP106(made_by : R Wate...	ChIP-Seq
SRX043986	SRA030388	Snyder_MDL-1_GFP_L1_rep2_extraction2_seq1_aliquote_2	Snyder_MDL-1_GFP_L1_rep2_extraction2_seq1_aliqu...	Snyder_MDL-1_GFP_L1_rep2 extraction2_seq1 channel_2	Snyder_MDL-1_GFP_L1_re...	OP106(made_by : R Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The MDL-1::EGFP fusion protein is expressed in the correct mdl-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the MDL-1 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119 (ed3) III; wgIs106 mdl-1::TY1::EGFP::FLAG; unc-119(+)) official name : OP106 )|Snyder_MDL-1_GFP_L1_rep2 extraction2_seq1 channel_2|fed L1	OP106(made_by : R Wate...	ChIP-Seq
SRX043987	SRA030389	Snyder_LIN-15B_GFP_L3_rep1_extraction1_seq1_aliquote_1	Snyder_LIN-15B_GFP_L3_rep1_extraction1_seq1_ali...	Snyder_LIN-15B_GFP_L3_rep1 extraction1_seq1 channel_1	Snyder_LIN-15B_GFP_L3_...	OP184(made_by : S Kim description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-15B::EGFP fusion protein is expressed in the correct lin-15B spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-15B transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc119(ed3); wgIs184(lin-15B::TY1 EGFP FLAG; unc119) official name : OP184 )|Snyder_LIN-15B_GFP_L3_rep1 extraction1_seq1 channel_1|L3	OP184(made_by : S Kim ...	ChIP-Seq
SRX043988	SRA030389	Snyder_LIN-15B_GFP_L3_rep1_extraction1_seq1_aliquote_2	Snyder_LIN-15B_GFP_L3_rep1_extraction1_seq1_ali...	Snyder_LIN-15B_GFP_L3_rep1 extraction1_seq1 channel_2	Snyder_LIN-15B_GFP_L3_...	OP184(made_by : S Kim description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-15B::EGFP fusion protein is expressed in the correct lin-15B spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-15B transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc119(ed3); wgIs184(lin-15B::TY1 EGFP FLAG; unc119) official name : OP184 )|Snyder_LIN-15B_GFP_L3_rep1 extraction1_seq1 channel_2|L3	OP184(made_by : S Kim ...	ChIP-Seq
SRX043989	SRA030389	Snyder_LIN-15B_GFP_L3_rep2_extraction2_seq1_aliquote_1	Snyder_LIN-15B_GFP_L3_rep2_extraction2_seq1_ali...	Snyder_LIN-15B_GFP_L3_rep2 extraction2_seq1 channel_1	Snyder_LIN-15B_GFP_L3_...	OP184(made_by : S Kim description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-15B::EGFP fusion protein is expressed in the correct lin-15B spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-15B transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc119(ed3); wgIs184(lin-15B::TY1 EGFP FLAG; unc119) official name : OP184 )|Snyder_LIN-15B_GFP_L3_rep2 extraction2_seq1 channel_1|L3	OP184(made_by : S Kim ...	ChIP-Seq
SRX043990	SRA030389	Snyder_LIN-15B_GFP_L3_rep2_extraction2_seq1_aliquote_2	Snyder_LIN-15B_GFP_L3_rep2_extraction2_seq1_ali...	Snyder_LIN-15B_GFP_L3_rep2 extraction2_seq1 channel_2	Snyder_LIN-15B_GFP_L3_...	OP184(made_by : S Kim description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-15B::EGFP fusion protein is expressed in the correct lin-15B spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-15B transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc119(ed3); wgIs184(lin-15B::TY1 EGFP FLAG; unc119) official name : OP184 )|Snyder_LIN-15B_GFP_L3_rep2 extraction2_seq1 channel_2|L3	OP184(made_by : S Kim ...	ChIP-Seq
SRX043991	SRA030390	Snyder_BLMP-1_GFP_L1_rep1_extraction1_seq1_aliquote_1	Snyder_BLMP-1_GFP_L1_rep1_extraction1_seq1_aliq...	Snyder_BLMP-1_GFP_L1_rep1 extraction1_seq1 channel_1	Snyder_BLMP-1_GFP_L1_r...	OP109(made_by : R Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The BLMP-1::EGFP fusion protein is expressed in the correct blmp-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the BLMP-1 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119 (ed3) III; wgIs109 blmp-1::TY1::EGFP::FLAG; unc-119 (+) official name : OP109 )|Snyder_BLMP-1_GFP_L1_rep1 extraction1_seq1 channel_1|fed L1	OP109(made_by : R Wate...	ChIP-Seq
SRX043992	SRA030390	Snyder_BLMP-1_GFP_L1_rep1_extraction1_seq1_aliquote_2	Snyder_BLMP-1_GFP_L1_rep1_extraction1_seq1_aliq...	Snyder_BLMP-1_GFP_L1_rep1 extraction1_seq1 channel_2	Snyder_BLMP-1_GFP_L1_r...	OP109(made_by : R Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The BLMP-1::EGFP fusion protein is expressed in the correct blmp-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the BLMP-1 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119 (ed3) III; wgIs109 blmp-1::TY1::EGFP::FLAG; unc-119 (+) official name : OP109 )|Snyder_BLMP-1_GFP_L1_rep1 extraction1_seq1 channel_2|fed L1	OP109(made_by : R Wate...	ChIP-Seq
SRX043993	SRA030390	Snyder_BLMP-1_GFP_L1_rep2_extraction2_seq1_aliquote_1	Snyder_BLMP-1_GFP_L1_rep2_extraction2_seq1_aliq...	Snyder_BLMP-1_GFP_L1_rep2 extraction2_seq1 channel_1	Snyder_BLMP-1_GFP_L1_r...	OP109(made_by : R Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The BLMP-1::EGFP fusion protein is expressed in the correct blmp-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the BLMP-1 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119 (ed3) III; wgIs109 blmp-1::TY1::EGFP::FLAG; unc-119 (+) official name : OP109 )|Snyder_BLMP-1_GFP_L1_rep2 extraction2_seq1 channel_1|fed L1	OP109(made_by : R Wate...	ChIP-Seq
SRX043994	SRA030390	Snyder_BLMP-1_GFP_L1_rep2_extraction2_seq1_aliquote_2	Snyder_BLMP-1_GFP_L1_rep2_extraction2_seq1_aliq...	Snyder_BLMP-1_GFP_L1_rep2 extraction2_seq1 channel_2	Snyder_BLMP-1_GFP_L1_r...	OP109(made_by : R Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The BLMP-1::EGFP fusion protein is expressed in the correct blmp-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the BLMP-1 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119 (ed3) III; wgIs109 blmp-1::TY1::EGFP::FLAG; unc-119 (+) official name : OP109 )|Snyder_BLMP-1_GFP_L1_rep2 extraction2_seq1 channel_2|fed L1	OP109(made_by : R Wate...	ChIP-Seq
SRX043995	SRA030391	Snyder_LIN-13_GFP_emb_rep1_extraction1_seq1_aliquote_1	Snyder_LIN-13_GFP_emb_rep1_extraction1_seq1_ali...	Snyder_LIN-13_GFP_emb_rep1 extraction1_seq1 channel_1	Snyder_LIN-13_GFP_emb_...	OP51(made_by : R Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-13::EGFP fusion protein is expressed in the correct LIN-13 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-13 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119 (ed3) III; wgIs73 lin-13::TY1::EGFP::FLAG; unc-119 (+) official name : OP51 )|Snyder_LIN-13_GFP_emb_rep1 extraction1_seq1 channel_1|embryo	OP51(made_by : R Water...	ChIP-Seq
SRX043996	SRA030391	Snyder_LIN-13_GFP_emb_rep1_extraction1_seq1_aliquote_2	Snyder_LIN-13_GFP_emb_rep1_extraction1_seq1_ali...	Snyder_LIN-13_GFP_emb_rep1 extraction1_seq1 channel_2	Snyder_LIN-13_GFP_emb_...	OP51(made_by : R Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-13::EGFP fusion protein is expressed in the correct LIN-13 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-13 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119 (ed3) III; wgIs73 lin-13::TY1::EGFP::FLAG; unc-119 (+) official name : OP51 )|Snyder_LIN-13_GFP_emb_rep1 extraction1_seq1 channel_2|embryo	OP51(made_by : R Water...	ChIP-Seq
SRX043997	SRA030391	Snyder_LIN-13_GFP_emb_rep2_extraction2_seq1_aliquote_1	Snyder_LIN-13_GFP_emb_rep2_extraction2_seq1_ali...	Snyder_LIN-13_GFP_emb_rep2 extraction2_seq1 channel_1	Snyder_LIN-13_GFP_emb_...	OP51(made_by : R Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-13::EGFP fusion protein is expressed in the correct LIN-13 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-13 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119 (ed3) III; wgIs73 lin-13::TY1::EGFP::FLAG; unc-119 (+) official name : OP51 )|Snyder_LIN-13_GFP_emb_rep2 extraction2_seq1 channel_1|embryo	OP51(made_by : R Water...	ChIP-Seq
SRX043998	SRA030391	Snyder_LIN-13_GFP_emb_rep2_extraction2_seq1_aliquote_2	Snyder_LIN-13_GFP_emb_rep2_extraction2_seq1_ali...	Snyder_LIN-13_GFP_emb_rep2 extraction2_seq1 channel_2	Snyder_LIN-13_GFP_emb_...	OP51(made_by : R Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-13::EGFP fusion protein is expressed in the correct LIN-13 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-13 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119 (ed3) III; wgIs73 lin-13::TY1::EGFP::FLAG; unc-119 (+) official name : OP51 )|Snyder_LIN-13_GFP_emb_rep2 extraction2_seq1 channel_2|embryo	OP51(made_by : R Water...	ChIP-Seq
SRX043999	SRA030392	Snyder_ELT-3_GFP_L1_rep1_extraction1_seq1_aliquote_1	Snyder_ELT-3_GFP_L1_rep1_extraction1_seq1_aliqu...	Snyder_ELT-3_GFP_L1_rep1 extraction1_seq1 channel_1	Snyder_ELT-3_GFP_L1_re...	OP75(made_by : R Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ELT-3::EGFP fusion protein is expressed in the correct elt-3 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ELT-3 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119 (ed3) III; wgIs75 elt-3::TY1::EGFP::FLAG; unc-119 (+) official name : OP75 )|Snyder_ELT-3_GFP_L1_rep1 extraction1_seq1 channel_1|fed L1	OP75(made_by : R Water...	ChIP-Seq
SRX044000	SRA030392	Snyder_ELT-3_GFP_L1_rep1_extraction1_seq1_aliquote_2	Snyder_ELT-3_GFP_L1_rep1_extraction1_seq1_aliqu...	Snyder_ELT-3_GFP_L1_rep1 extraction1_seq1 channel_2	Snyder_ELT-3_GFP_L1_re...	OP75(made_by : R Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ELT-3::EGFP fusion protein is expressed in the correct elt-3 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ELT-3 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119 (ed3) III; wgIs75 elt-3::TY1::EGFP::FLAG; unc-119 (+) official name : OP75 )|Snyder_ELT-3_GFP_L1_rep1 extraction1_seq1 channel_2|fed L1	OP75(made_by : R Water...	ChIP-Seq
SRX044001	SRA030392	Snyder_ELT-3_GFP_L1_rep2_extraction2_seq1_aliquote_1	Snyder_ELT-3_GFP_L1_rep2_extraction2_seq1_aliqu...	Snyder_ELT-3_GFP_L1_rep2 extraction2_seq1 channel_1	Snyder_ELT-3_GFP_L1_re...	OP75(made_by : R Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ELT-3::EGFP fusion protein is expressed in the correct elt-3 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ELT-3 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119 (ed3) III; wgIs75 elt-3::TY1::EGFP::FLAG; unc-119 (+) official name : OP75 )|Snyder_ELT-3_GFP_L1_rep2 extraction2_seq1 channel_1|fed L1	OP75(made_by : R Water...	ChIP-Seq
SRX044002	SRA030392	Snyder_ELT-3_GFP_L1_rep2_extraction2_seq1_aliquote_2	Snyder_ELT-3_GFP_L1_rep2_extraction2_seq1_aliqu...	Snyder_ELT-3_GFP_L1_rep2 extraction2_seq1 channel_2	Snyder_ELT-3_GFP_L1_re...	OP75(made_by : R Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ELT-3::EGFP fusion protein is expressed in the correct elt-3 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ELT-3 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119 (ed3) III; wgIs75 elt-3::TY1::EGFP::FLAG; unc-119 (+) official name : OP75 )|Snyder_ELT-3_GFP_L1_rep2 extraction2_seq1 channel_2|fed L1	OP75(made_by : R Water...	ChIP-Seq
SRX044003	SRA030393	Snyder_CEH-30_GFP_lemb_rep1_extraction1_seq1_aliquote_1	Snyder_CEH-30_GFP_lemb_rep1_extraction1_seq1_al...	Snyder_CEH-30_GFP_lemb_rep1 extraction1_seq1 channel_1	Snyder_CEH-30_GFP_lemb...	OP120(made_by : R Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CEH-30::EGFP fusion protein is expressed in the correct ceh-30 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CEH-30 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc119(ed3); wgIs120(ceh-30::TY1 EGFP FLAG; unc119) official name : OP120 )|Snyder_CEH-30_GFP_lemb_rep1 extraction1_seq1 channel_1|late embryo	OP120(made_by : R Wate...	ChIP-Seq
SRX044004	SRA030393	Snyder_CEH-30_GFP_lemb_rep1_extraction1_seq1_aliquote_2	Snyder_CEH-30_GFP_lemb_rep1_extraction1_seq1_al...	Snyder_CEH-30_GFP_lemb_rep1 extraction1_seq1 channel_2	Snyder_CEH-30_GFP_lemb...	OP120(made_by : R Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CEH-30::EGFP fusion protein is expressed in the correct ceh-30 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CEH-30 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc119(ed3); wgIs120(ceh-30::TY1 EGFP FLAG; unc119) official name : OP120 )|Snyder_CEH-30_GFP_lemb_rep1 extraction1_seq1 channel_2|late embryo	OP120(made_by : R Wate...	ChIP-Seq
SRX044005	SRA030393	Snyder_CEH-30_GFP_lemb_rep2_extraction2_seq1_aliquote_1	Snyder_CEH-30_GFP_lemb_rep2_extraction2_seq1_al...	Snyder_CEH-30_GFP_lemb_rep2 extraction2_seq1 channel_1	Snyder_CEH-30_GFP_lemb...	OP120(made_by : R Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CEH-30::EGFP fusion protein is expressed in the correct ceh-30 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CEH-30 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc119(ed3); wgIs120(ceh-30::TY1 EGFP FLAG; unc119) official name : OP120 )|Snyder_CEH-30_GFP_lemb_rep2 extraction2_seq1 channel_1|late embryo	OP120(made_by : R Wate...	ChIP-Seq
SRX044006	SRA030393	Snyder_CEH-30_GFP_lemb_rep2_extraction2_seq1_aliquote_2	Snyder_CEH-30_GFP_lemb_rep2_extraction2_seq1_al...	Snyder_CEH-30_GFP_lemb_rep2 extraction2_seq1 channel_2	Snyder_CEH-30_GFP_lemb...	OP120(made_by : R Waterston description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CEH-30::EGFP fusion protein is expressed in the correct ceh-30 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CEH-30 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc119(ed3); wgIs120(ceh-30::TY1 EGFP FLAG; unc119) official name : OP120 )|Snyder_CEH-30_GFP_lemb_rep2 extraction2_seq1 channel_2|late embryo	OP120(made_by : R Wate...	ChIP-Seq
SRX044007	SRA030394	Snyder_EGL-27_GFP_L1_rep1_extraction1_seq1_aliquote_1	Snyder_EGL-27_GFP_L1_rep1_extraction1_seq1_aliq...	Snyder_EGL-27_GFP_L1_rep1 extraction1_seq1 channel_1	Snyder_EGL-27_GFP_L1_r...	OP177(made_by : S Kim description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The EGL-27::EGFP fusion protein is expressed in the correct egl-27 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the EGL-27 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc119(ed3); wgIs177(egl-27::TY1 EGFP FLAG; unc119) official name : OP177 )|Snyder_EGL-27_GFP_L1_rep1 extraction1_seq1 channel_1|fed L1	OP177(made_by : S Kim ...	ChIP-Seq
SRX044008	SRA030394	Snyder_EGL-27_GFP_L1_rep1_extraction1_seq1_aliquote_2	Snyder_EGL-27_GFP_L1_rep1_extraction1_seq1_aliq...	Snyder_EGL-27_GFP_L1_rep1 extraction1_seq1 channel_2	Snyder_EGL-27_GFP_L1_r...	OP177(made_by : S Kim description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The EGL-27::EGFP fusion protein is expressed in the correct egl-27 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the EGL-27 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc119(ed3); wgIs177(egl-27::TY1 EGFP FLAG; unc119) official name : OP177 )|Snyder_EGL-27_GFP_L1_rep1 extraction1_seq1 channel_2|fed L1	OP177(made_by : S Kim ...	ChIP-Seq
SRX044009	SRA030394	Snyder_EGL-27_GFP_L1_rep2_extraction2_seq1_aliquote_1	Snyder_EGL-27_GFP_L1_rep2_extraction2_seq1_aliq...	Snyder_EGL-27_GFP_L1_rep2 extraction2_seq1 channel_1	Snyder_EGL-27_GFP_L1_r...	OP177(made_by : S Kim description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The EGL-27::EGFP fusion protein is expressed in the correct egl-27 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the EGL-27 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc119(ed3); wgIs177(egl-27::TY1 EGFP FLAG; unc119) official name : OP177 )|Snyder_EGL-27_GFP_L1_rep2 extraction2_seq1 channel_1|fed L1	OP177(made_by : S Kim ...	ChIP-Seq
SRX044010	SRA030394	Snyder_EGL-27_GFP_L1_rep2_extraction2_seq1_aliquote_2	Snyder_EGL-27_GFP_L1_rep2_extraction2_seq1_aliq...	Snyder_EGL-27_GFP_L1_rep2 extraction2_seq1 channel_2	Snyder_EGL-27_GFP_L1_r...	OP177(made_by : S Kim description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The EGL-27::EGFP fusion protein is expressed in the correct egl-27 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the EGL-27 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc119(ed3); wgIs177(egl-27::TY1 EGFP FLAG; unc119) official name : OP177 )|Snyder_EGL-27_GFP_L1_rep2 extraction2_seq1 channel_2|fed L1	OP177(made_by : S Kim ...	ChIP-Seq
SRX044011	SRA030395	Snyder_SKN-1_GFP_L1_rep1_extraction1_seq1_aliquote_1	Snyder_SKN-1_GFP_L1_rep1_extraction1_seq1_aliqu...	Snyder_SKN-1_GFP_L1_rep1 extraction1_seq1 channel_1	Snyder_SKN-1_GFP_L1_re...	OP178(made_by : S Kim tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc119(ed3); wgIs178(skn-1::TY1 EGFP FLAG; unc119) official name : WBGene00004804 )|Snyder_SKN-1_GFP_L1_rep1 extraction1_seq1 channel_1|fed L1	OP178(made_by : S Kim ...	ChIP-Seq
SRX044012	SRA030395	Snyder_SKN-1_GFP_L1_rep1_extraction1_seq1_aliquote_2	Snyder_SKN-1_GFP_L1_rep1_extraction1_seq1_aliqu...	Snyder_SKN-1_GFP_L1_rep1 extraction1_seq1 channel_2	Snyder_SKN-1_GFP_L1_re...	OP178(made_by : S Kim tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc119(ed3); wgIs178(skn-1::TY1 EGFP FLAG; unc119) official name : WBGene00004804 )|Snyder_SKN-1_GFP_L1_rep1 extraction1_seq1 channel_2|fed L1	OP178(made_by : S Kim ...	ChIP-Seq
SRX044013	SRA030395	Snyder_SKN-1_GFP_L1_rep2_extraction2_seq1_aliquote_1	Snyder_SKN-1_GFP_L1_rep2_extraction2_seq1_aliqu...	Snyder_SKN-1_GFP_L1_rep2 extraction2_seq1 channel_1	Snyder_SKN-1_GFP_L1_re...	OP178(made_by : S Kim tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc119(ed3); wgIs178(skn-1::TY1 EGFP FLAG; unc119) official name : WBGene00004804 )|Snyder_SKN-1_GFP_L1_rep2 extraction2_seq1 channel_1|fed L1	OP178(made_by : S Kim ...	ChIP-Seq
SRX044014	SRA030395	Snyder_SKN-1_GFP_L1_rep2_extraction2_seq1_aliquote_2	Snyder_SKN-1_GFP_L1_rep2_extraction2_seq1_aliqu...	Snyder_SKN-1_GFP_L1_rep2 extraction2_seq1 channel_2	Snyder_SKN-1_GFP_L1_re...	OP178(made_by : S Kim tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc119(ed3); wgIs178(skn-1::TY1 EGFP FLAG; unc119) official name : WBGene00004804 )|Snyder_SKN-1_GFP_L1_rep2 extraction2_seq1 channel_2|fed L1	OP178(made_by : S Kim ...	ChIP-Seq
SRX044015	SRA030396	Snyder_PQM-1_GFP_L3_rep1_extraction1_seq1_aliquote_1	Snyder_PQM-1_GFP_L3_rep1_extraction1_seq1_aliqu...	Snyder_PQM-1_GFP_L3_rep1 extraction1_seq1 channel_1	Snyder_PQM-1_GFP_L3_re...	OP201(made_by : S Kim description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PQM-1::EGFP fusion protein is expressed in the correct pqm-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PQM-1 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc119(ed3); wgIs201(pqm-1::TY1 EGFP FLAG C; unc119) official name : OP201 )|Snyder_PQM-1_GFP_L3_rep1 extraction1_seq1 channel_1|L3	OP201(made_by : S Kim ...	ChIP-Seq
SRX044016	SRA030396	Snyder_PQM-1_GFP_L3_rep1_extraction1_seq1_aliquote_2	Snyder_PQM-1_GFP_L3_rep1_extraction1_seq1_aliqu...	Snyder_PQM-1_GFP_L3_rep1 extraction1_seq1 channel_2	Snyder_PQM-1_GFP_L3_re...	OP201(made_by : S Kim description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PQM-1::EGFP fusion protein is expressed in the correct pqm-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PQM-1 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc119(ed3); wgIs201(pqm-1::TY1 EGFP FLAG C; unc119) official name : OP201 )|Snyder_PQM-1_GFP_L3_rep1 extraction1_seq1 channel_2|L3	OP201(made_by : S Kim ...	ChIP-Seq
SRX044017	SRA030396	Snyder_PQM-1_GFP_L3_rep2_extraction2_seq1_aliquote_1	Snyder_PQM-1_GFP_L3_rep2_extraction2_seq1_aliqu...	Snyder_PQM-1_GFP_L3_rep2 extraction2_seq1 channel_1	Snyder_PQM-1_GFP_L3_re...	OP201(made_by : S Kim description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PQM-1::EGFP fusion protein is expressed in the correct pqm-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PQM-1 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc119(ed3); wgIs201(pqm-1::TY1 EGFP FLAG C; unc119) official name : OP201 )|Snyder_PQM-1_GFP_L3_rep2 extraction2_seq1 channel_1|L3	OP201(made_by : S Kim ...	ChIP-Seq
SRX044018	SRA030396	Snyder_PQM-1_GFP_L3_rep2_extraction2_seq1_aliquote_2	Snyder_PQM-1_GFP_L3_rep2_extraction2_seq1_aliqu...	Snyder_PQM-1_GFP_L3_rep2 extraction2_seq1 channel_2	Snyder_PQM-1_GFP_L3_re...	OP201(made_by : S Kim description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PQM-1::EGFP fusion protein is expressed in the correct pqm-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PQM-1 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc119(ed3); wgIs201(pqm-1::TY1 EGFP FLAG C; unc119) official name : OP201 )|Snyder_PQM-1_GFP_L3_rep2 extraction2_seq1 channel_2|L3	OP201(made_by : S Kim ...	ChIP-Seq
SRX044021	SRA030356	Snyder_LIN-39-GFP_L3_rep1_extraction1_seq1_aliquote_1	Snyder_LIN-39-GFP_L3_rep1_extraction1_seq1_aliq...	Snyder_LIN-39-GFP_L3_rep1 extraction1_seq1 channel_1	Snyder_LIN-39-GFP_L3_r...	OP18(made_by : R. Waterston and S. Kim description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-39::EGFP fusion protein is expressed in the correct lin-39 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-39 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119(ed3) III; wgIs18 unc-119(+) lin-39::TY1::EGFP::3xFLAG official name : OP18 )|Snyder_LIN-39-GFP_L3_rep1 extraction1_seq1 channel_1|L3	OP18(made_by : R. Wate...	ChIP-Seq
SRX044022	SRA030356	Snyder_LIN-39-GFP_L3_rep1_extraction1_seq1_aliquote_2	Snyder_LIN-39-GFP_L3_rep1_extraction1_seq1_aliq...	Snyder_LIN-39-GFP_L3_rep1 extraction1_seq1 channel_2	Snyder_LIN-39-GFP_L3_r...	OP18(made_by : R. Waterston and S. Kim description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-39::EGFP fusion protein is expressed in the correct lin-39 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-39 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119(ed3) III; wgIs18 unc-119(+) lin-39::TY1::EGFP::3xFLAG official name : OP18 )|Snyder_LIN-39-GFP_L3_rep1 extraction1_seq1 channel_2|L3	OP18(made_by : R. Wate...	ChIP-Seq
SRX044023	SRA030356	Snyder_LIN-39-GFP_L3_rep2_extraction2_seq1_aliquote_1	Snyder_LIN-39-GFP_L3_rep2_extraction2_seq1_aliq...	Snyder_LIN-39-GFP_L3_rep2 extraction2_seq1 channel_1	Snyder_LIN-39-GFP_L3_r...	OP18(made_by : R. Waterston and S. Kim description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-39::EGFP fusion protein is expressed in the correct lin-39 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-39 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119(ed3) III; wgIs18 unc-119(+) lin-39::TY1::EGFP::3xFLAG official name : OP18 )|Snyder_LIN-39-GFP_L3_rep2 extraction2_seq1 channel_1|L3	OP18(made_by : R. Wate...	ChIP-Seq
SRX044024	SRA030356	Snyder_LIN-39-GFP_L3_rep2_extraction2_seq1_aliquote_2	Snyder_LIN-39-GFP_L3_rep2_extraction2_seq1_aliq...	Snyder_LIN-39-GFP_L3_rep2 extraction2_seq1 channel_2	Snyder_LIN-39-GFP_L3_r...	OP18(made_by : R. Waterston and S. Kim description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-39::EGFP fusion protein is expressed in the correct lin-39 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-39 transcription factor. tags : GFP::3xFlag mutagen : Bombard outcross : 3 genotype : unc-119(ed3) III; wgIs18 unc-119(+) lin-39::TY1::EGFP::3xFLAG official name : OP18 )|Snyder_LIN-39-GFP_L3_rep2 extraction2_seq1 channel_2|L3	OP18(made_by : R. Wate...	ChIP-Seq
SRX054205	SRA030935	Snyder_PHA-4_GFP_YA_rep2_extraction1_seq1_aliquote_1	Snyder_PHA-4_GFP_YA_rep2_extraction1_seq1_aliqu...	Snyder_PHA-4_GFP_YA_rep2 extraction1_seq1 channel_1	Snyder_PHA-4_GFP_YA_re...	OP37(official name : OP37 genotype : unc-119(ed3) III; wgIs37 unc-119(+) pha-4::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PHA-4::EGFP fusion protein is expressed in the correct pha-4 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PHA-4 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_PHA-4_GFP_YA_rep2 extraction1_seq1 channel_1|Young Adult	OP37(official name : O...	ChIP-Seq
SRX054206	SRA030935	Snyder_PHA-4_GFP_YA_rep2_extraction2_seq2_aliquote_1	Snyder_PHA-4_GFP_YA_rep2_extraction2_seq2_aliqu...	Snyder_PHA-4_GFP_YA_rep2 extraction2_seq2 channel_1	Snyder_PHA-4_GFP_YA_re...	OP37(official name : OP37 genotype : unc-119(ed3) III; wgIs37 unc-119(+) pha-4::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PHA-4::EGFP fusion protein is expressed in the correct pha-4 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PHA-4 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_PHA-4_GFP_YA_rep2 extraction2_seq2 channel_1|Young Adult	OP37(official name : O...	ChIP-Seq
SRX054207	SRA030935	Snyder_PHA-4_GFP_YA_rep2_extraction3_seq3_aliquote_1	Snyder_PHA-4_GFP_YA_rep2_extraction3_seq3_aliqu...	Snyder_PHA-4_GFP_YA_rep2 extraction3_seq3 channel_1	Snyder_PHA-4_GFP_YA_re...	OP37(official name : OP37 genotype : unc-119(ed3) III; wgIs37 unc-119(+) pha-4::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PHA-4::EGFP fusion protein is expressed in the correct pha-4 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PHA-4 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_PHA-4_GFP_YA_rep2 extraction3_seq3 channel_1|Young Adult	OP37(official name : O...	ChIP-Seq
SRX054208	SRA030935	Snyder_PHA-4_GFP_YA_rep2_extraction4_seq4_aliquote_1	Snyder_PHA-4_GFP_YA_rep2_extraction4_seq4_aliqu...	Snyder_PHA-4_GFP_YA_rep2 extraction4_seq4 channel_1	Snyder_PHA-4_GFP_YA_re...	OP37(official name : OP37 genotype : unc-119(ed3) III; wgIs37 unc-119(+) pha-4::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PHA-4::EGFP fusion protein is expressed in the correct pha-4 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PHA-4 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_PHA-4_GFP_YA_rep2 extraction4_seq4 channel_1|Young Adult	OP37(official name : O...	ChIP-Seq
SRX054209	SRA030935	Snyder_PHA-4_GFP_YA_rep2_extraction5_seq5_aliquote_1	Snyder_PHA-4_GFP_YA_rep2_extraction5_seq5_aliqu...	Snyder_PHA-4_GFP_YA_rep2 extraction5_seq5 channel_1	Snyder_PHA-4_GFP_YA_re...	OP37(official name : OP37 genotype : unc-119(ed3) III; wgIs37 unc-119(+) pha-4::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PHA-4::EGFP fusion protein is expressed in the correct pha-4 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PHA-4 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_PHA-4_GFP_YA_rep2 extraction5_seq5 channel_1|Young Adult	OP37(official name : O...	ChIP-Seq
SRX054210	SRA030935	Snyder_PHA-4_GFP_YA_rep1_extraction6_seq6_aliquote_1	Snyder_PHA-4_GFP_YA_rep1_extraction6_seq6_aliqu...	Snyder_PHA-4_GFP_YA_rep1 extraction6_seq6 channel_1	Snyder_PHA-4_GFP_YA_re...	OP37(official name : OP37 genotype : unc-119(ed3) III; wgIs37 unc-119(+) pha-4::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PHA-4::EGFP fusion protein is expressed in the correct pha-4 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PHA-4 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_PHA-4_GFP_YA_rep1 extraction6_seq6 channel_1|Young Adult	OP37(official name : O...	ChIP-Seq
SRX054211	SRA030935	Snyder_PHA-4_GFP_YA_rep1_extraction7_seq7_aliquote_1	Snyder_PHA-4_GFP_YA_rep1_extraction7_seq7_aliqu...	Snyder_PHA-4_GFP_YA_rep1 extraction7_seq7 channel_1	Snyder_PHA-4_GFP_YA_re...	OP37(official name : OP37 genotype : unc-119(ed3) III; wgIs37 unc-119(+) pha-4::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PHA-4::EGFP fusion protein is expressed in the correct pha-4 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PHA-4 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_PHA-4_GFP_YA_rep1 extraction7_seq7 channel_1|Young Adult	OP37(official name : O...	ChIP-Seq
SRX054248	SRA030936	Snyder_ALR-1_GFP_L2_rep2_extraction1_seq1_aliquote_1	Snyder_ALR-1_GFP_L2_rep2_extraction1_seq1_aliqu...	Snyder_ALR-1_GFP_L2_rep2 extraction1_seq1 channel_1	Snyder_ALR-1_GFP_L2_re...	OP200(official name : OP200 genotype : unc119(ed3); wgIs200(alr-1::TY1 EGFP FLAG C; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : his strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ALR-1::EGFP fusion protein is expressed in the correct alr-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ALR-1 transcription factor. made_by : R. Waterston )|Snyder_ALR-1_GFP_L2_rep2 extraction1_seq1 channel_1|L2	OP200(official name : ...	ChIP-Seq
SRX054249	SRA030936	Snyder_ALR-1_GFP_L2_rep1_extraction2_seq2_aliquote_1	Snyder_ALR-1_GFP_L2_rep1_extraction2_seq2_aliqu...	Snyder_ALR-1_GFP_L2_rep1 extraction2_seq2 channel_1	Snyder_ALR-1_GFP_L2_re...	OP200(official name : OP200 genotype : unc119(ed3); wgIs200(alr-1::TY1 EGFP FLAG C; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : his strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ALR-1::EGFP fusion protein is expressed in the correct alr-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ALR-1 transcription factor. made_by : R. Waterston )|Snyder_ALR-1_GFP_L2_rep1 extraction2_seq2 channel_1|L2	OP200(official name : ...	ChIP-Seq
SRX054250	SRA030936	Snyder_ALR-1_GFP_L2_rep1_extraction3_seq3_aliquote_1	Snyder_ALR-1_GFP_L2_rep1_extraction3_seq3_aliqu...	Snyder_ALR-1_GFP_L2_rep1 extraction3_seq3 channel_1	Snyder_ALR-1_GFP_L2_re...	OP200(official name : OP200 genotype : unc119(ed3); wgIs200(alr-1::TY1 EGFP FLAG C; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : his strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ALR-1::EGFP fusion protein is expressed in the correct alr-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ALR-1 transcription factor. made_by : R. Waterston )|Snyder_ALR-1_GFP_L2_rep1 extraction3_seq3 channel_1|L2	OP200(official name : ...	ChIP-Seq
SRX054251	SRA030936	Snyder_ALR-1_GFP_L2_rep1_extraction4_seq4_aliquote_1	Snyder_ALR-1_GFP_L2_rep1_extraction4_seq4_aliqu...	Snyder_ALR-1_GFP_L2_rep1 extraction4_seq4 channel_1	Snyder_ALR-1_GFP_L2_re...	OP200(official name : OP200 genotype : unc119(ed3); wgIs200(alr-1::TY1 EGFP FLAG C; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : his strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ALR-1::EGFP fusion protein is expressed in the correct alr-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ALR-1 transcription factor. made_by : R. Waterston )|Snyder_ALR-1_GFP_L2_rep1 extraction4_seq4 channel_1|L2	OP200(official name : ...	ChIP-Seq
SRX054252	SRA030936	Snyder_ALR-1_GFP_L2_rep1_extraction5_seq5_aliquote_1	Snyder_ALR-1_GFP_L2_rep1_extraction5_seq5_aliqu...	Snyder_ALR-1_GFP_L2_rep1 extraction5_seq5 channel_1	Snyder_ALR-1_GFP_L2_re...	OP200(official name : OP200 genotype : unc119(ed3); wgIs200(alr-1::TY1 EGFP FLAG C; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : his strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ALR-1::EGFP fusion protein is expressed in the correct alr-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ALR-1 transcription factor. made_by : R. Waterston )|Snyder_ALR-1_GFP_L2_rep1 extraction5_seq5 channel_1|L2	OP200(official name : ...	ChIP-Seq
SRX054253	SRA030937	Snyder_PHA-4_GFP_L2_rep2_extraction1_seq1_aliquote_1	Snyder_PHA-4_GFP_L2_rep2_extraction1_seq1_aliqu...	Snyder_PHA-4_GFP_L2_rep2 extraction1_seq1 channel_1	Snyder_PHA-4_GFP_L2_re...	OP37(official name : OP37 genotype : unc-119(ed3) III; wgIs37 unc-119(+) pha-4::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PHA-4::EGFP fusion protein is expressed in the correct pha-4 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PHA-4 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_PHA-4_GFP_L2_rep2 extraction1_seq1 channel_1|L2	OP37(official name : O...	ChIP-Seq
SRX054254	SRA030937	Snyder_PHA-4_GFP_L2_rep2_extraction2_seq2_aliquote_1	Snyder_PHA-4_GFP_L2_rep2_extraction2_seq2_aliqu...	Snyder_PHA-4_GFP_L2_rep2 extraction2_seq2 channel_1	Snyder_PHA-4_GFP_L2_re...	OP37(official name : OP37 genotype : unc-119(ed3) III; wgIs37 unc-119(+) pha-4::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PHA-4::EGFP fusion protein is expressed in the correct pha-4 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PHA-4 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_PHA-4_GFP_L2_rep2 extraction2_seq2 channel_1|L2	OP37(official name : O...	ChIP-Seq
SRX054255	SRA030937	Snyder_PHA-4_GFP_L2_rep1_extraction3_seq3_aliquote_1	Snyder_PHA-4_GFP_L2_rep1_extraction3_seq3_aliqu...	Snyder_PHA-4_GFP_L2_rep1 extraction3_seq3 channel_1	Snyder_PHA-4_GFP_L2_re...	OP37(official name : OP37 genotype : unc-119(ed3) III; wgIs37 unc-119(+) pha-4::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PHA-4::EGFP fusion protein is expressed in the correct pha-4 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PHA-4 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_PHA-4_GFP_L2_rep1 extraction3_seq3 channel_1|L2	OP37(official name : O...	ChIP-Seq
SRX054256	SRA030937	Snyder_PHA-4_GFP_L2_rep1_extraction4_seq4_aliquote_1	Snyder_PHA-4_GFP_L2_rep1_extraction4_seq4_aliqu...	Snyder_PHA-4_GFP_L2_rep1 extraction4_seq4 channel_1	Snyder_PHA-4_GFP_L2_re...	OP37(official name : OP37 genotype : unc-119(ed3) III; wgIs37 unc-119(+) pha-4::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PHA-4::EGFP fusion protein is expressed in the correct pha-4 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PHA-4 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_PHA-4_GFP_L2_rep1 extraction4_seq4 channel_1|L2	OP37(official name : O...	ChIP-Seq
SRX054257	SRA030937	Snyder_PHA-4_GFP_L2_rep1_extraction5_seq5_aliquote_1	Snyder_PHA-4_GFP_L2_rep1_extraction5_seq5_aliqu...	Snyder_PHA-4_GFP_L2_rep1 extraction5_seq5 channel_1	Snyder_PHA-4_GFP_L2_re...	OP37(official name : OP37 genotype : unc-119(ed3) III; wgIs37 unc-119(+) pha-4::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PHA-4::EGFP fusion protein is expressed in the correct pha-4 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PHA-4 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_PHA-4_GFP_L2_rep1 extraction5_seq5 channel_1|L2	OP37(official name : O...	ChIP-Seq
SRX054258	SRA030938	Snyder_PES-1_GFP_L4_rep1_extraction1_seq1_aliquote_1	Snyder_PES-1_GFP_L4_rep1_extraction1_seq1_aliqu...	Snyder_PES-1_GFP_L4_rep1 extraction1_seq1 channel_1	Snyder_PES-1_GFP_L4_re...	OP87(official name : OP87 genotype : unc-119(ed3) III; wgIs87 unc-119(+) pes-1::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PES-1::EGFP fusion protein is expressed in the correct pes-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PES-1 transcription factor. made_by : R. Waterston )|Snyder_PES-1_GFP_L4_rep1 extraction1_seq1 channel_1|L4	OP87(official name : O...	ChIP-Seq
SRX054259	SRA030938	Snyder_PES-1_GFP_L4_rep1_extraction2_seq2_aliquote_1	Snyder_PES-1_GFP_L4_rep1_extraction2_seq2_aliqu...	Snyder_PES-1_GFP_L4_rep1 extraction2_seq2 channel_1	Snyder_PES-1_GFP_L4_re...	OP87(official name : OP87 genotype : unc-119(ed3) III; wgIs87 unc-119(+) pes-1::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PES-1::EGFP fusion protein is expressed in the correct pes-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PES-1 transcription factor. made_by : R. Waterston )|Snyder_PES-1_GFP_L4_rep1 extraction2_seq2 channel_1|L4	OP87(official name : O...	ChIP-Seq
SRX054260	SRA030938	Snyder_PES-1_GFP_L4_rep1_extraction3_seq3_aliquote_1	Snyder_PES-1_GFP_L4_rep1_extraction3_seq3_aliqu...	Snyder_PES-1_GFP_L4_rep1 extraction3_seq3 channel_1	Snyder_PES-1_GFP_L4_re...	OP87(official name : OP87 genotype : unc-119(ed3) III; wgIs87 unc-119(+) pes-1::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PES-1::EGFP fusion protein is expressed in the correct pes-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PES-1 transcription factor. made_by : R. Waterston )|Snyder_PES-1_GFP_L4_rep1 extraction3_seq3 channel_1|L4	OP87(official name : O...	ChIP-Seq
SRX054261	SRA030938	Snyder_PES-1_GFP_L4_rep1_extraction4_seq4_aliquote_1	Snyder_PES-1_GFP_L4_rep1_extraction4_seq4_aliqu...	Snyder_PES-1_GFP_L4_rep1 extraction4_seq4 channel_1	Snyder_PES-1_GFP_L4_re...	OP87(official name : OP87 genotype : unc-119(ed3) III; wgIs87 unc-119(+) pes-1::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PES-1::EGFP fusion protein is expressed in the correct pes-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PES-1 transcription factor. made_by : R. Waterston )|Snyder_PES-1_GFP_L4_rep1 extraction4_seq4 channel_1|L4	OP87(official name : O...	ChIP-Seq
SRX054262	SRA030938	Snyder_PES-1_GFP_L4_rep1_extraction5_seq5_aliquote_1	Snyder_PES-1_GFP_L4_rep1_extraction5_seq5_aliqu...	Snyder_PES-1_GFP_L4_rep1 extraction5_seq5 channel_1	Snyder_PES-1_GFP_L4_re...	OP87(official name : OP87 genotype : unc-119(ed3) III; wgIs87 unc-119(+) pes-1::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PES-1::EGFP fusion protein is expressed in the correct pes-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PES-1 transcription factor. made_by : R. Waterston )|Snyder_PES-1_GFP_L4_rep1 extraction5_seq5 channel_1|L4	OP87(official name : O...	ChIP-Seq
SRX054263	SRA030938	Snyder_PES-1_GFP_L4_rep1_extraction6_seq6_aliquote_1	Snyder_PES-1_GFP_L4_rep1_extraction6_seq6_aliqu...	Snyder_PES-1_GFP_L4_rep1 extraction6_seq6 channel_1	Snyder_PES-1_GFP_L4_re...	OP87(official name : OP87 genotype : unc-119(ed3) III; wgIs87 unc-119(+) pes-1::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PES-1::EGFP fusion protein is expressed in the correct pes-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PES-1 transcription factor. made_by : R. Waterston )|Snyder_PES-1_GFP_L4_rep1 extraction6_seq6 channel_1|L4	OP87(official name : O...	ChIP-Seq
SRX054264	SRA030938	Snyder_PES-1_GFP_L4_rep2_extraction7_seq7_aliquote_1	Snyder_PES-1_GFP_L4_rep2_extraction7_seq7_aliqu...	Snyder_PES-1_GFP_L4_rep2 extraction7_seq7 channel_1	Snyder_PES-1_GFP_L4_re...	OP87(official name : OP87 genotype : unc-119(ed3) III; wgIs87 unc-119(+) pes-1::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PES-1::EGFP fusion protein is expressed in the correct pes-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PES-1 transcription factor. made_by : R. Waterston )|Snyder_PES-1_GFP_L4_rep2 extraction7_seq7 channel_1|L4	OP87(official name : O...	ChIP-Seq
SRX054265	SRA030938	Snyder_PES-1_GFP_L4_rep2_extraction8_seq8_aliquote_1	Snyder_PES-1_GFP_L4_rep2_extraction8_seq8_aliqu...	Snyder_PES-1_GFP_L4_rep2 extraction8_seq8 channel_1	Snyder_PES-1_GFP_L4_re...	OP87(official name : OP87 genotype : unc-119(ed3) III; wgIs87 unc-119(+) pes-1::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PES-1::EGFP fusion protein is expressed in the correct pes-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PES-1 transcription factor. made_by : R. Waterston )|Snyder_PES-1_GFP_L4_rep2 extraction8_seq8 channel_1|L4	OP87(official name : O...	ChIP-Seq
SRX054266	SRA030938	Snyder_PES-1_GFP_L4_rep2_extraction9_seq9_aliquote_1	Snyder_PES-1_GFP_L4_rep2_extraction9_seq9_aliqu...	Snyder_PES-1_GFP_L4_rep2 extraction9_seq9 channel_1	Snyder_PES-1_GFP_L4_re...	OP87(official name : OP87 genotype : unc-119(ed3) III; wgIs87 unc-119(+) pes-1::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PES-1::EGFP fusion protein is expressed in the correct pes-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PES-1 transcription factor. made_by : R. Waterston )|Snyder_PES-1_GFP_L4_rep2 extraction9_seq9 channel_1|L4	OP87(official name : O...	ChIP-Seq
SRX054303	SRA030939	Snyder_EGL-5_GFP_L3_rep2_extraction1_seq1_aliquote_1	Snyder_EGL-5_GFP_L3_rep2_extraction1_seq1_aliqu...	Snyder_EGL-5_GFP_L3_rep2 extraction1_seq1 channel_1	Snyder_EGL-5_GFP_L3_re...	OP54(official name : OP54 genotype : unc-119(ed3) III; wgIs54 unc-119(+) egl-5::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The EGL-5::EGFP fusion protein is expressed in the correct egl-5 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the EGL-5 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_EGL-5_GFP_L3_rep2 extraction1_seq1 channel_1|L3	OP54(official name : O...	ChIP-Seq
SRX054304	SRA030939	Snyder_EGL-5_GFP_L3_rep2_extraction2_seq2_aliquote_1	Snyder_EGL-5_GFP_L3_rep2_extraction2_seq2_aliqu...	Snyder_EGL-5_GFP_L3_rep2 extraction2_seq2 channel_1	Snyder_EGL-5_GFP_L3_re...	OP54(official name : OP54 genotype : unc-119(ed3) III; wgIs54 unc-119(+) egl-5::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The EGL-5::EGFP fusion protein is expressed in the correct egl-5 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the EGL-5 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_EGL-5_GFP_L3_rep2 extraction2_seq2 channel_1|L3	OP54(official name : O...	ChIP-Seq
SRX054305	SRA030939	Snyder_EGL-5_GFP_L3_rep2_extraction3_seq3_aliquote_1	Snyder_EGL-5_GFP_L3_rep2_extraction3_seq3_aliqu...	Snyder_EGL-5_GFP_L3_rep2 extraction3_seq3 channel_1	Snyder_EGL-5_GFP_L3_re...	OP54(official name : OP54 genotype : unc-119(ed3) III; wgIs54 unc-119(+) egl-5::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The EGL-5::EGFP fusion protein is expressed in the correct egl-5 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the EGL-5 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_EGL-5_GFP_L3_rep2 extraction3_seq3 channel_1|L3	OP54(official name : O...	ChIP-Seq
SRX054306	SRA030939	Snyder_EGL-5_GFP_L3_rep2_extraction4_seq4_aliquote_1	Snyder_EGL-5_GFP_L3_rep2_extraction4_seq4_aliqu...	Snyder_EGL-5_GFP_L3_rep2 extraction4_seq4 channel_1	Snyder_EGL-5_GFP_L3_re...	OP54(official name : OP54 genotype : unc-119(ed3) III; wgIs54 unc-119(+) egl-5::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The EGL-5::EGFP fusion protein is expressed in the correct egl-5 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the EGL-5 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_EGL-5_GFP_L3_rep2 extraction4_seq4 channel_1|L3	OP54(official name : O...	ChIP-Seq
SRX054307	SRA030939	Snyder_EGL-5_GFP_L3_rep2_extraction5_seq5_aliquote_1	Snyder_EGL-5_GFP_L3_rep2_extraction5_seq5_aliqu...	Snyder_EGL-5_GFP_L3_rep2 extraction5_seq5 channel_1	Snyder_EGL-5_GFP_L3_re...	OP54(official name : OP54 genotype : unc-119(ed3) III; wgIs54 unc-119(+) egl-5::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The EGL-5::EGFP fusion protein is expressed in the correct egl-5 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the EGL-5 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_EGL-5_GFP_L3_rep2 extraction5_seq5 channel_1|L3	OP54(official name : O...	ChIP-Seq
SRX054308	SRA030939	Snyder_EGL-5_GFP_L3_rep1_extraction6_seq6_aliquote_1	Snyder_EGL-5_GFP_L3_rep1_extraction6_seq6_aliqu...	Snyder_EGL-5_GFP_L3_rep1 extraction6_seq6 channel_1	Snyder_EGL-5_GFP_L3_re...	OP54(official name : OP54 genotype : unc-119(ed3) III; wgIs54 unc-119(+) egl-5::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The EGL-5::EGFP fusion protein is expressed in the correct egl-5 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the EGL-5 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_EGL-5_GFP_L3_rep1 extraction6_seq6 channel_1|L3	OP54(official name : O...	ChIP-Seq
SRX054309	SRA030939	Snyder_EGL-5_GFP_L3_rep1_extraction7_seq7_aliquote_1	Snyder_EGL-5_GFP_L3_rep1_extraction7_seq7_aliqu...	Snyder_EGL-5_GFP_L3_rep1 extraction7_seq7 channel_1	Snyder_EGL-5_GFP_L3_re...	OP54(official name : OP54 genotype : unc-119(ed3) III; wgIs54 unc-119(+) egl-5::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The EGL-5::EGFP fusion protein is expressed in the correct egl-5 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the EGL-5 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_EGL-5_GFP_L3_rep1 extraction7_seq7 channel_1|L3	OP54(official name : O...	ChIP-Seq
SRX054310	SRA030939	Snyder_EGL-5_GFP_L3_rep2_extraction8_seq8_aliquote_1	Snyder_EGL-5_GFP_L3_rep2_extraction8_seq8_aliqu...	Snyder_EGL-5_GFP_L3_rep2 extraction8_seq8 channel_1	Snyder_EGL-5_GFP_L3_re...	OP54(official name : OP54 genotype : unc-119(ed3) III; wgIs54 unc-119(+) egl-5::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The EGL-5::EGFP fusion protein is expressed in the correct egl-5 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the EGL-5 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_EGL-5_GFP_L3_rep2 extraction8_seq8 channel_1|L3	OP54(official name : O...	ChIP-Seq
SRX054311	SRA030939	Snyder_EGL-5_GFP_L3_rep2_extraction9_seq9_aliquote_1	Snyder_EGL-5_GFP_L3_rep2_extraction9_seq9_aliqu...	Snyder_EGL-5_GFP_L3_rep2 extraction9_seq9 channel_1	Snyder_EGL-5_GFP_L3_re...	OP54(official name : OP54 genotype : unc-119(ed3) III; wgIs54 unc-119(+) egl-5::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The EGL-5::EGFP fusion protein is expressed in the correct egl-5 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the EGL-5 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_EGL-5_GFP_L3_rep2 extraction9_seq9 channel_1|L3	OP54(official name : O...	ChIP-Seq
SRX059220	SRA035910	seq-NA_N2_L3_1_mE1_input_DNA	seq-NA_N2_L3_1_mE1_input_DNA	Control sample from L3 stage N2 worms, whole body	Control sample from L3...	N2|Control sample from L3 stage N2 worms, whole body|whole body|L3	N2	ChIP-Seq
SRX059221	SRA035910	seq-NA_N2_L3_3_input_DNA	seq-NA_N2_L3_3_input_DNA	Control sample from L3 stage N2 worms, whole body	Control sample from L3...	N2|Control sample from L3 stage N2 worms, whole body|whole body|L3	N2	ChIP-Seq
SRX059222	SRA035910	seq-NA_N2_L3_IL-1_input_DNA	seq-NA_N2_L3_IL-1_input_DNA	Control sample from L3 stage N2 worms, whole body	Control sample from L3...	N2|Control sample from L3 stage N2 worms, whole body|whole body|L3	N2	ChIP-Seq
SRX059223	SRA035910	seq-AB1791_H3_N2_L3_1	seq-AB1791_H3_N2_L3_1	AB1791_H3|whole body	AB1791_H3	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059224	SRA035910	seq-AB1791_H3_N2_L3_2	seq-AB1791_H3_N2_L3_2	AB1791_H3|whole body	AB1791_H3	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059225	SRA035910	seq-AB1791_H3_N2_L3_7	seq-AB1791_H3_N2_L3_7	AB1791_H3|whole body	AB1791_H3	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059226	SRA035912	seq-BH00001_LIN52_N2_L3_1	seq-BH00001_LIN52_N2_L3_1	BH00001 LIN52|whole body	BH00001 LIN52	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059227	SRA035912	seq-BH00001_LIN52_N2_L3_2	seq-BH00001_LIN52_N2_L3_2	BH00001 LIN52|whole body	BH00001 LIN52	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059228	SRA035911	seq-AR0144_H3_144_N2_L3_1	seq-AR0144_H3_144_N2_L3_1	AR0144_H3:144|whole body	AR0144_H3:144	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059229	SRA035911	seq-AR0144_H3_144_N2_L3_2	seq-AR0144_H3_144_N2_L3_2	AR0144_H3:144|whole body	AR0144_H3:144	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059230	SRA035913	seq-BH00003_LIN37_N2_L3_1	seq-BH00003_LIN37_N2_L3_1	BH00003 LIN37|whole body	BH00003 LIN37	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059231	SRA035913	seq-BH00003_LIN37_N2_L3_2	seq-BH00003_LIN37_N2_L3_2	BH00003 LIN37|whole body	BH00003 LIN37	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059232	SRA035914	seq-BH00004_LIN54_N2_L3_1	seq-BH00004_LIN54_N2_L3_1	BH00004_LIN54|whole body	BH00004_LIN54	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059233	SRA035914	seq-BH00004_LIN54_N2_L3_2	seq-BH00004_LIN54_N2_L3_2	BH00004_LIN54|whole body	BH00004_LIN54	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059234	SRA035915	seq-BH00005_LIN9_N2_L3_1	seq-BH00005_LIN9_N2_L3_1	BH00005 LIN9|whole body	BH00005 LIN9	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059235	SRA035915	seq-BH00005_LIN9_N2_L3_2	seq-BH00005_LIN9_N2_L3_2	BH00005 LIN9|whole body	BH00005 LIN9	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059236	SRA035916	seq-NA_N2_L3_IL-2_input_DNA	seq-NA_N2_L3_IL-2_input_DNA	Control sample from L3 stage N2 worms, whole body	Control sample from L3...	N2|Control sample from L3 stage N2 worms, whole body|whole body|L3	N2	ChIP-Seq
SRX059237	SRA035916	seq-JA00001_HTZ1_N2_L3_2	seq-JA00001_HTZ1_N2_L3_2	JA00001 HTZ1|whole body	JA00001 HTZ1	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059238	SRA035916	seq-JA00001_HTZ1_N2_L3_3	seq-JA00001_HTZ1_N2_L3_3	JA00001 HTZ1|whole body	JA00001 HTZ1	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059239	SRA035916	seq-BK00001_HTZ1_N2_L3_1	seq-BK00001_HTZ1_N2_L3_1	BK00001 HTZ1|whole body	BK00001 HTZ1	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059240	SRA035917	seq-JA00011_LIN35_N2_L3_2	seq-JA00011_LIN35_N2_L3_2	JA00011 LIN35|whole body	JA00011 LIN35	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059241	SRA035917	seq-JA00011_LIN35_N2_L3_4	seq-JA00011_LIN35_N2_L3_4	JA00011 LIN35|whole body	JA00011 LIN35	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059242	SRA035918	seq-JL00002_SDC3_N2_L3_2	seq-JL00002_SDC3_N2_L3_2	JL00002 SDC3|whole body	JL00002 SDC3	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059243	SRA035918	seq-JL00002_SDC3_N2_L3_3	seq-JL00002_SDC3_N2_L3_3	JL00002 SDC3|whole body	JL00002 SDC3	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059244	SRA035919	seq-LPAR109_H4tetraac_109_N2_L3_1	seq-LPAR109_H4tetraac_109_N2_L3_1	LPAR109 H4tetraac:109|whole body	LPAR109 H4tetraac:109	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059245	SRA035919	seq-LPAR109_H4tetraac_109_N2_L3_2	seq-LPAR109_H4tetraac_109_N2_L3_2	LPAR109 H4tetraac:109|whole body	LPAR109 H4tetraac:109	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059246	SRA035920	seq-SDQ0820_EPC1_N2_L3_1_EGS	seq-SDQ0820_EPC1_N2_L3_1_EGS	SDQ0820 EPC1|whole body	SDQ0820 EPC1	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059247	SRA035920	seq-NA_N2_L3_1_N2.2PK-EGS_input_DNA	seq-NA_N2_L3_1_N2.2PK-EGS_input_DNA	whole body	whole body	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059248	SRA035920	seq-SDQ0820_EPC1_N2_L3_2_EGS	seq-SDQ0820_EPC1_N2_L3_2_EGS	SDQ0820 EPC1|whole body	SDQ0820 EPC1	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059249	SRA035920	seq-NA_N2_L3_1_N2.3PK-EGS_input_DNA	seq-NA_N2_L3_1_N2.3PK-EGS_input_DNA	whole body	whole body	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059250	SRA035921	seq-SDQ2370_LIN53_N2_L3_1	seq-SDQ2370_LIN53_N2_L3_1	SDQ2370 LIN53|whole body	SDQ2370 LIN53	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059251	SRA035921	seq-SDQ2370_LIN53_N2_L3_2	seq-SDQ2370_LIN53_N2_L3_2	SDQ2370 LIN53|whole body	SDQ2370 LIN53	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059252	SRA035922	seq-SDQ3590_EFL1_N2_L3_1	seq-SDQ3590_EFL1_N2_L3_1	SDQ3590 EFL1|whole body	SDQ3590 EFL1	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059253	SRA035922	seq-SDQ3590_EFL1_N2_L3_2	seq-SDQ3590_EFL1_N2_L3_2	SDQ3590 EFL1|whole body	SDQ3590 EFL1	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059254	SRA035923	seq-WA30534819_H3K4me3_N2_L3_1	seq-WA30534819_H3K4me3_N2_L3_1	WA30534819 H3K4me3|whole body	WA30534819 H3K4me3	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059255	SRA035923	seq-WA30534819_H3K4me3_N2_L3_2	seq-WA30534819_H3K4me3_N2_L3_2	WA30534819 H3K4me3|whole body	WA30534819 H3K4me3	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059256	SRA035924	seq-SDQ3599_DPL1_N2_L3_1	seq-SDQ3599_DPL1_N2_L3_1	SDQ3599 DPL1|whole body	SDQ3599 DPL1	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059257	SRA035924	seq-SDQ3599_DPL1_N2_L3_2	seq-SDQ3599_DPL1_N2_L3_2	SDQ3599 DPL1|whole body	SDQ3599 DPL1	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059264	SRA035926	seq-WA30932379_H3K9ac_N2_L3_1	seq-WA30932379_H3K9ac_N2_L3_1	WA30932379 H3K9ac|whole body	WA30932379 H3K9ac	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059265	SRA035926	seq-WA30932379_H3K9ac_N2_L3_2	seq-WA30932379_H3K9ac_N2_L3_2	WA30932379 H3K9ac|whole body	WA30932379 H3K9ac	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059266	SRA035927	seq-NA_N2_MXemb_6_EE8_input_DNA	seq-NA_N2_MXemb_6_EE8_input_DNA	Control sample from mixed embryo N2 worms, whole body	Control sample from mi...	N2|Control sample from mixed embryo N2 worms, whole body|whole body|mixed stages	N2	ChIP-Seq
SRX059267	SRA035927	seq-SDQ4470_TAG315_N2_MXemb_1_A_EE8_KI032	seq-SDQ4470_TAG315_N2_MXemb_1_A_EE8_KI032	SDQ4470 TAG315|whole body	SDQ4470 TAG315	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059268	SRA035927	seq-SDQ4470_TAG315_N2_MXemb_2_A_EE9_KI033	seq-SDQ4470_TAG315_N2_MXemb_2_A_EE9_KI033	SDQ4470 TAG315|whole body	SDQ4470 TAG315	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059269	SRA035928	seq-SDQ4526_SFC1_N2_MXemb_1_A_EE8_KI034	seq-SDQ4526_SFC1_N2_MXemb_1_A_EE8_KI034	SDQ4526 SFC1|whole body	SDQ4526 SFC1	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059270	SRA035928	seq-SDQ4526_SFC1_N2_MXemb_2_A_EE9_KI035	seq-SDQ4526_SFC1_N2_MXemb_2_A_EE9_KI035	SDQ4526 SFC1|whole body	SDQ4526 SFC1	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059271	SRA035929	seq-SDQ4663_RPC1_N2_MXemb_1_A_EE8	seq-SDQ4663_RPC1_N2_MXemb_1_A_EE8	SDQ4663_RPC1|whole body	SDQ4663_RPC1	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059272	SRA035929	seq-SDQ4663_RPC1_N2_MXemb_2_A_EE9_KI031	seq-SDQ4663_RPC1_N2_MXemb_2_A_EE9_KI031	SDQ4663_RPC1|whole body	SDQ4663_RPC1	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059273	SRA035930	seq-WA30534819_H3K4me3_N2_MXemb_1	seq-WA30534819_H3K4me3_N2_MXemb_1	WA30534819 H3K4me3|whole body	WA30534819 H3K4me3	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX059274	SRA035930	seq-WA30534819_H3K4me3_N2_MXemb_2	seq-WA30534819_H3K4me3_N2_MXemb_2	WA30534819 H3K4me3|whole body	WA30534819 H3K4me3	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX060162	SRA035916	seq-NA_N2_L3_1_mE5_input_DNA	seq-NA_N2_L3_1_mE5_input_DNA	Control sample from L3 stage N2 worms, whole body	Control sample from L3...	N2|Control sample from L3 stage N2 worms, whole body|whole body|L3	N2	ChIP-Seq
SRX060164	SRA035918	seq-NA_N2_L3_1_mE6_input_DNA	seq-NA_N2_L3_1_mE6_input_DNA	Control sample from L3 stage N2 worms, whole body	Control sample from L3...	N2|Control sample from L3 stage N2 worms, whole body|whole body|L3	N2	ChIP-Seq
SRX060165	SRA035912	seq-NA_N2_L3_2_input_DNA	seq-NA_N2_L3_2_input_DNA	Control sample from L3 stage N2 worms, whole body	Control sample from L3...	N2|Control sample from L3 stage N2 worms, whole body|whole body|L3	N2	ChIP-Seq
SRX063957	SRA036920	H3K4me3	H3K4me3	H3K4me3|L3 embyros	H3K4me3	N2|L3 embyros|L3	N2	ChIP-Seq
SRX063958	SRA036920	H3K9me3	H3K9me3	H3K9me3|L3 embyros	H3K9me3	N2|L3 embyros|L3	N2	ChIP-Seq
SRX063959	SRA036920	H3K36me3	H3K36me3	H3K36me3|L3 embyros	H3K36me3	N2|L3 embyros|L3	N2	ChIP-Seq
SRX063960	SRA036920	DPY-27	DPY-27	DPY-27|L3 embyros	DPY-27	N2|L3 embyros|L3	N2	ChIP-Seq
SRX063961	SRA036920	Input_control_3	Input_control_3	none|L3 embyros	none	N2|L3 embyros|L3	N2	ChIP-Seq
SRX063962	SRA036920	Input_control_4	Input_control_4	none|L3 embyros	none	N2|L3 embyros|L3	N2	ChIP-Seq
SRX065622	SRA037203	Snyder_TLP-1_Input_L1_extraction1_seq1_aliquote_1	Snyder_TLP-1_Input_L1_extraction1_seq1_aliquote_1	Snyder_TLP-1_Input_L1 extraction1_seq1 channel_1	Snyder_TLP-1_Input_L1 ...	OP321(official name : TLP-1 genotype : unc119(ed3); wgIs321(tlp-1::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of TLP-1::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the TLP-1 transcription factor. made_by : Bob Waterston's lab from UW )|Snyder_TLP-1_Input_L1 extraction1_seq1 channel_1|fed L1	OP321(official name : ...	ChIP-Seq
SRX065623	SRA037203	Snyder_TLP-1_Input_L1_extraction2_seq2_aliquote_1	Snyder_TLP-1_Input_L1_extraction2_seq2_aliquote_1	Snyder_TLP-1_Input_L1 extraction2_seq2 channel_1	Snyder_TLP-1_Input_L1 ...	OP321(official name : TLP-1 genotype : unc119(ed3); wgIs321(tlp-1::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of TLP-1::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the TLP-1 transcription factor. made_by : Bob Waterston's lab from UW )|Snyder_TLP-1_Input_L1 extraction2_seq2 channel_1|fed L1	OP321(official name : ...	ChIP-Seq
SRX065624	SRA037203	Snyder_TLP-1_GFP_L1_rep1_extraction3_seq3_aliquote_1	Snyder_TLP-1_GFP_L1_rep1_extraction3_seq3_aliqu...	Snyder_TLP-1_GFP_L1_rep1 extraction3_seq3 channel_1	Snyder_TLP-1_GFP_L1_re...	OP321(official name : TLP-1 genotype : unc119(ed3); wgIs321(tlp-1::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of TLP-1::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the TLP-1 transcription factor. made_by : Bob Waterston's lab from UW )|Snyder_TLP-1_GFP_L1_rep1 extraction3_seq3 channel_1|fed L1	OP321(official name : ...	ChIP-Seq
SRX065625	SRA037203	Snyder_TLP-1_GFP_L1_rep2_extraction4_seq4_aliquote_1	Snyder_TLP-1_GFP_L1_rep2_extraction4_seq4_aliqu...	Snyder_TLP-1_GFP_L1_rep2 extraction4_seq4 channel_1	Snyder_TLP-1_GFP_L1_re...	OP321(official name : TLP-1 genotype : unc119(ed3); wgIs321(tlp-1::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of TLP-1::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the TLP-1 transcription factor. made_by : Bob Waterston's lab from UW )|Snyder_TLP-1_GFP_L1_rep2 extraction4_seq4 channel_1|fed L1	OP321(official name : ...	ChIP-Seq
SRX065626	SRA037204	Snyder_PHA-4_Input_L3_extraction1_seq1_aliquote_1	Snyder_PHA-4_Input_L3_extraction1_seq1_aliquote_1	Snyder_PHA-4_Input_L3 extraction1_seq1 channel_1	Snyder_PHA-4_Input_L3 ...	OP37(official name : OP37 genotype : unc-119(ed3) III; wgIs37 unc-119(+) pha-4::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PHA-4::EGFP fusion protein is expressed in the correct pha-4 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PHA-4 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_PHA-4_Input_L3 extraction1_seq1 channel_1|L3	OP37(official name : O...	ChIP-Seq
SRX065627	SRA037204	Snyder_PHA-4_Input_L3_extraction2_seq2_aliquote_1	Snyder_PHA-4_Input_L3_extraction2_seq2_aliquote_1	Snyder_PHA-4_Input_L3 extraction2_seq2 channel_1	Snyder_PHA-4_Input_L3 ...	OP37(official name : OP37 genotype : unc-119(ed3) III; wgIs37 unc-119(+) pha-4::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PHA-4::EGFP fusion protein is expressed in the correct pha-4 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PHA-4 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_PHA-4_Input_L3 extraction2_seq2 channel_1|L3	OP37(official name : O...	ChIP-Seq
SRX065628	SRA037204	Snyder_PHA-4_GFP_L3_rep1_extraction3_seq3_aliquote_1	Snyder_PHA-4_GFP_L3_rep1_extraction3_seq3_aliqu...	Snyder_PHA-4_GFP_L3_rep1 extraction3_seq3 channel_1	Snyder_PHA-4_GFP_L3_re...	OP37(official name : OP37 genotype : unc-119(ed3) III; wgIs37 unc-119(+) pha-4::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PHA-4::EGFP fusion protein is expressed in the correct pha-4 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PHA-4 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_PHA-4_GFP_L3_rep1 extraction3_seq3 channel_1|L3	OP37(official name : O...	ChIP-Seq
SRX065629	SRA037204	Snyder_PHA-4_GFP_L3_rep2_extraction4_seq4_aliquote_1	Snyder_PHA-4_GFP_L3_rep2_extraction4_seq4_aliqu...	Snyder_PHA-4_GFP_L3_rep2 extraction4_seq4 channel_1	Snyder_PHA-4_GFP_L3_re...	OP37(official name : OP37 genotype : unc-119(ed3) III; wgIs37 unc-119(+) pha-4::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PHA-4::EGFP fusion protein is expressed in the correct pha-4 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PHA-4 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_PHA-4_GFP_L3_rep2 extraction4_seq4 channel_1|L3	OP37(official name : O...	ChIP-Seq
SRX065630	SRA037205	Snyder_W03F9.2_Input_YA_extraction1_seq1_aliquote_1	Snyder_W03F9.2_Input_YA_extraction1_seq1_aliquo...	Snyder_W03F9.2_Input_YA extraction1_seq1 channel_1	Snyder_W03F9.2_Input_Y...	OP215(official name : OP215 genotype : unc119(ed3); wgIs215(W03F9.2::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The W03F9.2::EGFP fusion protein is mainly expressed in germline cells. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the W03F9.2 transcription factor. made_by : Tony Hyman's lab from MPI-CBG )|Snyder_W03F9.2_Input_YA extraction1_seq1 channel_1|L4-Young Adult	OP215(official name : ...	ChIP-Seq
SRX065631	SRA037205	Snyder_W03F9.2_Input_YA_extraction2_seq2_aliquote_1	Snyder_W03F9.2_Input_YA_extraction2_seq2_aliquo...	Snyder_W03F9.2_Input_YA extraction2_seq2 channel_1	Snyder_W03F9.2_Input_Y...	OP215(official name : OP215 genotype : unc119(ed3); wgIs215(W03F9.2::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The W03F9.2::EGFP fusion protein is mainly expressed in germline cells. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the W03F9.2 transcription factor. made_by : Tony Hyman's lab from MPI-CBG )|Snyder_W03F9.2_Input_YA extraction2_seq2 channel_1|L4-Young Adult	OP215(official name : ...	ChIP-Seq
SRX065632	SRA037205	Snyder_W03F9.2_GFP_YA_rep1_extraction3_seq3_aliquote_1	Snyder_W03F9.2_GFP_YA_rep1_extraction3_seq3_ali...	Snyder_W03F9.2_GFP_YA_rep1 extraction3_seq3 channel_1	Snyder_W03F9.2_GFP_YA_...	OP215(official name : OP215 genotype : unc119(ed3); wgIs215(W03F9.2::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The W03F9.2::EGFP fusion protein is mainly expressed in germline cells. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the W03F9.2 transcription factor. made_by : Tony Hyman's lab from MPI-CBG )|Snyder_W03F9.2_GFP_YA_rep1 extraction3_seq3 channel_1|L4-Young Adult	OP215(official name : ...	ChIP-Seq
SRX065633	SRA037205	Snyder_W03F9.2_GFP_YA_rep2_extraction4_seq4_aliquote_1	Snyder_W03F9.2_GFP_YA_rep2_extraction4_seq4_ali...	Snyder_W03F9.2_GFP_YA_rep2 extraction4_seq4 channel_1	Snyder_W03F9.2_GFP_YA_...	OP215(official name : OP215 genotype : unc119(ed3); wgIs215(W03F9.2::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The W03F9.2::EGFP fusion protein is mainly expressed in germline cells. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the W03F9.2 transcription factor. made_by : Tony Hyman's lab from MPI-CBG )|Snyder_W03F9.2_GFP_YA_rep2 extraction4_seq4 channel_1|L4-Young Adult	OP215(official name : ...	ChIP-Seq
SRX065634	SRA037206	Snyder_ZTF-4_Input_L3_extraction1_seq1_aliquote_1	Snyder_ZTF-4_Input_L3_extraction1_seq1_aliquote_1	Snyder_ZTF-4_Input_L3 extraction1_seq1 channel_1	Snyder_ZTF-4_Input_L3 ...	OP322(official name : ZTF-4 genotype : unc119(ed3); wgIs322(ztf-4::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of ZTF-4::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZTF-4 transcription factor. made_by : Bob Waterston's lab from UW )|Snyder_ZTF-4_Input_L3 extraction1_seq1 channel_1|L3	OP322(official name : ...	ChIP-Seq
SRX065635	SRA037206	Snyder_ZTF-4_Input_L3_extraction2_seq2_aliquote_1	Snyder_ZTF-4_Input_L3_extraction2_seq2_aliquote_1	Snyder_ZTF-4_Input_L3 extraction2_seq2 channel_1	Snyder_ZTF-4_Input_L3 ...	OP322(official name : ZTF-4 genotype : unc119(ed3); wgIs322(ztf-4::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of ZTF-4::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZTF-4 transcription factor. made_by : Bob Waterston's lab from UW )|Snyder_ZTF-4_Input_L3 extraction2_seq2 channel_1|L3	OP322(official name : ...	ChIP-Seq
SRX065636	SRA037206	Snyder_ZTF-4_GFP_L3_rep1_extraction3_seq3_aliquote_1	Snyder_ZTF-4_GFP_L3_rep1_extraction3_seq3_aliqu...	Snyder_ZTF-4_GFP_L3_rep1 extraction3_seq3 channel_1	Snyder_ZTF-4_GFP_L3_re...	OP322(official name : ZTF-4 genotype : unc119(ed3); wgIs322(ztf-4::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of ZTF-4::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZTF-4 transcription factor. made_by : Bob Waterston's lab from UW )|Snyder_ZTF-4_GFP_L3_rep1 extraction3_seq3 channel_1|L3	OP322(official name : ...	ChIP-Seq
SRX065637	SRA037206	Snyder_ZTF-4_GFP_L3_rep2_extraction4_seq4_aliquote_1	Snyder_ZTF-4_GFP_L3_rep2_extraction4_seq4_aliqu...	Snyder_ZTF-4_GFP_L3_rep2 extraction4_seq4 channel_1	Snyder_ZTF-4_GFP_L3_re...	OP322(official name : ZTF-4 genotype : unc119(ed3); wgIs322(ztf-4::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of ZTF-4::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZTF-4 transcription factor. made_by : Bob Waterston's lab from UW )|Snyder_ZTF-4_GFP_L3_rep2 extraction4_seq4 channel_1|L3	OP322(official name : ...	ChIP-Seq
SRX065638	SRA037207	Snyder_ZTF-7_Input_L4_extraction1_seq1_aliquote_1	Snyder_ZTF-7_Input_L4_extraction1_seq1_aliquote_1	Snyder_ZTF-7_Input_L4 extraction1_seq1 channel_1	Snyder_ZTF-7_Input_L4 ...	OP332(official name : ZTF-7 genotype : unc119(ed3); wgIs332(ztf-71::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of ZTF-7::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZTF-7 transcription factor. made_by : Bob Waterston's lab from UW )|Snyder_ZTF-7_Input_L4 extraction1_seq1 channel_1|L4	OP332(official name : ...	ChIP-Seq
SRX065639	SRA037207	Snyder_ZTF-7_Input_L4_extraction2_seq2_aliquote_1	Snyder_ZTF-7_Input_L4_extraction2_seq2_aliquote_1	Snyder_ZTF-7_Input_L4 extraction2_seq2 channel_1	Snyder_ZTF-7_Input_L4 ...	OP332(official name : ZTF-7 genotype : unc119(ed3); wgIs332(ztf-71::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of ZTF-7::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZTF-7 transcription factor. made_by : Bob Waterston's lab from UW )|Snyder_ZTF-7_Input_L4 extraction2_seq2 channel_1|L4	OP332(official name : ...	ChIP-Seq
SRX065640	SRA037207	Snyder_ZTF-7_GFP_L4_rep1_extraction3_seq3_aliquote_1	Snyder_ZTF-7_GFP_L4_rep1_extraction3_seq3_aliqu...	Snyder_ZTF-7_GFP_L4_rep1 extraction3_seq3 channel_1	Snyder_ZTF-7_GFP_L4_re...	OP332(official name : ZTF-7 genotype : unc119(ed3); wgIs332(ztf-71::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of ZTF-7::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZTF-7 transcription factor. made_by : Bob Waterston's lab from UW )|Snyder_ZTF-7_GFP_L4_rep1 extraction3_seq3 channel_1|L4	OP332(official name : ...	ChIP-Seq
SRX065641	SRA037207	Snyder_ZTF-7_GFP_L4_rep2_extraction4_seq4_aliquote_1	Snyder_ZTF-7_GFP_L4_rep2_extraction4_seq4_aliqu...	Snyder_ZTF-7_GFP_L4_rep2 extraction4_seq4 channel_1	Snyder_ZTF-7_GFP_L4_re...	OP332(official name : ZTF-7 genotype : unc119(ed3); wgIs332(ztf-71::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of ZTF-7::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZTF-7 transcription factor. made_by : Bob Waterston's lab from UW )|Snyder_ZTF-7_GFP_L4_rep2 extraction4_seq4 channel_1|L4	OP332(official name : ...	ChIP-Seq
SRX065642	SRA037208	Snyder_ZAG-1_Input_L2_extraction1_seq1_aliquote_1	Snyder_ZAG-1_Input_L2_extraction1_seq1_aliquote_1	Snyder_ZAG-1_Input_L2 extraction1_seq1 channel_1	Snyder_ZAG-1_Input_L2 ...	OP83(official name : OP83 genotype : unc119(ed3); wgIs83(zag-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ZAG-1::EGFP fusion protein is expressed in the correct zag-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZAG-1 transcription factor. made_by : R Waterston )|Snyder_ZAG-1_Input_L2 extraction1_seq1 channel_1|L2	OP83(official name : O...	ChIP-Seq
SRX065643	SRA037208	Snyder_ZAG-1_Input_L2_extraction2_seq2_aliquote_1	Snyder_ZAG-1_Input_L2_extraction2_seq2_aliquote_1	Snyder_ZAG-1_Input_L2 extraction2_seq2 channel_1	Snyder_ZAG-1_Input_L2 ...	OP83(official name : OP83 genotype : unc119(ed3); wgIs83(zag-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ZAG-1::EGFP fusion protein is expressed in the correct zag-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZAG-1 transcription factor. made_by : R Waterston )|Snyder_ZAG-1_Input_L2 extraction2_seq2 channel_1|L2	OP83(official name : O...	ChIP-Seq
SRX065644	SRA037208	Snyder_ZAG-1_GFP_L2_rep1_extraction3_seq3_aliquote_1	Snyder_ZAG-1_GFP_L2_rep1_extraction3_seq3_aliqu...	Snyder_ZAG-1_GFP_L2_rep1 extraction3_seq3 channel_1	Snyder_ZAG-1_GFP_L2_re...	OP83(official name : OP83 genotype : unc119(ed3); wgIs83(zag-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ZAG-1::EGFP fusion protein is expressed in the correct zag-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZAG-1 transcription factor. made_by : R Waterston )|Snyder_ZAG-1_GFP_L2_rep1 extraction3_seq3 channel_1|L2	OP83(official name : O...	ChIP-Seq
SRX065645	SRA037208	Snyder_ZAG-1_GFP_L2_rep2_extraction4_seq4_aliquote_1	Snyder_ZAG-1_GFP_L2_rep2_extraction4_seq4_aliqu...	Snyder_ZAG-1_GFP_L2_rep2 extraction4_seq4 channel_1	Snyder_ZAG-1_GFP_L2_re...	OP83(official name : OP83 genotype : unc119(ed3); wgIs83(zag-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ZAG-1::EGFP fusion protein is expressed in the correct zag-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZAG-1 transcription factor. made_by : R Waterston )|Snyder_ZAG-1_GFP_L2_rep2 extraction4_seq4 channel_1|L2	OP83(official name : O...	ChIP-Seq
SRX065646	SRA037209	Snyder_CES-1_Input_L4_extraction1_seq1_aliquote_1	Snyder_CES-1_Input_L4_extraction1_seq1_aliquote_1	Snyder_CES-1_Input_L4 extraction1_seq1 channel_1	Snyder_CES-1_Input_L4 ...	OP174(official name : OP174 genotype : unc-119(ed3); wgIs174(ces-1::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CES-1::EGFP fusion protein is expressed in the correct ces-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CES-1 transcription factor. made_by : S. Kim )|Snyder_CES-1_Input_L4 extraction1_seq1 channel_1|L4	OP174(official name : ...	ChIP-Seq
SRX065647	SRA037209	Snyder_CES-1_Input_L4_extraction2_seq2_aliquote_1	Snyder_CES-1_Input_L4_extraction2_seq2_aliquote_1	Snyder_CES-1_Input_L4 extraction2_seq2 channel_1	Snyder_CES-1_Input_L4 ...	OP174(official name : OP174 genotype : unc-119(ed3); wgIs174(ces-1::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CES-1::EGFP fusion protein is expressed in the correct ces-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CES-1 transcription factor. made_by : S. Kim )|Snyder_CES-1_Input_L4 extraction2_seq2 channel_1|L4	OP174(official name : ...	ChIP-Seq
SRX065648	SRA037209	Snyder_CES-1_GFP_L4_rep1_extraction3_seq3_aliquote_1	Snyder_CES-1_GFP_L4_rep1_extraction3_seq3_aliqu...	Snyder_CES-1_GFP_L4_rep1 extraction3_seq3 channel_1	Snyder_CES-1_GFP_L4_re...	OP174(official name : OP174 genotype : unc-119(ed3); wgIs174(ces-1::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CES-1::EGFP fusion protein is expressed in the correct ces-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CES-1 transcription factor. made_by : S. Kim )|Snyder_CES-1_GFP_L4_rep1 extraction3_seq3 channel_1|L4	OP174(official name : ...	ChIP-Seq
SRX065649	SRA037209	Snyder_CES-1_GFP_L4_rep2_extraction4_seq4_aliquote_1	Snyder_CES-1_GFP_L4_rep2_extraction4_seq4_aliqu...	Snyder_CES-1_GFP_L4_rep2 extraction4_seq4 channel_1	Snyder_CES-1_GFP_L4_re...	OP174(official name : OP174 genotype : unc-119(ed3); wgIs174(ces-1::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CES-1::EGFP fusion protein is expressed in the correct ces-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CES-1 transcription factor. made_by : S. Kim )|Snyder_CES-1_GFP_L4_rep2 extraction4_seq4 channel_1|L4	OP174(official name : ...	ChIP-Seq
SRX065650	SRA037210	Snyder_UNC-62_Input_L3_extraction1_seq1_aliquote_1	Snyder_UNC-62_Input_L3_extraction1_seq1_aliquote_1	Snyder_UNC-62_Input_L3 extraction1_seq1 channel_1	Snyder_UNC-62_Input_L3...	OP600(official name : OP600 genotype : unc119(ed3); wgIs600(unc-62::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-62::EGFP fusion protein is expressed in the correct unc-62 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-62 transcription factor. made_by : S Kim )|Snyder_UNC-62_Input_L3 extraction1_seq1 channel_1|L3	OP600(official name : ...	ChIP-Seq
SRX065651	SRA037210	Snyder_UNC-62_Input_L3_extraction2_seq2_aliquote_1	Snyder_UNC-62_Input_L3_extraction2_seq2_aliquote_1	Snyder_UNC-62_Input_L3 extraction2_seq2 channel_1	Snyder_UNC-62_Input_L3...	OP600(official name : OP600 genotype : unc119(ed3); wgIs600(unc-62::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-62::EGFP fusion protein is expressed in the correct unc-62 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-62 transcription factor. made_by : S Kim )|Snyder_UNC-62_Input_L3 extraction2_seq2 channel_1|L3	OP600(official name : ...	ChIP-Seq
SRX065652	SRA037210	Snyder_UNC-62_GFP_L3_rep1_extraction3_seq3_aliquote_1	Snyder_UNC-62_GFP_L3_rep1_extraction3_seq3_aliq...	Snyder_UNC-62_GFP_L3_rep1 extraction3_seq3 channel_1	Snyder_UNC-62_GFP_L3_r...	OP600(official name : OP600 genotype : unc119(ed3); wgIs600(unc-62::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-62::EGFP fusion protein is expressed in the correct unc-62 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-62 transcription factor. made_by : S Kim )|Snyder_UNC-62_GFP_L3_rep1 extraction3_seq3 channel_1|L3	OP600(official name : ...	ChIP-Seq
SRX065653	SRA037210	Snyder_UNC-62_GFP_L3_rep2_extraction4_seq4_aliquote_1	Snyder_UNC-62_GFP_L3_rep2_extraction4_seq4_aliq...	Snyder_UNC-62_GFP_L3_rep2 extraction4_seq4 channel_1	Snyder_UNC-62_GFP_L3_r...	OP600(official name : OP600 genotype : unc119(ed3); wgIs600(unc-62::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-62::EGFP fusion protein is expressed in the correct unc-62 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-62 transcription factor. made_by : S Kim )|Snyder_UNC-62_GFP_L3_rep2 extraction4_seq4 channel_1|L3	OP600(official name : ...	ChIP-Seq
SRX065654	SRA037211	Snyder_NHR-28_Input_L4_extraction1_seq1_aliquote_1	Snyder_NHR-28_Input_L4_extraction1_seq1_aliquote_1	Snyder_NHR-28_Input_L4 extraction1_seq1 channel_1	Snyder_NHR-28_Input_L4...	OP317(official name : OP317 genotype : unc119(ed3); wgIs317(nhr-28::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-28::EGFP fusion protein is expressed in the correct nhr-28 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-28 transcription factor. made_by : R Waterston )|Snyder_NHR-28_Input_L4 extraction1_seq1 channel_1|L4	OP317(official name : ...	ChIP-Seq
SRX065655	SRA037211	Snyder_NHR-28_Input_L4_extraction2_seq2_aliquote_1	Snyder_NHR-28_Input_L4_extraction2_seq2_aliquote_1	Snyder_NHR-28_Input_L4 extraction2_seq2 channel_1	Snyder_NHR-28_Input_L4...	OP317(official name : OP317 genotype : unc119(ed3); wgIs317(nhr-28::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-28::EGFP fusion protein is expressed in the correct nhr-28 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-28 transcription factor. made_by : R Waterston )|Snyder_NHR-28_Input_L4 extraction2_seq2 channel_1|L4	OP317(official name : ...	ChIP-Seq
SRX065656	SRA037211	Snyder_NHR-28_GFP_L4_rep1_extraction3_seq3_aliquote_1	Snyder_NHR-28_GFP_L4_rep1_extraction3_seq3_aliq...	Snyder_NHR-28_GFP_L4_rep1 extraction3_seq3 channel_1	Snyder_NHR-28_GFP_L4_r...	OP317(official name : OP317 genotype : unc119(ed3); wgIs317(nhr-28::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-28::EGFP fusion protein is expressed in the correct nhr-28 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-28 transcription factor. made_by : R Waterston )|Snyder_NHR-28_GFP_L4_rep1 extraction3_seq3 channel_1|L4	OP317(official name : ...	ChIP-Seq
SRX065657	SRA037211	Snyder_NHR-28_GFP_L4_rep2_extraction4_seq4_aliquote_1	Snyder_NHR-28_GFP_L4_rep2_extraction4_seq4_aliq...	Snyder_NHR-28_GFP_L4_rep2 extraction4_seq4 channel_1	Snyder_NHR-28_GFP_L4_r...	OP317(official name : OP317 genotype : unc119(ed3); wgIs317(nhr-28::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-28::EGFP fusion protein is expressed in the correct nhr-28 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-28 transcription factor. made_by : R Waterston )|Snyder_NHR-28_GFP_L4_rep2 extraction4_seq4 channel_1|L4	OP317(official name : ...	ChIP-Seq
SRX065658	SRA037212	Snyder_FOS-1_Input_L2_extraction1_seq1_aliquote_1	Snyder_FOS-1_Input_L2_extraction1_seq1_aliquote_1	Snyder_FOS-1_Input_L2 extraction1_seq1 channel_1	Snyder_FOS-1_Input_L2 ...	OP304(official name : OP304 genotype : unc119(ed3); wgIs304(fos-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The FOS-1::EGFP fusion protein is expressed in the correct fos-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the FOS-1 transcription factor. made_by : R Waterston )|Snyder_FOS-1_Input_L2 extraction1_seq1 channel_1|L2	OP304(official name : ...	ChIP-Seq
SRX065659	SRA037212	Snyder_FOS-1_Input_L2_extraction2_seq2_aliquote_1	Snyder_FOS-1_Input_L2_extraction2_seq2_aliquote_1	Snyder_FOS-1_Input_L2 extraction2_seq2 channel_1	Snyder_FOS-1_Input_L2 ...	OP304(official name : OP304 genotype : unc119(ed3); wgIs304(fos-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The FOS-1::EGFP fusion protein is expressed in the correct fos-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the FOS-1 transcription factor. made_by : R Waterston )|Snyder_FOS-1_Input_L2 extraction2_seq2 channel_1|L2	OP304(official name : ...	ChIP-Seq
SRX065660	SRA037212	Snyder_FOS-1_GFP_L2_rep1_extraction3_seq3_aliquote_1	Snyder_FOS-1_GFP_L2_rep1_extraction3_seq3_aliqu...	Snyder_FOS-1_GFP_L2_rep1 extraction3_seq3 channel_1	Snyder_FOS-1_GFP_L2_re...	OP304(official name : OP304 genotype : unc119(ed3); wgIs304(fos-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The FOS-1::EGFP fusion protein is expressed in the correct fos-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the FOS-1 transcription factor. made_by : R Waterston )|Snyder_FOS-1_GFP_L2_rep1 extraction3_seq3 channel_1|L2	OP304(official name : ...	ChIP-Seq
SRX065661	SRA037212	Snyder_FOS-1_GFP_L2_rep2_extraction4_seq4_aliquote_1	Snyder_FOS-1_GFP_L2_rep2_extraction4_seq4_aliqu...	Snyder_FOS-1_GFP_L2_rep2 extraction4_seq4 channel_1	Snyder_FOS-1_GFP_L2_re...	OP304(official name : OP304 genotype : unc119(ed3); wgIs304(fos-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The FOS-1::EGFP fusion protein is expressed in the correct fos-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the FOS-1 transcription factor. made_by : R Waterston )|Snyder_FOS-1_GFP_L2_rep2 extraction4_seq4 channel_1|L2	OP304(official name : ...	ChIP-Seq
SRX065662	SRA037213	Snyder_UNC-62_Input_L2_extraction1_seq1_aliquote_1	Snyder_UNC-62_Input_L2_extraction1_seq1_aliquote_1	Snyder_UNC-62_Input_L2 extraction1_seq1 channel_1	Snyder_UNC-62_Input_L2...	OP600(official name : OP600 genotype : unc119(ed3); wgIs600(unc-62::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-62::EGFP fusion protein is expressed in the correct unc-62 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-62 transcription factor. made_by : S Kim )|Snyder_UNC-62_Input_L2 extraction1_seq1 channel_1|L2	OP600(official name : ...	ChIP-Seq
SRX065663	SRA037213	Snyder_UNC-62_Input_L2_extraction2_seq2_aliquote_1	Snyder_UNC-62_Input_L2_extraction2_seq2_aliquote_1	Snyder_UNC-62_Input_L2 extraction2_seq2 channel_1	Snyder_UNC-62_Input_L2...	OP600(official name : OP600 genotype : unc119(ed3); wgIs600(unc-62::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-62::EGFP fusion protein is expressed in the correct unc-62 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-62 transcription factor. made_by : S Kim )|Snyder_UNC-62_Input_L2 extraction2_seq2 channel_1|L2	OP600(official name : ...	ChIP-Seq
SRX065664	SRA037213	Snyder_UNC-62_GFP_L2_rep1_extraction3_seq3_aliquote_1	Snyder_UNC-62_GFP_L2_rep1_extraction3_seq3_aliq...	Snyder_UNC-62_GFP_L2_rep1 extraction3_seq3 channel_1	Snyder_UNC-62_GFP_L2_r...	OP600(official name : OP600 genotype : unc119(ed3); wgIs600(unc-62::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-62::EGFP fusion protein is expressed in the correct unc-62 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-62 transcription factor. made_by : S Kim )|Snyder_UNC-62_GFP_L2_rep1 extraction3_seq3 channel_1|L2	OP600(official name : ...	ChIP-Seq
SRX065665	SRA037213	Snyder_UNC-62_GFP_L2_rep2_extraction4_seq4_aliquote_1	Snyder_UNC-62_GFP_L2_rep2_extraction4_seq4_aliq...	Snyder_UNC-62_GFP_L2_rep2 extraction4_seq4 channel_1	Snyder_UNC-62_GFP_L2_r...	OP600(official name : OP600 genotype : unc119(ed3); wgIs600(unc-62::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-62::EGFP fusion protein is expressed in the correct unc-62 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-62 transcription factor. made_by : S Kim )|Snyder_UNC-62_GFP_L2_rep2 extraction4_seq4 channel_1|L2	OP600(official name : ...	ChIP-Seq
SRX065675	SRA037215	Snyder_C01B12.2_Input_L2_extraction1_seq1_aliquote_1	Snyder_C01B12.2_Input_L2_extraction1_seq1_aliqu...	Snyder_C01B12.2_Input_L2 extraction1_seq1 channel_1	Snyder_C01B12.2_Input_...	OP343(official name : OP343 genotype : unc119(ed3); wgIs343(C01B12.2:TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The C01B12.2::EGFP fusion protein has broad expression pattern at L2 stage. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the DPL-1 transcription factor. made_by : Bob Waterston's lab from UW )|Snyder_C01B12.2_Input_L2 extraction1_seq1 channel_1|L2	OP343(official name : ...	ChIP-Seq
SRX065676	SRA037215	Snyder_C01B12.2_Input_L2_extraction2_seq2_aliquote_1	Snyder_C01B12.2_Input_L2_extraction2_seq2_aliqu...	Snyder_C01B12.2_Input_L2 extraction2_seq2 channel_1	Snyder_C01B12.2_Input_...	OP343(official name : OP343 genotype : unc119(ed3); wgIs343(C01B12.2:TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The C01B12.2::EGFP fusion protein has broad expression pattern at L2 stage. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the DPL-1 transcription factor. made_by : Bob Waterston's lab from UW )|Snyder_C01B12.2_Input_L2 extraction2_seq2 channel_1|L2	OP343(official name : ...	ChIP-Seq
SRX065677	SRA037215	Snyder_C01B12.2_GFP_L2_rep1_extraction3_seq3_aliquote_1	Snyder_C01B12.2_GFP_L2_rep1_extraction3_seq3_al...	Snyder_C01B12.2_GFP_L2_rep1 extraction3_seq3 channel_1	Snyder_C01B12.2_GFP_L2...	OP343(official name : OP343 genotype : unc119(ed3); wgIs343(C01B12.2:TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The C01B12.2::EGFP fusion protein has broad expression pattern at L2 stage. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the DPL-1 transcription factor. made_by : Bob Waterston's lab from UW )|Snyder_C01B12.2_GFP_L2_rep1 extraction3_seq3 channel_1|L2	OP343(official name : ...	ChIP-Seq
SRX065678	SRA037215	Snyder_C01B12.2_GFP_L2_rep2_extraction4_seq4_aliquote_1	Snyder_C01B12.2_GFP_L2_rep2_extraction4_seq4_al...	Snyder_C01B12.2_GFP_L2_rep2 extraction4_seq4 channel_1	Snyder_C01B12.2_GFP_L2...	OP343(official name : OP343 genotype : unc119(ed3); wgIs343(C01B12.2:TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The C01B12.2::EGFP fusion protein has broad expression pattern at L2 stage. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the DPL-1 transcription factor. made_by : Bob Waterston's lab from UW )|Snyder_C01B12.2_GFP_L2_rep2 extraction4_seq4 channel_1|L2	OP343(official name : ...	ChIP-Seq
SRX065679	SRA037216	Snyder_EOR-1_Input_L3_extraction1_seq1_aliquote_1	Snyder_EOR-1_Input_L3_extraction1_seq1_aliquote_1	Snyder_EOR-1_Input_L3 extraction1_seq1 channel_1	Snyder_EOR-1_Input_L3 ...	OP81(official name : OP81 genotype : unc-119(ed3) III; wgIs81 unc-119(+) eor-1::TY1::EGFP::3xFLAG outcross : 0 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The EOR-1::EGFP fusion protein is expressed in the correct eor-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the EOR-1 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_EOR-1_Input_L3 extraction1_seq1 channel_1|L3	OP81(official name : O...	ChIP-Seq
SRX065680	SRA037216	Snyder_EOR-1_Input_L3_extraction2_seq2_aliquote_1	Snyder_EOR-1_Input_L3_extraction2_seq2_aliquote_1	Snyder_EOR-1_Input_L3 extraction2_seq2 channel_1	Snyder_EOR-1_Input_L3 ...	OP81(official name : OP81 genotype : unc-119(ed3) III; wgIs81 unc-119(+) eor-1::TY1::EGFP::3xFLAG outcross : 0 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The EOR-1::EGFP fusion protein is expressed in the correct eor-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the EOR-1 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_EOR-1_Input_L3 extraction2_seq2 channel_1|L3	OP81(official name : O...	ChIP-Seq
SRX065681	SRA037216	Snyder_EOR-1_GFP_L3_rep1_extraction3_seq3_aliquote_1	Snyder_EOR-1_GFP_L3_rep1_extraction3_seq3_aliqu...	Snyder_EOR-1_GFP_L3_rep1 extraction3_seq3 channel_1	Snyder_EOR-1_GFP_L3_re...	OP81(official name : OP81 genotype : unc-119(ed3) III; wgIs81 unc-119(+) eor-1::TY1::EGFP::3xFLAG outcross : 0 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The EOR-1::EGFP fusion protein is expressed in the correct eor-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the EOR-1 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_EOR-1_GFP_L3_rep1 extraction3_seq3 channel_1|L3	OP81(official name : O...	ChIP-Seq
SRX065682	SRA037216	Snyder_EOR-1_GFP_L3_rep2_extraction4_seq4_aliquote_1	Snyder_EOR-1_GFP_L3_rep2_extraction4_seq4_aliqu...	Snyder_EOR-1_GFP_L3_rep2 extraction4_seq4 channel_1	Snyder_EOR-1_GFP_L3_re...	OP81(official name : OP81 genotype : unc-119(ed3) III; wgIs81 unc-119(+) eor-1::TY1::EGFP::3xFLAG outcross : 0 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The EOR-1::EGFP fusion protein is expressed in the correct eor-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the EOR-1 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_EOR-1_GFP_L3_rep2 extraction4_seq4 channel_1|L3	OP81(official name : O...	ChIP-Seq
SRX065683	SRA037218	Snyder_UNC-62_Input_L1_extraction1_seq1_aliquote_1	Snyder_UNC-62_Input_L1_extraction1_seq1_aliquote_1	Snyder_UNC-62_Input_L1 extraction1_seq1 channel_1	Snyder_UNC-62_Input_L1...	OP600(official name : OP600 genotype : unc119(ed3); wgIs600(unc-62::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-62::EGFP fusion protein is expressed in the correct unc-62 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-62 transcription factor. made_by : S Kim )|Snyder_UNC-62_Input_L1 extraction1_seq1 channel_1|fed L1	OP600(official name : ...	ChIP-Seq
SRX065684	SRA037218	Snyder_UNC-62_Input_L1_extraction2_seq2_aliquote_1	Snyder_UNC-62_Input_L1_extraction2_seq2_aliquote_1	Snyder_UNC-62_Input_L1 extraction2_seq2 channel_1	Snyder_UNC-62_Input_L1...	OP600(official name : OP600 genotype : unc119(ed3); wgIs600(unc-62::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-62::EGFP fusion protein is expressed in the correct unc-62 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-62 transcription factor. made_by : S Kim )|Snyder_UNC-62_Input_L1 extraction2_seq2 channel_1|fed L1	OP600(official name : ...	ChIP-Seq
SRX065685	SRA037218	Snyder_UNC-62_GFP_L1_rep1_extraction3_seq3_aliquote_1	Snyder_UNC-62_GFP_L1_rep1_extraction3_seq3_aliq...	Snyder_UNC-62_GFP_L1_rep1 extraction3_seq3 channel_1	Snyder_UNC-62_GFP_L1_r...	OP600(official name : OP600 genotype : unc119(ed3); wgIs600(unc-62::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-62::EGFP fusion protein is expressed in the correct unc-62 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-62 transcription factor. made_by : S Kim )|Snyder_UNC-62_GFP_L1_rep1 extraction3_seq3 channel_1|fed L1	OP600(official name : ...	ChIP-Seq
SRX065686	SRA037218	Snyder_UNC-62_GFP_L1_rep2_extraction4_seq4_aliquote_1	Snyder_UNC-62_GFP_L1_rep2_extraction4_seq4_aliq...	Snyder_UNC-62_GFP_L1_rep2 extraction4_seq4 channel_1	Snyder_UNC-62_GFP_L1_r...	OP600(official name : OP600 genotype : unc119(ed3); wgIs600(unc-62::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-62::EGFP fusion protein is expressed in the correct unc-62 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-62 transcription factor. made_by : S Kim )|Snyder_UNC-62_GFP_L1_rep2 extraction4_seq4 channel_1|fed L1	OP600(official name : ...	ChIP-Seq
SRX065687	SRA037219	Snyder_NHR-6v2_Input_L2_extraction1_seq1_aliquote_1	Snyder_NHR-6v2_Input_L2_extraction1_seq1_aliquo...	Snyder_NHR-6v2_Input_L2 extraction1_seq1 channel_1	Snyder_NHR-6v2_Input_L...	OP90(official name : OP90 genotype : unc-119(ed3) III; wgIs90 unc-119(+) nhr-6::TY1::EGFP::3xFLAG outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-6::EGFP fusion protein is expressed in neurons surrounding pharynx at L2 stage. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-6 transcription factor. made_by : R. Waterston )|Snyder_NHR-6v2_Input_L2 extraction1_seq1 channel_1|L2	OP90(official name : O...	ChIP-Seq
SRX065688	SRA037219	Snyder_NHR-6v2_Input_L2_extraction2_seq2_aliquote_1	Snyder_NHR-6v2_Input_L2_extraction2_seq2_aliquo...	Snyder_NHR-6v2_Input_L2 extraction2_seq2 channel_1	Snyder_NHR-6v2_Input_L...	OP90(official name : OP90 genotype : unc-119(ed3) III; wgIs90 unc-119(+) nhr-6::TY1::EGFP::3xFLAG outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-6::EGFP fusion protein is expressed in neurons surrounding pharynx at L2 stage. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-6 transcription factor. made_by : R. Waterston )|Snyder_NHR-6v2_Input_L2 extraction2_seq2 channel_1|L2	OP90(official name : O...	ChIP-Seq
SRX065689	SRA037219	Snyder_NHR-6v2_GFP_L2_rep1_extraction3_seq3_aliquote_1	Snyder_NHR-6v2_GFP_L2_rep1_extraction3_seq3_ali...	Snyder_NHR-6v2_GFP_L2_rep1 extraction3_seq3 channel_1	Snyder_NHR-6v2_GFP_L2_...	OP90(official name : OP90 genotype : unc-119(ed3) III; wgIs90 unc-119(+) nhr-6::TY1::EGFP::3xFLAG outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-6::EGFP fusion protein is expressed in neurons surrounding pharynx at L2 stage. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-6 transcription factor. made_by : R. Waterston )|Snyder_NHR-6v2_GFP_L2_rep1 extraction3_seq3 channel_1|L2	OP90(official name : O...	ChIP-Seq
SRX065690	SRA037219	Snyder_NHR-6v2_GFP_L2_rep2_extraction4_seq4_aliquote_1	Snyder_NHR-6v2_GFP_L2_rep2_extraction4_seq4_ali...	Snyder_NHR-6v2_GFP_L2_rep2 extraction4_seq4 channel_1	Snyder_NHR-6v2_GFP_L2_...	OP90(official name : OP90 genotype : unc-119(ed3) III; wgIs90 unc-119(+) nhr-6::TY1::EGFP::3xFLAG outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-6::EGFP fusion protein is expressed in neurons surrounding pharynx at L2 stage. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-6 transcription factor. made_by : R. Waterston )|Snyder_NHR-6v2_GFP_L2_rep2 extraction4_seq4 channel_1|L2	OP90(official name : O...	ChIP-Seq
SRX065691	SRA037220	Snyder_ZAG-1_Input_L3_extraction1_seq1_aliquote_1	Snyder_ZAG-1_Input_L3_extraction1_seq1_aliquote_1	Snyder_ZAG-1_Input_L3 extraction1_seq1 channel_1	Snyder_ZAG-1_Input_L3 ...	OP83(official name : OP83 genotype : unc119(ed3); wgIs83(zag-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ZAG-1::EGFP fusion protein is expressed in the correct zag-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZAG-1 transcription factor. made_by : R Waterston )|Snyder_ZAG-1_Input_L3 extraction1_seq1 channel_1|L3	OP83(official name : O...	ChIP-Seq
SRX065692	SRA037220	Snyder_ZAG-1_Input_L3_extraction2_seq2_aliquote_1	Snyder_ZAG-1_Input_L3_extraction2_seq2_aliquote_1	Snyder_ZAG-1_Input_L3 extraction2_seq2 channel_1	Snyder_ZAG-1_Input_L3 ...	OP83(official name : OP83 genotype : unc119(ed3); wgIs83(zag-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ZAG-1::EGFP fusion protein is expressed in the correct zag-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZAG-1 transcription factor. made_by : R Waterston )|Snyder_ZAG-1_Input_L3 extraction2_seq2 channel_1|L3	OP83(official name : O...	ChIP-Seq
SRX065693	SRA037220	Snyder_ZAG-1_GFP_L3_rep1_extraction3_seq3_aliquote_1	Snyder_ZAG-1_GFP_L3_rep1_extraction3_seq3_aliqu...	Snyder_ZAG-1_GFP_L3_rep1 extraction3_seq3 channel_1	Snyder_ZAG-1_GFP_L3_re...	OP83(official name : OP83 genotype : unc119(ed3); wgIs83(zag-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ZAG-1::EGFP fusion protein is expressed in the correct zag-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZAG-1 transcription factor. made_by : R Waterston )|Snyder_ZAG-1_GFP_L3_rep1 extraction3_seq3 channel_1|L3	OP83(official name : O...	ChIP-Seq
SRX065694	SRA037220	Snyder_ZAG-1_GFP_L3_rep2_extraction4_seq4_aliquote_1	Snyder_ZAG-1_GFP_L3_rep2_extraction4_seq4_aliqu...	Snyder_ZAG-1_GFP_L3_rep2 extraction4_seq4 channel_1	Snyder_ZAG-1_GFP_L3_re...	OP83(official name : OP83 genotype : unc119(ed3); wgIs83(zag-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ZAG-1::EGFP fusion protein is expressed in the correct zag-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZAG-1 transcription factor. made_by : R Waterston )|Snyder_ZAG-1_GFP_L3_rep2 extraction4_seq4 channel_1|L3	OP83(official name : O...	ChIP-Seq
SRX065695	SRA037221	Snyder_ZAG-1_Input_L1_extraction1_seq1_aliquote_1	Snyder_ZAG-1_Input_L1_extraction1_seq1_aliquote_1	Snyder_ZAG-1_Input_L1 extraction1_seq1 channel_1	Snyder_ZAG-1_Input_L1 ...	OP83(official name : OP83 genotype : unc119(ed3); wgIs83(zag-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ZAG-1::EGFP fusion protein is expressed in the correct zag-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZAG-1 transcription factor. made_by : R Waterston )|Snyder_ZAG-1_Input_L1 extraction1_seq1 channel_1|fed L1	OP83(official name : O...	ChIP-Seq
SRX065696	SRA037221	Snyder_ZAG-1_Input_L1_extraction2_seq2_aliquote_1	Snyder_ZAG-1_Input_L1_extraction2_seq2_aliquote_1	Snyder_ZAG-1_Input_L1 extraction2_seq2 channel_1	Snyder_ZAG-1_Input_L1 ...	OP83(official name : OP83 genotype : unc119(ed3); wgIs83(zag-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ZAG-1::EGFP fusion protein is expressed in the correct zag-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZAG-1 transcription factor. made_by : R Waterston )|Snyder_ZAG-1_Input_L1 extraction2_seq2 channel_1|fed L1	OP83(official name : O...	ChIP-Seq
SRX065697	SRA037221	Snyder_ZAG-1_GFP_L1_rep1_extraction3_seq3_aliquote_1	Snyder_ZAG-1_GFP_L1_rep1_extraction3_seq3_aliqu...	Snyder_ZAG-1_GFP_L1_rep1 extraction3_seq3 channel_1	Snyder_ZAG-1_GFP_L1_re...	OP83(official name : OP83 genotype : unc119(ed3); wgIs83(zag-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ZAG-1::EGFP fusion protein is expressed in the correct zag-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZAG-1 transcription factor. made_by : R Waterston )|Snyder_ZAG-1_GFP_L1_rep1 extraction3_seq3 channel_1|fed L1	OP83(official name : O...	ChIP-Seq
SRX065698	SRA037221	Snyder_ZAG-1_GFP_L1_rep2_extraction4_seq4_aliquote_1	Snyder_ZAG-1_GFP_L1_rep2_extraction4_seq4_aliqu...	Snyder_ZAG-1_GFP_L1_rep2 extraction4_seq4 channel_1	Snyder_ZAG-1_GFP_L1_re...	OP83(official name : OP83 genotype : unc119(ed3); wgIs83(zag-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ZAG-1::EGFP fusion protein is expressed in the correct zag-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZAG-1 transcription factor. made_by : R Waterston )|Snyder_ZAG-1_GFP_L1_rep2 extraction4_seq4 channel_1|fed L1	OP83(official name : O...	ChIP-Seq
SRX065699	SRA037222	Snyder_F45C12.2_Input_L3_extraction1_seq1_aliquote_1	Snyder_F45C12.2_Input_L3_extraction1_seq1_aliqu...	Snyder_F45C12.2_Input_L3 extraction1_seq1 channel_1	Snyder_F45C12.2_Input_...	OP212(official name : OP212 genotype : unc119(ed3); wgIs212(F45C12.2:TY1 EGFP FLAG; unc119) outcross : 3 transgene : F45C12.2 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The F45C12.2::EGFP fusion protein is expressed in the correct F45C12.2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the F45C12.2 transcription factor. made_by : Mihail Sarov )|Snyder_F45C12.2_Input_L3 extraction1_seq1 channel_1|L3	OP212(official name : ...	ChIP-Seq
SRX065700	SRA037222	Snyder_F45C12.2_Input_L3_extraction2_seq2_aliquote_1	Snyder_F45C12.2_Input_L3_extraction2_seq2_aliqu...	Snyder_F45C12.2_Input_L3 extraction2_seq2 channel_1	Snyder_F45C12.2_Input_...	OP212(official name : OP212 genotype : unc119(ed3); wgIs212(F45C12.2:TY1 EGFP FLAG; unc119) outcross : 3 transgene : F45C12.2 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The F45C12.2::EGFP fusion protein is expressed in the correct F45C12.2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the F45C12.2 transcription factor. made_by : Mihail Sarov )|Snyder_F45C12.2_Input_L3 extraction2_seq2 channel_1|L3	OP212(official name : ...	ChIP-Seq
SRX065701	SRA037222	Snyder_F45C12.2_GFP_L3_rep1_extraction3_seq3_aliquote_1	Snyder_F45C12.2_GFP_L3_rep1_extraction3_seq3_al...	Snyder_F45C12.2_GFP_L3_rep1 extraction3_seq3 channel_1	Snyder_F45C12.2_GFP_L3...	OP212(official name : OP212 genotype : unc119(ed3); wgIs212(F45C12.2:TY1 EGFP FLAG; unc119) outcross : 3 transgene : F45C12.2 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The F45C12.2::EGFP fusion protein is expressed in the correct F45C12.2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the F45C12.2 transcription factor. made_by : Mihail Sarov )|Snyder_F45C12.2_GFP_L3_rep1 extraction3_seq3 channel_1|L3	OP212(official name : ...	ChIP-Seq
SRX065702	SRA037222	Snyder_F45C12.2_GFP_L3_rep2_extraction4_seq4_aliquote_1	Snyder_F45C12.2_GFP_L3_rep2_extraction4_seq4_al...	Snyder_F45C12.2_GFP_L3_rep2 extraction4_seq4 channel_1	Snyder_F45C12.2_GFP_L3...	OP212(official name : OP212 genotype : unc119(ed3); wgIs212(F45C12.2:TY1 EGFP FLAG; unc119) outcross : 3 transgene : F45C12.2 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The F45C12.2::EGFP fusion protein is expressed in the correct F45C12.2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the F45C12.2 transcription factor. made_by : Mihail Sarov )|Snyder_F45C12.2_GFP_L3_rep2 extraction4_seq4 channel_1|L3	OP212(official name : ...	ChIP-Seq
SRX065703	SRA037223	Snyder_DAF-12_Input_L3_extraction1_seq1_aliquote_1	Snyder_DAF-12_Input_L3_extraction1_seq1_aliquote_1	Snyder_DAF-12_Input_L3 extraction1_seq1 channel_1	Snyder_DAF-12_Input_L3...	OP222(official name : OP222 genotype : unc119(ed3); wgIs222(daf-12:TY1 EGFP FLAG; unc119) outcross : 3 transgene : daf-12 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The DAF-12::EGFP fusion protein is expressed in the correct daf-12 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the DAF-12 transcription factor. made_by : Mihail Sarov )|Snyder_DAF-12_Input_L3 extraction1_seq1 channel_1|L3	OP222(official name : ...	ChIP-Seq
SRX065704	SRA037223	Snyder_DAF-12_Input_L3_extraction2_seq2_aliquote_1	Snyder_DAF-12_Input_L3_extraction2_seq2_aliquote_1	Snyder_DAF-12_Input_L3 extraction2_seq2 channel_1	Snyder_DAF-12_Input_L3...	OP222(official name : OP222 genotype : unc119(ed3); wgIs222(daf-12:TY1 EGFP FLAG; unc119) outcross : 3 transgene : daf-12 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The DAF-12::EGFP fusion protein is expressed in the correct daf-12 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the DAF-12 transcription factor. made_by : Mihail Sarov )|Snyder_DAF-12_Input_L3 extraction2_seq2 channel_1|L3	OP222(official name : ...	ChIP-Seq
SRX065705	SRA037223	Snyder_DAF-12_GFP_L3_rep1_extraction3_seq3_aliquote_1	Snyder_DAF-12_GFP_L3_rep1_extraction3_seq3_aliq...	Snyder_DAF-12_GFP_L3_rep1 extraction3_seq3 channel_1	Snyder_DAF-12_GFP_L3_r...	OP222(official name : OP222 genotype : unc119(ed3); wgIs222(daf-12:TY1 EGFP FLAG; unc119) outcross : 3 transgene : daf-12 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The DAF-12::EGFP fusion protein is expressed in the correct daf-12 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the DAF-12 transcription factor. made_by : Mihail Sarov )|Snyder_DAF-12_GFP_L3_rep1 extraction3_seq3 channel_1|L3	OP222(official name : ...	ChIP-Seq
SRX065706	SRA037223	Snyder_DAF-12_GFP_L3_rep2_extraction4_seq4_aliquote_1	Snyder_DAF-12_GFP_L3_rep2_extraction4_seq4_aliq...	Snyder_DAF-12_GFP_L3_rep2 extraction4_seq4 channel_1	Snyder_DAF-12_GFP_L3_r...	OP222(official name : OP222 genotype : unc119(ed3); wgIs222(daf-12:TY1 EGFP FLAG; unc119) outcross : 3 transgene : daf-12 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The DAF-12::EGFP fusion protein is expressed in the correct daf-12 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the DAF-12 transcription factor. made_by : Mihail Sarov )|Snyder_DAF-12_GFP_L3_rep2 extraction4_seq4 channel_1|L3	OP222(official name : ...	ChIP-Seq
SRX065707	SRA037224	Snyder_ALY-2_Input_L1_extraction1_seq1_aliquote_1	Snyder_ALY-2_Input_L1_extraction1_seq1_aliquote_1	Snyder_ALY-2_Input_L1 extraction1_seq1 channel_1	Snyder_ALY-2_Input_L1 ...	OP217(official name : OP217 genotype : unc119(ed3); wgIs217(aly-2:TY1 EGFP FLAG; unc119) outcross : 3 transgene : aly-2 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ALY-2::EGFP fusion protein is expressed in the correct aly-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ALY-2 transcription factor. made_by : Mihail Sarov )|Snyder_ALY-2_Input_L1 extraction1_seq1 channel_1|fed L1	OP217(official name : ...	ChIP-Seq
SRX065708	SRA037224	Snyder_ALY-2_Input_L1_extraction2_seq2_aliquote_1	Snyder_ALY-2_Input_L1_extraction2_seq2_aliquote_1	Snyder_ALY-2_Input_L1 extraction2_seq2 channel_1	Snyder_ALY-2_Input_L1 ...	OP217(official name : OP217 genotype : unc119(ed3); wgIs217(aly-2:TY1 EGFP FLAG; unc119) outcross : 3 transgene : aly-2 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ALY-2::EGFP fusion protein is expressed in the correct aly-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ALY-2 transcription factor. made_by : Mihail Sarov )|Snyder_ALY-2_Input_L1 extraction2_seq2 channel_1|fed L1	OP217(official name : ...	ChIP-Seq
SRX065709	SRA037224	Snyder_ALY-2_GFP_L1_rep1_extraction3_seq3_aliquote_1	Snyder_ALY-2_GFP_L1_rep1_extraction3_seq3_aliqu...	Snyder_ALY-2_GFP_L1_rep1 extraction3_seq3 channel_1	Snyder_ALY-2_GFP_L1_re...	OP217(official name : OP217 genotype : unc119(ed3); wgIs217(aly-2:TY1 EGFP FLAG; unc119) outcross : 3 transgene : aly-2 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ALY-2::EGFP fusion protein is expressed in the correct aly-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ALY-2 transcription factor. made_by : Mihail Sarov )|Snyder_ALY-2_GFP_L1_rep1 extraction3_seq3 channel_1|fed L1	OP217(official name : ...	ChIP-Seq
SRX065710	SRA037224	Snyder_ALY-2_GFP_L1_rep2_extraction4_seq4_aliquote_1	Snyder_ALY-2_GFP_L1_rep2_extraction4_seq4_aliqu...	Snyder_ALY-2_GFP_L1_rep2 extraction4_seq4 channel_1	Snyder_ALY-2_GFP_L1_re...	OP217(official name : OP217 genotype : unc119(ed3); wgIs217(aly-2:TY1 EGFP FLAG; unc119) outcross : 3 transgene : aly-2 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ALY-2::EGFP fusion protein is expressed in the correct aly-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ALY-2 transcription factor. made_by : Mihail Sarov )|Snyder_ALY-2_GFP_L1_rep2 extraction4_seq4 channel_1|fed L1	OP217(official name : ...	ChIP-Seq
SRX065711	SRA037225	Snyder_DAF-12_Input_L4_extraction1_seq1_aliquote_1	Snyder_DAF-12_Input_L4_extraction1_seq1_aliquote_1	Snyder_DAF-12_Input_L4 extraction1_seq1 channel_1	Snyder_DAF-12_Input_L4...	OP222(official name : OP222 genotype : unc119(ed3); wgIs222(daf-12:TY1 EGFP FLAG; unc119) outcross : 3 transgene : daf-12 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The DAF-12::EGFP fusion protein is expressed in the correct daf-12 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the DAF-12 transcription factor. made_by : Mihail Sarov )|Snyder_DAF-12_Input_L4 extraction1_seq1 channel_1|L4	OP222(official name : ...	ChIP-Seq
SRX065712	SRA037225	Snyder_DAF-12_Input_L4_extraction2_seq2_aliquote_1	Snyder_DAF-12_Input_L4_extraction2_seq2_aliquote_1	Snyder_DAF-12_Input_L4 extraction2_seq2 channel_1	Snyder_DAF-12_Input_L4...	OP222(official name : OP222 genotype : unc119(ed3); wgIs222(daf-12:TY1 EGFP FLAG; unc119) outcross : 3 transgene : daf-12 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The DAF-12::EGFP fusion protein is expressed in the correct daf-12 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the DAF-12 transcription factor. made_by : Mihail Sarov )|Snyder_DAF-12_Input_L4 extraction2_seq2 channel_1|L4	OP222(official name : ...	ChIP-Seq
SRX065713	SRA037225	Snyder_DAF-12_GFP_L4_rep1_extraction3_seq3_aliquote_1	Snyder_DAF-12_GFP_L4_rep1_extraction3_seq3_aliq...	Snyder_DAF-12_GFP_L4_rep1 extraction3_seq3 channel_1	Snyder_DAF-12_GFP_L4_r...	OP222(official name : OP222 genotype : unc119(ed3); wgIs222(daf-12:TY1 EGFP FLAG; unc119) outcross : 3 transgene : daf-12 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The DAF-12::EGFP fusion protein is expressed in the correct daf-12 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the DAF-12 transcription factor. made_by : Mihail Sarov )|Snyder_DAF-12_GFP_L4_rep1 extraction3_seq3 channel_1|L4	OP222(official name : ...	ChIP-Seq
SRX065714	SRA037225	Snyder_DAF-12_GFP_L4_rep2_extraction4_seq4_aliquote_1	Snyder_DAF-12_GFP_L4_rep2_extraction4_seq4_aliq...	Snyder_DAF-12_GFP_L4_rep2 extraction4_seq4 channel_1	Snyder_DAF-12_GFP_L4_r...	OP222(official name : OP222 genotype : unc119(ed3); wgIs222(daf-12:TY1 EGFP FLAG; unc119) outcross : 3 transgene : daf-12 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The DAF-12::EGFP fusion protein is expressed in the correct daf-12 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the DAF-12 transcription factor. made_by : Mihail Sarov )|Snyder_DAF-12_GFP_L4_rep2 extraction4_seq4 channel_1|L4	OP222(official name : ...	ChIP-Seq
SRX065715	SRA037226	Snyder_ALY-2_Input_L3_extraction1_seq1_aliquote_1	Snyder_ALY-2_Input_L3_extraction1_seq1_aliquote_1	Snyder_ALY-2_Input_L3 extraction1_seq1 channel_1	Snyder_ALY-2_Input_L3 ...	OP217(official name : OP217 genotype : unc119(ed3); wgIs217(aly-2:TY1 EGFP FLAG; unc119) outcross : 3 transgene : aly-2 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ALY-2::EGFP fusion protein is expressed in the correct aly-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ALY-2 transcription factor. made_by : Mihail Sarov )|Snyder_ALY-2_Input_L3 extraction1_seq1 channel_1|L3	OP217(official name : ...	ChIP-Seq
SRX065716	SRA037226	Snyder_ALY-2_Input_L3_extraction2_seq2_aliquote_1	Snyder_ALY-2_Input_L3_extraction2_seq2_aliquote_1	Snyder_ALY-2_Input_L3 extraction2_seq2 channel_1	Snyder_ALY-2_Input_L3 ...	OP217(official name : OP217 genotype : unc119(ed3); wgIs217(aly-2:TY1 EGFP FLAG; unc119) outcross : 3 transgene : aly-2 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ALY-2::EGFP fusion protein is expressed in the correct aly-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ALY-2 transcription factor. made_by : Mihail Sarov )|Snyder_ALY-2_Input_L3 extraction2_seq2 channel_1|L3	OP217(official name : ...	ChIP-Seq
SRX065717	SRA037226	Snyder_ALY-2_GFP_L3_rep1_extraction3_seq3_aliquote_1	Snyder_ALY-2_GFP_L3_rep1_extraction3_seq3_aliqu...	Snyder_ALY-2_GFP_L3_rep1 extraction3_seq3 channel_1	Snyder_ALY-2_GFP_L3_re...	OP217(official name : OP217 genotype : unc119(ed3); wgIs217(aly-2:TY1 EGFP FLAG; unc119) outcross : 3 transgene : aly-2 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ALY-2::EGFP fusion protein is expressed in the correct aly-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ALY-2 transcription factor. made_by : Mihail Sarov )|Snyder_ALY-2_GFP_L3_rep1 extraction3_seq3 channel_1|L3	OP217(official name : ...	ChIP-Seq
SRX065718	SRA037226	Snyder_ALY-2_GFP_L3_rep2_extraction4_seq4_aliquote_1	Snyder_ALY-2_GFP_L3_rep2_extraction4_seq4_aliqu...	Snyder_ALY-2_GFP_L3_rep2 extraction4_seq4 channel_1	Snyder_ALY-2_GFP_L3_re...	OP217(official name : OP217 genotype : unc119(ed3); wgIs217(aly-2:TY1 EGFP FLAG; unc119) outcross : 3 transgene : aly-2 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ALY-2::EGFP fusion protein is expressed in the correct aly-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ALY-2 transcription factor. made_by : Mihail Sarov )|Snyder_ALY-2_GFP_L3_rep2 extraction4_seq4 channel_1|L3	OP217(official name : ...	ChIP-Seq
SRX065719	SRA037227	Snyder_R02D3.7_Input_L2_extraction1_seq1_aliquote_1	Snyder_R02D3.7_Input_L2_extraction1_seq1_aliquo...	Snyder_R02D3.7_Input_L2 extraction1_seq1 channel_1	Snyder_R02D3.7_Input_L...	OP218(official name : OP218 genotype : unc-119(ed3); wgIs218(R02D3.7:TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The R02D3.7::EGFP fusion protein is expressed in the correct R02D3.7 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the RO2D3.7 transcription factor. made_by : )|Snyder_R02D3.7_Input_L2 extraction1_seq1 channel_1|L2	OP218(official name : ...	ChIP-Seq
SRX065720	SRA037227	Snyder_R02D3.7_Input_L2_extraction2_seq2_aliquote_1	Snyder_R02D3.7_Input_L2_extraction2_seq2_aliquo...	Snyder_R02D3.7_Input_L2 extraction2_seq2 channel_1	Snyder_R02D3.7_Input_L...	OP218(official name : OP218 genotype : unc-119(ed3); wgIs218(R02D3.7:TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The R02D3.7::EGFP fusion protein is expressed in the correct R02D3.7 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the RO2D3.7 transcription factor. made_by : )|Snyder_R02D3.7_Input_L2 extraction2_seq2 channel_1|L2	OP218(official name : ...	ChIP-Seq
SRX065721	SRA037227	Snyder_R02D3.7_GFP_L2_rep1_extraction3_seq3_aliquote_1	Snyder_R02D3.7_GFP_L2_rep1_extraction3_seq3_ali...	Snyder_R02D3.7_GFP_L2_rep1 extraction3_seq3 channel_1	Snyder_R02D3.7_GFP_L2_...	OP218(official name : OP218 genotype : unc-119(ed3); wgIs218(R02D3.7:TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The R02D3.7::EGFP fusion protein is expressed in the correct R02D3.7 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the RO2D3.7 transcription factor. made_by : )|Snyder_R02D3.7_GFP_L2_rep1 extraction3_seq3 channel_1|L2	OP218(official name : ...	ChIP-Seq
SRX065722	SRA037227	Snyder_R02D3.7_GFP_L2_rep2_extraction4_seq4_aliquote_1	Snyder_R02D3.7_GFP_L2_rep2_extraction4_seq4_ali...	Snyder_R02D3.7_GFP_L2_rep2 extraction4_seq4 channel_1	Snyder_R02D3.7_GFP_L2_...	OP218(official name : OP218 genotype : unc-119(ed3); wgIs218(R02D3.7:TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The R02D3.7::EGFP fusion protein is expressed in the correct R02D3.7 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the RO2D3.7 transcription factor. made_by : )|Snyder_R02D3.7_GFP_L2_rep2 extraction4_seq4 channel_1|L2	OP218(official name : ...	ChIP-Seq
SRX065723	SRA037228	Snyder_NHR-28_Input_L3_extraction1_seq1_aliquote_1	Snyder_NHR-28_Input_L3_extraction1_seq1_aliquote_1	Snyder_NHR-28_Input_L3 extraction1_seq1 channel_1	Snyder_NHR-28_Input_L3...	OP317(official name : OP317 genotype : unc119(ed3); wgIs317(nhr-28::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-28::EGFP fusion protein is expressed in the correct nhr-28 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-28 transcription factor. made_by : R Waterston )|Snyder_NHR-28_Input_L3 extraction1_seq1 channel_1|L3	OP317(official name : ...	ChIP-Seq
SRX065724	SRA037228	Snyder_NHR-28_Input_L3_extraction2_seq2_aliquote_1	Snyder_NHR-28_Input_L3_extraction2_seq2_aliquote_1	Snyder_NHR-28_Input_L3 extraction2_seq2 channel_1	Snyder_NHR-28_Input_L3...	OP317(official name : OP317 genotype : unc119(ed3); wgIs317(nhr-28::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-28::EGFP fusion protein is expressed in the correct nhr-28 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-28 transcription factor. made_by : R Waterston )|Snyder_NHR-28_Input_L3 extraction2_seq2 channel_1|L3	OP317(official name : ...	ChIP-Seq
SRX065725	SRA037228	Snyder_NHR-28_GFP_L3_rep1_extraction3_seq3_aliquote_1	Snyder_NHR-28_GFP_L3_rep1_extraction3_seq3_aliq...	Snyder_NHR-28_GFP_L3_rep1 extraction3_seq3 channel_1	Snyder_NHR-28_GFP_L3_r...	OP317(official name : OP317 genotype : unc119(ed3); wgIs317(nhr-28::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-28::EGFP fusion protein is expressed in the correct nhr-28 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-28 transcription factor. made_by : R Waterston )|Snyder_NHR-28_GFP_L3_rep1 extraction3_seq3 channel_1|L3	OP317(official name : ...	ChIP-Seq
SRX065726	SRA037228	Snyder_NHR-28_GFP_L3_rep2_extraction4_seq4_aliquote_1	Snyder_NHR-28_GFP_L3_rep2_extraction4_seq4_aliq...	Snyder_NHR-28_GFP_L3_rep2 extraction4_seq4 channel_1	Snyder_NHR-28_GFP_L3_r...	OP317(official name : OP317 genotype : unc119(ed3); wgIs317(nhr-28::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-28::EGFP fusion protein is expressed in the correct nhr-28 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-28 transcription factor. made_by : R Waterston )|Snyder_NHR-28_GFP_L3_rep2 extraction4_seq4 channel_1|L3	OP317(official name : ...	ChIP-Seq
SRX076077	SRA037869	Young_ctl_H3K27me3_ChIPSeq	Young_ctl_H3K27me3_ChIPSeq	H3K27me3|Whole worm, young, control, H3K27me3 ChIP	H3K27me3	N2|Whole worm, young, control, H3K27me3 ChIP|whole body	N2	ChIP-Seq
SRX076078	SRA037869	Old_ctl_H3K27me3_ChIPSeq	Old_ctl_H3K27me3_ChIPSeq	H3K27me3|Whole worm, old, control, H3K27me3 ChIP	H3K27me3	N2|Whole worm, old, control, H3K27me3 ChIP|whole body	N2	ChIP-Seq
SRX076079	SRA037869	Old_utx-1_H3K27me3_ChIPSeq	Old_utx-1_H3K27me3_ChIPSeq	H3K27me3|Whole worm, old, Utx-1 RNAi, H3K27me3 ChIP	H3K27me3	N2|Whole worm, old, Utx-1 RNAi, H3K27me3 ChIP|whole body	N2	ChIP-Seq
SRX080059	SRA039273	Ppie-1_EFL-1_YL445_3-25-10_Ad_rep2_GFP_ACGT	Ppie-1_EFL-1_YL445_3-25-10_Ad_rep2_GFP_ACGT	GFP|Ppie-1 EFL-1:GFP:FLAG whole animal	GFP	YL445|Ppie-1 EFL-1:GFP:FLAG whole animal|Young adult	YL445	ChIP-Seq
SRX080060	SRA039273	Ppie-1_EFL-1_YL445_3-25-10_Ad_rep2_Input_TGCT	Ppie-1_EFL-1_YL445_3-25-10_Ad_rep2_Input_TGCT	None|Ppie-1 EFL-1:GFP:FLAG whole animal	None	YL445|Ppie-1 EFL-1:GFP:FLAG whole animal|Young adult	YL445	ChIP-Seq
SRX080061	SRA039273	Ppie-1_EFL-1_YL445_3-31-10_Ad_rep3_GFP_TGCT	Ppie-1_EFL-1_YL445_3-31-10_Ad_rep3_GFP_TGCT	GFP|Ppie-1 EFL-1:GFP:FLAG whole animal	GFP	YL445|Ppie-1 EFL-1:GFP:FLAG whole animal|Young adult	YL445	ChIP-Seq
SRX080062	SRA039273	Ppie-1_EFL-1_YL445_3-31-10_Ad_rep3_Input_TGCT	Ppie-1_EFL-1_YL445_3-31-10_Ad_rep3_Input_TGCT	None|Ppie-1 EFL-1:GFP:FLAG whole animal	None	YL445|Ppie-1 EFL-1:GFP:FLAG whole animal|Young adult	YL445	ChIP-Seq
SRX080063	SRA039273	Ppie-1_DPL-1_YL390_12-31-09_Ad_rep1__GFP_GTAT	Ppie-1_DPL-1_YL390_12-31-09_Ad_rep1__GFP_GTAT	GFP|Ppie-1_DPL-1:GFP:FLAG whole animal	GFP	YL390|Ppie-1_DPL-1:GFP:FLAG whole animal|Young adult	YL390	ChIP-Seq
SRX080064	SRA039273	Ppie-1_DPL-1_YL390_12-31-09_Ad_rep1_Input_GTAT	Ppie-1_DPL-1_YL390_12-31-09_Ad_rep1_Input_GTAT	None|Ppie-1_DPL-1:GFP:FLAG whole animal	None	YL390|Ppie-1_DPL-1:GFP:FLAG whole animal|Young adult	YL390	ChIP-Seq
SRX080065	SRA039273	Ppie-1__DPL-1_YL390_4-23-10_Ad_rep4_GFP_ACGT	Ppie-1__DPL-1_YL390_4-23-10_Ad_rep4_GFP_ACGT	GFP|Ppie-1_DPL-1:GFP:FLAG whole animal	GFP	YL390|Ppie-1_DPL-1:GFP:FLAG whole animal|Young adult	YL390	ChIP-Seq
SRX080066	SRA039273	Ppie-1__DPL-1_YL390_4-23-10_Ad_rep4_Input_ACGT	Ppie-1__DPL-1_YL390_4-23-10_Ad_rep4_Input_ACGT	None|Ppie-1_DPL-1:GFP:FLAG whole animal	None	YL390|Ppie-1_DPL-1:GFP:FLAG whole animal|Young adult	YL390	ChIP-Seq
SRX080067	SRA039273	Ppie-1_LIN-35_YL402-3-31-10_Ad_rep2.1_GFP_TGCT	Ppie-1_LIN-35_YL402-3-31-10_Ad_rep2.1_GFP_TGCT	GFP|Ppie-1 LIN-35:GFP:FLAG whole animal	GFP	YL402|Ppie-1 LIN-35:GFP:FLAG whole animal|Young adult	YL402	ChIP-Seq
SRX080068	SRA039273	Ppie-1_LIN-35_YL402-3-31-10_Ad_rep2.2_GFP_TGCT	Ppie-1_LIN-35_YL402-3-31-10_Ad_rep2.2_GFP_TGCT	GFP|Ppie-1 LIN-35:GFP:FLAG whole animal	GFP	YL402|Ppie-1 LIN-35:GFP:FLAG whole animal|Young adult	YL402	ChIP-Seq
SRX080069	SRA039273	Ppie-1_LIN-35_YL402-3-31-10_Ad_rep2_Input_TGCT	Ppie-1_LIN-35_YL402-3-31-10_Ad_rep2_Input_TGCT	None|Ppie-1 LIN-35:GFP:FLAG whole animal	None	YL402|Ppie-1 LIN-35:GFP:FLAG whole animal|Young adult	YL402	ChIP-Seq
SRX080070	SRA039273	Ppie-1_LIN-35_YL402_4-2-10_Ad_rep3__GFP_TGCT	Ppie-1_LIN-35_YL402_4-2-10_Ad_rep3__GFP_TGCT	GFP|Ppie-1 LIN-35:GFP:FLAG whole animal	GFP	YL402|Ppie-1 LIN-35:GFP:FLAG whole animal|Young adult	YL402	ChIP-Seq
SRX080071	SRA039273	Ppie-1_LIN-35_YL402_4-2-10_Ad_rep3_Input_TGCT	Ppie-1_LIN-35_YL402_4-2-10_Ad_rep3_Input_TGCT	None|Ppie-1 LIN-35:GFP:FLAG whole animal	None	YL402|Ppie-1 LIN-35:GFP:FLAG whole animal|Young adult	YL402	ChIP-Seq
SRX080072	SRA039273	Pmex-5_LIN-35_YL468_10-6-10_yAd_rep1_GFP_GTAT	Pmex-5_LIN-35_YL468_10-6-10_yAd_rep1_GFP_GTAT	GFP|Pmex-5 LIN-35:GFP:FLAG whole animal	GFP	YL468|Pmex-5 LIN-35:GFP:FLAG whole animal|Young adult	YL468	ChIP-Seq
SRX080073	SRA039273	Pmex-5_LIN-35_YL468_10-6-10_yAd_rep1_Input_GTAT	Pmex-5_LIN-35_YL468_10-6-10_yAd_rep1_Input_GTAT	None|Pmex-5 LIN-35:GFP:FLAG whole animal	None	YL468|Pmex-5 LIN-35:GFP:FLAG whole animal|Young adult	YL468	ChIP-Seq
SRX080074	SRA039273	Pmex-5_LIN-35_YL468_10_18_10_yAd_rep2_GFP_CATT	Pmex-5_LIN-35_YL468_10_18_10_yAd_rep2_GFP_CATT	GFP|Pmex-5 LIN-35:GFP:FLAG whole animal	GFP	YL468|Pmex-5 LIN-35:GFP:FLAG whole animal|Young adult	YL468	ChIP-Seq
SRX080075	SRA039273	Pmex-5_LIN-35_YL468_10_18_10_yAd_rep2_Input_CATT	Pmex-5_LIN-35_YL468_10_18_10_yAd_rep2_Input_CATT	None|Pmex-5 LIN-35:GFP:FLAG whole animal	None	YL468|Pmex-5 LIN-35:GFP:FLAG whole animal|Young adult	YL468	ChIP-Seq
SRX080076	SRA039273	Pefl-1_EFL-1_YL424_3-1-10_L1_rep1_GFP_ACGT	Pefl-1_EFL-1_YL424_3-1-10_L1_rep1_GFP_ACGT	GFP|Pefl-1 EFL-1:GFP:FLAG whole animal	GFP	YL424|Pefl-1 EFL-1:GFP:FLAG whole animal|L1	YL424	ChIP-Seq
SRX080077	SRA039273	Pefl-1_EFL-1_YL424_3-1-10_L1_rep1_Input_TGCT	Pefl-1_EFL-1_YL424_3-1-10_L1_rep1_Input_TGCT	None|Pefl-1 EFL-1:GFP:FLAG whole animal	None	YL424|Pefl-1 EFL-1:GFP:FLAG whole animal|L1	YL424	ChIP-Seq
SRX080078	SRA039273	Pefl-1_EFL-1_YL424_4-30-10_L1_rep2__GFP_CATT	Pefl-1_EFL-1_YL424_4-30-10_L1_rep2__GFP_CATT	GFP|Pefl-1 EFL-1:GFP:FLAG whole animal	GFP	YL424|Pefl-1 EFL-1:GFP:FLAG whole animal|L1	YL424	ChIP-Seq
SRX080079	SRA039273	Pefl-1_EFL-1_YL424_4-30-10_L1_rep2__Input_CATT	Pefl-1_EFL-1_YL424_4-30-10_L1_rep2__Input_CATT	None|Pefl-1 EFL-1:GFP:FLAG whole animal	None	YL424|Pefl-1 EFL-1:GFP:FLAG whole animal|L1	YL424	ChIP-Seq
SRX080080	SRA039273	Pdpl-1_DPL-1_YL425_2-14-10_L1_rep1_GFP__GTAT	Pdpl-1_DPL-1_YL425_2-14-10_L1_rep1_GFP__GTAT	GFP|Pdpl-1_DPL-1:GFP:FLAG whole animal	GFP	YL425|Pdpl-1_DPL-1:GFP:FLAG whole animal|L1	YL425	ChIP-Seq
SRX080081	SRA039273	Pdpl-1_DPL-1_YL425_2-14-10_L1_rep1_Input_CATT	Pdpl-1_DPL-1_YL425_2-14-10_L1_rep1_Input_CATT	None|Pdpl-1_DPL-1:GFP:FLAG whole animal	None	YL425|Pdpl-1_DPL-1:GFP:FLAG whole animal|L1	YL425	ChIP-Seq
SRX080082	SRA039273	Pdpl-1_DPL-1_YL425_5-3-10_L1_rep2__GFP__GTAT	Pdpl-1_DPL-1_YL425_5-3-10_L1_rep2__GFP__GTAT	GFP|Pdpl-1_DPL-1:GFP:FLAG whole animal	GFP	YL425|Pdpl-1_DPL-1:GFP:FLAG whole animal|L1	YL425	ChIP-Seq
SRX080083	SRA039273	Pdpl-1_DPL-1_YL425_5-3-10_L1_rep2__Input__GTAT	Pdpl-1_DPL-1_YL425_5-3-10_L1_rep2__Input__GTAT	None|Pdpl-1_DPL-1:GFP:FLAG whole animal	None	YL425|Pdpl-1_DPL-1:GFP:FLAG whole animal|L1	YL425	ChIP-Seq
SRX080084	SRA039273	Plin-35_LIN-35_YL409_4-9-10_L1_rep1.1_GFP__GTAT	Plin-35_LIN-35_YL409_4-9-10_L1_rep1.1_GFP__GTAT	GFP|Plin-35_LIN-35:GFP:FLAG whole animal	GFP	YL409|Plin-35_LIN-35:GFP:FLAG whole animal|L1	YL409	ChIP-Seq
SRX080085	SRA039273	Plin-35_LIN-35_YL409_4-9-10_L1_rep1.2_GFP__GTAT	Plin-35_LIN-35_YL409_4-9-10_L1_rep1.2_GFP__GTAT	GFP|Plin-35_LIN-35:GFP:FLAG whole animal	GFP	YL409|Plin-35_LIN-35:GFP:FLAG whole animal|L1	YL409	ChIP-Seq
SRX080086	SRA039273	Plin-35_LIN-35_YL409_4-9-10_L1_rep1_Input__GTAT	Plin-35_LIN-35_YL409_4-9-10_L1_rep1_Input__GTAT	None|Plin-35_LIN-35:GFP:FLAG whole animal	None	YL409|Plin-35_LIN-35:GFP:FLAG whole animal|L1	YL409	ChIP-Seq
SRX080087	SRA039273	Plin-35_LIN-35_YL409_4-12-10_L1_rep2.1_GFP_CATT	Plin-35_LIN-35_YL409_4-12-10_L1_rep2.1_GFP_CATT	GFP|Plin-35_LIN-35:GFP:FLAG whole animal	GFP	YL409|Plin-35_LIN-35:GFP:FLAG whole animal|L1	YL409	ChIP-Seq
SRX080088	SRA039273	Plin-35_LIN-35_YL409_4-12-10_L1_rep2.2_GFP_CATT	Plin-35_LIN-35_YL409_4-12-10_L1_rep2.2_GFP_CATT	GFP|Plin-35_LIN-35:GFP:FLAG whole animal	GFP	YL409|Plin-35_LIN-35:GFP:FLAG whole animal|L1	YL409	ChIP-Seq
SRX080089	SRA039273	Plin-35_LIN-35_YL409_4-12-10_L1_rep2_Input_CATT	Plin-35_LIN-35_YL409_4-12-10_L1_rep2_Input_CATT	None|Plin-35_LIN-35:GFP:FLAG whole animal	None	YL409|Plin-35_LIN-35:GFP:FLAG whole animal|L1	YL409	ChIP-Seq
SRX080090	SRA039273	pGES-1_EFL-1_YL418_5-31-10_L1_rep2_GFP_CATT	pGES-1_EFL-1_YL418_5-31-10_L1_rep2_GFP_CATT	GFP|pGES-1 EFL-1:GFP:FLAG whole animal	GFP	YL418|pGES-1 EFL-1:GFP:FLAG whole animal|L1	YL418	ChIP-Seq
SRX080091	SRA039273	pGES-1_EFL-1_YL418_5-31-10_L1_rep2_Input_CATT	pGES-1_EFL-1_YL418_5-31-10_L1_rep2_Input_CATT	None|pGES-1 EFL-1:GFP:FLAG whole animal	None	YL418|pGES-1 EFL-1:GFP:FLAG whole animal|L1	YL418	ChIP-Seq
SRX080092	SRA039273	pGES-1_EFL-1_YL418_6-21-10_L1_rep3__GFP_ACGT	pGES-1_EFL-1_YL418_6-21-10_L1_rep3__GFP_ACGT	GFP|pGES-1 EFL-1:GFP:FLAG whole animal	GFP	YL418|pGES-1 EFL-1:GFP:FLAG whole animal|L1	YL418	ChIP-Seq
SRX080093	SRA039273	pGES-1_EFL-1_YL418_6-21-10_L1_rep3__Input_TGCT	pGES-1_EFL-1_YL418_6-21-10_L1_rep3__Input_TGCT	None|pGES-1 EFL-1:GFP:FLAG whole animal	None	YL418|pGES-1 EFL-1:GFP:FLAG whole animal|L1	YL418	ChIP-Seq
SRX080094	SRA039273	pGES-1_DPL-1_YL448_3-22-10_L1_rep1_GFP_TGCT	pGES-1_DPL-1_YL448_3-22-10_L1_rep1_GFP_TGCT	GFP|pGES-1 DPL-1:GFP:FLAG whole animal	GFP	YL448|pGES-1 DPL-1:GFP:FLAG whole animal|L1	YL448	ChIP-Seq
SRX080095	SRA039273	pGES-1_DPL-1_YL448_3-22-10_L1_rep1_Input_TGCT	pGES-1_DPL-1_YL448_3-22-10_L1_rep1_Input_TGCT	None|pGES-1 DPL-1:GFP:FLAG whole animal	None	YL448|pGES-1 DPL-1:GFP:FLAG whole animal|L1	YL448	ChIP-Seq
SRX080096	SRA039273	pGES-1_DPL-1_YL448_6-7-10__L1_rep2_GFP__GTAT	pGES-1_DPL-1_YL448_6-7-10__L1_rep2_GFP__GTAT	GFP|pGES-1 DPL-1:GFP:FLAG whole animal	GFP	YL448|pGES-1 DPL-1:GFP:FLAG whole animal|L1	YL448	ChIP-Seq
SRX080097	SRA039273	pGES-1_DPL-1_YL448_6-7-10__L1_rep2_Input__GTAT	pGES-1_DPL-1_YL448_6-7-10__L1_rep2_Input__GTAT	None|pGES-1 DPL-1:GFP:FLAG whole animal	None	YL448|pGES-1 DPL-1:GFP:FLAG whole animal|L1	YL448	ChIP-Seq
SRX080098	SRA039273	pGES-1_LIN-35_YL398_3-4-10_L1_rep1__GFP__GTAT	pGES-1_LIN-35_YL398_3-4-10_L1_rep1__GFP__GTAT	GFP|pGES-1 LIN-35:GFP:FLAG whole animal	GFP	YL398|pGES-1 LIN-35:GFP:FLAG whole animal|L1	YL398	ChIP-Seq
SRX080099	SRA039273	pGES-1_LIN-35_YL398_3-4-10_L1_rep1__Input__GTAT	pGES-1_LIN-35_YL398_3-4-10_L1_rep1__Input__GTAT	None|pGES-1 LIN-35:GFP:FLAG whole animal	None	YL398|pGES-1 LIN-35:GFP:FLAG whole animal|L1	YL398	ChIP-Seq
SRX080100	SRA039273	pGES-1_LIN-35_YL398_6-14-10_L1_rep2__GFP__GTAT	pGES-1_LIN-35_YL398_6-14-10_L1_rep2__GFP__GTAT	GFP|pGES-1 LIN-35:GFP:FLAG whole animal	GFP	YL398|pGES-1 LIN-35:GFP:FLAG whole animal|L1	YL398	ChIP-Seq
SRX080101	SRA039273	pGES-1_LIN-35_YL398_6-14-10_L1_rep2__Input__CATT	pGES-1_LIN-35_YL398_6-14-10_L1_rep2__Input__CATT	None|pGES-1 LIN-35:GFP:FLAG whole animal	None	YL398|pGES-1 LIN-35:GFP:FLAG whole animal|L1	YL398	ChIP-Seq
SRX080102	SRA039273	pGES-1__HPL-2_YL416_3-4-10_L1_rep1_GFP_ACGT	pGES-1__HPL-2_YL416_3-4-10_L1_rep1_GFP_ACGT	GFP|pGES-1 HPL-2:GFP:FLAG whole animal	GFP	YL416|pGES-1 HPL-2:GFP:FLAG whole animal|L1	YL416	ChIP-Seq
SRX080103	SRA039273	pGES-1__HPL-2_YL416_3-4-10_L1_rep1_Input_ACGT	pGES-1__HPL-2_YL416_3-4-10_L1_rep1_Input_ACGT	None|pGES-1 HPL-2:GFP:FLAG whole animal	None	YL416|pGES-1 HPL-2:GFP:FLAG whole animal|L1	YL416	ChIP-Seq
SRX080104	SRA039273	pGES-1__HPL-2_YL416_3-4-10_L1_rep2_GFP_ACGT	pGES-1__HPL-2_YL416_3-4-10_L1_rep2_GFP_ACGT	GFP|pGES-1 HPL-2:GFP:FLAG whole animal	GFP	YL416|pGES-1 HPL-2:GFP:FLAG whole animal|L1	YL416	ChIP-Seq
SRX080105	SRA039273	pGES-1__HPL-2_YL416_3-4-10_L1_rep2_Input_ACGT	pGES-1__HPL-2_YL416_3-4-10_L1_rep2_Input_ACGT	None|pGES-1 HPL-2:GFP:FLAG whole animal	None	YL416|pGES-1 HPL-2:GFP:FLAG whole animal|L1	YL416	ChIP-Seq
SRX080106	SRA039273	pGES-1__HPL-2_YL416_3-4-10_L1_rep3_GFP_ACGT	pGES-1__HPL-2_YL416_3-4-10_L1_rep3_GFP_ACGT	GFP|pGES-1 HPL-2:GFP:FLAG whole animal	GFP	YL416|pGES-1 HPL-2:GFP:FLAG whole animal|L1	YL416	ChIP-Seq
SRX094473	SRA045439	seq-AB9050_H3K36me3_N2_L3_1	seq-AB9050_H3K36me3_N2_L3_1	AB9050 H3K36me3|whole body	AB9050 H3K36me3	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX094474	SRA045439	seq-NA_N2_L3_1_E77_input_DNA	seq-NA_N2_L3_1_E77_input_DNA	Control sample from L3 stage N2 worms, whole body	Control sample from L3...	N2|Control sample from L3 stage N2 worms, whole body|whole body|L3	N2	ChIP-Seq
SRX094475	SRA045439	seq-AB9050_H3K36me3_N2_L3_7	seq-AB9050_H3K36me3_N2_L3_7	AB9050 H3K36me3|whole body	AB9050 H3K36me3	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX094514	SRA045503	seq-JL00001_DPY27_N2_L3_2	seq-JL00001_DPY27_N2_L3_2	JL00001 DPY27|whole body	JL00001 DPY27	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX094515	SRA045503	seq-JL00001_DPY27_N2_L3_3	seq-JL00001_DPY27_N2_L3_3	JL00001 DPY27|whole body	JL00001 DPY27	N2|whole body|whole body|L3	N2	ChIP-Seq
SRX1007130	SRA262045	input-L1;_Caenorhabditis_elegans;_ChIP-Seq	input-L1;_Caenorhabditis_elegans;_ChIP-Seq	supernatant lysates|wild type worms	supernatant lysates	N2|wild type worms|L1-L2	N2	ChIP-Seq
SRX1007131	SRA262045	N2-L1;_Caenorhabditis_elegans;_ChIP-Seq	N2-L1;_Caenorhabditis_elegans;_ChIP-Seq	4H8|wild type worms	4H8	N2|wild type worms|L1-L2	N2	ChIP-Seq
SRX1007132	SRA262045	sydn-L1;_Caenorhabditis_elegans;_ChIP-Seq	sydn-L1;_Caenorhabditis_elegans;_ChIP-Seq	4H8|sydn-1(0) worms	4H8	sydn-1(0)|sydn-1(0) worms|L1-L2	sydn-1(0)	ChIP-Seq
SRX1007133	SRA262045	ssup-sydn-L1;_Caenorhabditis_elegans;_ChIP-Seq	ssup-sydn-L1;_Caenorhabditis_elegans;_ChIP-Seq	4H8|ssup-72(0); sydn-1(0) worms	4H8	ssup-72(0); sydn-1(0)|ssup-72(0); sydn-1(0) worms|L1-L2	ssup-72(0); sydn-1(0)	ChIP-Seq
SRX1007134	SRA262045	input-L2;_Caenorhabditis_elegans;_ChIP-Seq	input-L2;_Caenorhabditis_elegans;_ChIP-Seq	supernatant lysates|wild type worms	supernatant lysates	N2|wild type worms|L2-L3	N2	ChIP-Seq
SRX1007135	SRA262045	N2-L2;_Caenorhabditis_elegans;_ChIP-Seq	N2-L2;_Caenorhabditis_elegans;_ChIP-Seq	4H8|wild type worms	4H8	N2|wild type worms|L2-L3	N2	ChIP-Seq
SRX1007136	SRA262045	sydn-L2;_Caenorhabditis_elegans;_ChIP-Seq	sydn-L2;_Caenorhabditis_elegans;_ChIP-Seq	4H8|sydn-1(0) worms	4H8	sydn-1(0)|sydn-1(0) worms|L2-L3	sydn-1(0)	ChIP-Seq
SRX1007137	SRA262045	ssup-L2;_Caenorhabditis_elegans;_ChIP-Seq	ssup-L2;_Caenorhabditis_elegans;_ChIP-Seq	4H8|ssup-72(0) worms	4H8	ssup-72(0)|ssup-72(0) worms|L2-L3	ssup-72(0)	ChIP-Seq
SRX1007138	SRA262045	ssup-sydn-L2;_Caenorhabditis_elegans;_ChIP-Seq	ssup-sydn-L2;_Caenorhabditis_elegans;_ChIP-Seq	4H8|ssup-72(0); sydn-1(0) worms	4H8	ssup-72(0); sydn-1(0)|ssup-72(0); sydn-1(0) worms|L2-L3	ssup-72(0); sydn-1(0)	ChIP-Seq
SRX1010104	SRA263996	R1.CE.8E.ChIP;_Caenorhabditis_elegans;_ChIP-Seq	R1.CE.8E.ChIP;_Caenorhabditis_elegans;_ChIP-Seq	4H8 (Covance)|8E syncrhonized embryos	4H8 (Covance)	N2|8E syncrhonized embryos	N2	ChIP-Seq
SRX1010106	SRA263996	R2.CE.8E.ChIP;_Caenorhabditis_elegans;_ChIP-Seq	R2.CE.8E.ChIP;_Caenorhabditis_elegans;_ChIP-Seq	4H8 (Covance)|8E syncrhonized embryos	4H8 (Covance)	N2|8E syncrhonized embryos	N2	ChIP-Seq
SRX1010107	SRA263996	R2.CE.8E.Input;_Caenorhabditis_elegans;_ChIP-Seq	R2.CE.8E.Input;_Caenorhabditis_elegans;_ChIP-Seq	none, Input|8E syncrhonized embryos	none, Input	N2|8E syncrhonized embryos	N2	ChIP-Seq
SRX1010108	SRA263996	R1.CE.BE.ChIP;_Caenorhabditis_elegans;_ChIP-Seq	R1.CE.BE.ChIP;_Caenorhabditis_elegans;_ChIP-Seq	4H8 (Covance)|bean syncrhonized embryos	4H8 (Covance)	N2|bean syncrhonized embryos	N2	ChIP-Seq
SRX1010109	SRA263996	R1.CE.BE.Input;_Caenorhabditis_elegans;_ChIP-Seq	R1.CE.BE.Input;_Caenorhabditis_elegans;_ChIP-Seq	none, Input|bean syncrhonized embryos	none, Input	N2|bean syncrhonized embryos	N2	ChIP-Seq
SRX1030169	SRA247938	ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	6mA|whole worm WT gDNA	6mA	whole worm WT gDNA|WT (N2) mixed stage worms	whole worm WT gDNA	ChIP-Seq
SRX1030170	SRA247938	ChIP-Seq_(input);_Caenorhabditis_elegans;_ChIP-Seq	ChIP-Seq_(input);_Caenorhabditis_elegans;_ChIP-Seq	none, input|whole worm WT gDNA	none, input	whole worm WT gDNA|WT (N2) mixed stage worms	whole worm WT gDNA	ChIP-Seq
SRX105309	SRA047998	seq-NA_N2_LTemb_Lemb2	seq-NA_N2_LTemb_Lemb2	whole body	whole body	N2|whole body|L3	N2	ChIP-Seq
SRX105310	SRA047998	seq-NA_N2_LTemb_Lemb3A	seq-NA_N2_LTemb_Lemb3A	whole body	whole body	N2|whole body|L3	N2	ChIP-Seq
SRX105311	SRA047998	seq-NA_N2_LTemb_Lemb3B	seq-NA_N2_LTemb_Lemb3B	whole body	whole body	N2|whole body|L3	N2	ChIP-Seq
SRX105312	SRA047998	seq-NA_N2_LTemb_Lemb4B	seq-NA_N2_LTemb_Lemb4B	whole body	whole body	N2|whole body|L3	N2	ChIP-Seq
SRX105313	SRA047998	seq-NA_N2_LTemb_Lemb4C	seq-NA_N2_LTemb_Lemb4C	whole body	whole body	N2|whole body|L3	N2	ChIP-Seq
SRX1078705	SRA275262	flag_a_chip;_Caenorhabditis_elegans;_ChIP-Seq	flag_a_chip;_Caenorhabditis_elegans;_ChIP-Seq	Whole animal	Whole animal	pJK1728|Whole animal|L4 larva	pJK1728	ChIP-Seq
SRX1078706	SRA275262	flag_a_input;_Caenorhabditis_elegans;_ChIP-Seq	flag_a_input;_Caenorhabditis_elegans;_ChIP-Seq	Whole animal	Whole animal	pJK1728|Whole animal|L4 larva	pJK1728	ChIP-Seq
SRX1078707	SRA275262	flag_b_chip;_Caenorhabditis_elegans;_ChIP-Seq	flag_b_chip;_Caenorhabditis_elegans;_ChIP-Seq	Whole animal	Whole animal	pJK1728|Whole animal|L4 larva	pJK1728	ChIP-Seq
SRX1078708	SRA275262	flag_b_input;_Caenorhabditis_elegans;_ChIP-Seq	flag_b_input;_Caenorhabditis_elegans;_ChIP-Seq	Whole animal	Whole animal	pJK1728|Whole animal|L4 larva	pJK1728	ChIP-Seq
SRX1078709	SRA275262	flag_c_chip;_Caenorhabditis_elegans;_ChIP-Seq	flag_c_chip;_Caenorhabditis_elegans;_ChIP-Seq	Whole animal	Whole animal	pJK1728|Whole animal|L4 larva	pJK1728	ChIP-Seq
SRX1078710	SRA275262	flag_c_input;_Caenorhabditis_elegans;_ChIP-Seq	flag_c_input;_Caenorhabditis_elegans;_ChIP-Seq	Whole animal	Whole animal	pJK1728|Whole animal|L4 larva	pJK1728	ChIP-Seq
SRX1078711	SRA275262	lag_a_chip;_Caenorhabditis_elegans;_ChIP-Seq	lag_a_chip;_Caenorhabditis_elegans;_ChIP-Seq	Whole animal	Whole animal	pJK1689|Whole animal|L4 larva	pJK1689	ChIP-Seq
SRX1078712	SRA275262	lag_a_input;_Caenorhabditis_elegans;_ChIP-Seq	lag_a_input;_Caenorhabditis_elegans;_ChIP-Seq	Whole animal	Whole animal	pJK1689|Whole animal|L4 larva	pJK1689	ChIP-Seq
SRX1078713	SRA275262	lag_b_chip;_Caenorhabditis_elegans;_ChIP-Seq	lag_b_chip;_Caenorhabditis_elegans;_ChIP-Seq	Whole animal	Whole animal	pJK1689|Whole animal|L4 larva	pJK1689	ChIP-Seq
SRX1078714	SRA275262	lag_b_input;_Caenorhabditis_elegans;_ChIP-Seq	lag_b_input;_Caenorhabditis_elegans;_ChIP-Seq	Whole animal	Whole animal	pJK1689|Whole animal|L4 larva	pJK1689	ChIP-Seq
SRX1078715	SRA275262	lag_c_chip;_Caenorhabditis_elegans;_ChIP-Seq	lag_c_chip;_Caenorhabditis_elegans;_ChIP-Seq	Whole animal	Whole animal	pJK1689|Whole animal|L4 larva	pJK1689	ChIP-Seq
SRX1078716	SRA275262	lag_c_input;_Caenorhabditis_elegans;_ChIP-Seq	lag_c_input;_Caenorhabditis_elegans;_ChIP-Seq	Whole animal	Whole animal	pJK1689|Whole animal|L4 larva	pJK1689	ChIP-Seq
SRX1078717	SRA275262	lag_e_chip;_Caenorhabditis_elegans;_ChIP-Seq	lag_e_chip;_Caenorhabditis_elegans;_ChIP-Seq	Whole animal	Whole animal	pJK1689|Whole animal|L4 larva	pJK1689	ChIP-Seq
SRX1078718	SRA275262	lag_e_input;_Caenorhabditis_elegans;_ChIP-Seq	lag_e_input;_Caenorhabditis_elegans;_ChIP-Seq	Whole animal	Whole animal	pJK1689|Whole animal|L4 larva	pJK1689	ChIP-Seq
SRX1078719	SRA275262	myc_a_chip;_Caenorhabditis_elegans;_ChIP-Seq	myc_a_chip;_Caenorhabditis_elegans;_ChIP-Seq	Whole animal	Whole animal	pJK1728|Whole animal|L4 larva	pJK1728	ChIP-Seq
SRX1078720	SRA275262	myc_a_input;_Caenorhabditis_elegans;_ChIP-Seq	myc_a_input;_Caenorhabditis_elegans;_ChIP-Seq	Whole animal	Whole animal	pJK1728|Whole animal|L4 larva	pJK1728	ChIP-Seq
SRX1078721	SRA275262	myc_c_chip;_Caenorhabditis_elegans;_ChIP-Seq	myc_c_chip;_Caenorhabditis_elegans;_ChIP-Seq	Whole animal	Whole animal	pJK1728|Whole animal|L4 larva	pJK1728	ChIP-Seq
SRX1078722	SRA275262	myc_c_input;_Caenorhabditis_elegans;_ChIP-Seq	myc_c_input;_Caenorhabditis_elegans;_ChIP-Seq	Whole animal	Whole animal	pJK1728|Whole animal|L4 larva	pJK1728	ChIP-Seq
SRX1078723	SRA275262	myc_d_chip;_Caenorhabditis_elegans;_ChIP-Seq	myc_d_chip;_Caenorhabditis_elegans;_ChIP-Seq	Whole animal	Whole animal	pJK1728|Whole animal|L4 larva	pJK1728	ChIP-Seq
SRX1078724	SRA275262	myc_d_input;_Caenorhabditis_elegans;_ChIP-Seq	myc_d_input;_Caenorhabditis_elegans;_ChIP-Seq	Whole animal	Whole animal	pJK1728|Whole animal|L4 larva	pJK1728	ChIP-Seq
SRX1078725	SRA275262	nicd_a_chip;_Caenorhabditis_elegans;_ChIP-Seq	nicd_a_chip;_Caenorhabditis_elegans;_ChIP-Seq	Whole animal	Whole animal	pJK1662|Whole animal|L4 larva	pJK1662	ChIP-Seq
SRX1078726	SRA275262	nicd_a_input;_Caenorhabditis_elegans;_ChIP-Seq	nicd_a_input;_Caenorhabditis_elegans;_ChIP-Seq	Whole animal	Whole animal	pJK1662|Whole animal|L4 larva	pJK1662	ChIP-Seq
SRX1078727	SRA275262	nicd_b_chip;_Caenorhabditis_elegans;_ChIP-Seq	nicd_b_chip;_Caenorhabditis_elegans;_ChIP-Seq	Whole animal	Whole animal	pJK1662|Whole animal|L4 larva	pJK1662	ChIP-Seq
SRX1078728	SRA275262	nicd_b_input;_Caenorhabditis_elegans;_ChIP-Seq	nicd_b_input;_Caenorhabditis_elegans;_ChIP-Seq	Whole animal	Whole animal	pJK1662|Whole animal|L4 larva	pJK1662	ChIP-Seq
SRX1078729	SRA275262	nicd_c_chip;_Caenorhabditis_elegans;_ChIP-Seq	nicd_c_chip;_Caenorhabditis_elegans;_ChIP-Seq	Whole animal	Whole animal	pJK1662|Whole animal|L4 larva	pJK1662	ChIP-Seq
SRX1078730	SRA275262	nicd_c_input;_Caenorhabditis_elegans;_ChIP-Seq	nicd_c_input;_Caenorhabditis_elegans;_ChIP-Seq	Whole animal	Whole animal	pJK1662|Whole animal|L4 larva	pJK1662	ChIP-Seq
SRX1078731	SRA275262	nicd_d_chip;_Caenorhabditis_elegans;_ChIP-Seq	nicd_d_chip;_Caenorhabditis_elegans;_ChIP-Seq	Whole animal	Whole animal	pJK1662|Whole animal|L4 larva	pJK1662	ChIP-Seq
SRX1078732	SRA275262	nicd_d_input;_Caenorhabditis_elegans;_ChIP-Seq	nicd_d_input;_Caenorhabditis_elegans;_ChIP-Seq	Whole animal	Whole animal	pJK1662|Whole animal|L4 larva	pJK1662	ChIP-Seq
SRX1099836	SRA250443	AMA1_N2_MxEmb_Rep3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	AMA1_N2_MxEmb_Rep3_ChIPSeq;_Caenorhabditis_eleg...	AMA1 Q2357 Rabbit polyclonal is against the antigen DLVLDVEKCKYGMEIPQNVVMGGGFYGSFAGSPSNREFSPAHSPWNSGVTPTYAGAAWSPTTGGMSPGAGFSPAGNTDGGASPFNEGGWSPASPGDPLGA May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	AMA1 Q2357 Rabbit poly...	N2|whole worms|embryo	N2	ChIP-Seq
SRX1099837	SRA250443	AMA1_CB428_MxEmb_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	AMA1_CB428_MxEmb_Rep1_ChIPSeq;_Caenorhabditis_e...	AMA1 Q2357 Rabbit polyclonal is against the antigen DLVLDVEKCKYGMEIPQNVVMGGGFYGSFAGSPSNREFSPAHSPWNSGVTPTYAGAAWSPTTGGMSPGAGFSPAGNTDGGASPFNEGGWSPASPGDPLGA May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	AMA1 Q2357 Rabbit poly...	CB428|whole worms|embryo	CB428	ChIP-Seq
SRX1099838	SRA250443	AMA1_CB428_MxEmb_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	AMA1_CB428_MxEmb_Rep2_ChIPSeq;_Caenorhabditis_e...	AMA1 Q2357 Rabbit polyclonal is against the antigen DLVLDVEKCKYGMEIPQNVVMGGGFYGSFAGSPSNREFSPAHSPWNSGVTPTYAGAAWSPTTGGMSPGAGFSPAGNTDGGASPFNEGGWSPASPGDPLGA May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	AMA1 Q2357 Rabbit poly...	CB428|whole worms|embryo	CB428	ChIP-Seq
SRX1099839	SRA250443	AMA1_CB428_MxEmb_Rep3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	AMA1_CB428_MxEmb_Rep3_ChIPSeq;_Caenorhabditis_e...	AMA1 Q2357 Rabbit polyclonal is against the antigen DLVLDVEKCKYGMEIPQNVVMGGGFYGSFAGSPSNREFSPAHSPWNSGVTPTYAGAAWSPTTGGMSPGAGFSPAGNTDGGASPFNEGGWSPASPGDPLGA May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	AMA1 Q2357 Rabbit poly...	CB428|whole worms|embryo	CB428	ChIP-Seq
SRX1099840	SRA250443	AMA1_SET4_MxEmb_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	AMA1_SET4_MxEmb_Rep1_ChIPSeq;_Caenorhabditis_el...	AMA1 Q2357 Rabbit polyclonal is against the antigen DLVLDVEKCKYGMEIPQNVVMGGGFYGSFAGSPSNREFSPAHSPWNSGVTPTYAGAAWSPTTGGMSPGAGFSPAGNTDGGASPFNEGGWSPASPGDPLGA May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	AMA1 Q2357 Rabbit poly...	SET4|whole worms|embryo	SET4	ChIP-Seq
SRX1099841	SRA250443	AMA1_SET4_MxEmb_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	AMA1_SET4_MxEmb_Rep2_ChIPSeq;_Caenorhabditis_el...	AMA1 Q2357 Rabbit polyclonal is against the antigen DLVLDVEKCKYGMEIPQNVVMGGGFYGSFAGSPSNREFSPAHSPWNSGVTPTYAGAAWSPTTGGMSPGAGFSPAGNTDGGASPFNEGGWSPASPGDPLGA May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	AMA1 Q2357 Rabbit poly...	SET4|whole worms|embryo	SET4	ChIP-Seq
SRX1099842	SRA250443	Input_SET4_MxEmb_Rep4;_Caenorhabditis_elegans;_ChIP-Seq	Input_SET4_MxEmb_Rep4;_Caenorhabditis_elegans;_...	none (input)|whole worms	none (input)	SET4|whole worms|embryo	SET4	ChIP-Seq
SRX1132912	SRA281912	EO025_rep1_ELT2;_Caenorhabditis_elegans;_ChIP-Seq	EO025_rep1_ELT2;_Caenorhabditis_elegans;_ChIP-Seq	a-ELT-2 (455-2A4)|L3 staged worms_ELT2_ChIP-seq	a-ELT-2 (455-2A4)	N2|L3 staged worms_ELT2_ChIP-seq|L3 staged worms	N2	ChIP-Seq
SRX1132913	SRA281912	EO027_rep1_IgG;_Caenorhabditis_elegans;_ChIP-Seq	EO027_rep1_IgG;_Caenorhabditis_elegans;_ChIP-Seq	IgG|L3 staged worms_IgG_ChIP-seq	IgG	N2|L3 staged worms_IgG_ChIP-seq|L3 staged worms	N2	ChIP-Seq
SRX1132914	SRA281912	EO028_rep1_input;_Caenorhabditis_elegans;_ChIP-Seq	EO028_rep1_input;_Caenorhabditis_elegans;_ChIP-Seq	L3 staged worms_input	L3 staged worms_input	N2|L3 staged worms_input|L3 staged worms	N2	ChIP-Seq
SRX1132915	SRA281912	EO036_rep2_H3K4me3;_Caenorhabditis_elegans;_ChIP-Seq	EO036_rep2_H3K4me3;_Caenorhabditis_elegans;_ChI...	a-H3K4me3 (WAKO 305-34819)|L3 staged worms_H3K4me3_ChIP-seq	a-H3K4me3 (WAKO 305-34...	N2|L3 staged worms_H3K4me3_ChIP-seq|L3 staged worms	N2	ChIP-Seq
SRX1132916	SRA281912	EO037_rep2_ELT2;_Caenorhabditis_elegans;_ChIP-Seq	EO037_rep2_ELT2;_Caenorhabditis_elegans;_ChIP-Seq	a-ELT-2 (455-2A4)|L3 staged worms_ELT2_ChIP-seq	a-ELT-2 (455-2A4)	N2|L3 staged worms_ELT2_ChIP-seq|L3 staged worms	N2	ChIP-Seq
SRX1132917	SRA281912	EO041_rep2_input;_Caenorhabditis_elegans;_ChIP-Seq	EO041_rep2_input;_Caenorhabditis_elegans;_ChIP-Seq	L3 staged worms_input	L3 staged worms_input	N2|L3 staged worms_input|L3 staged worms	N2	ChIP-Seq
SRX1132918	SRA281912	AR135_rep3_H3K4me3;_Caenorhabditis_elegans;_ChIP-Seq	AR135_rep3_H3K4me3;_Caenorhabditis_elegans;_ChI...	a-H3K4me3 (WAKO 305-34819)|L3 staged worms_H3K4me3_ChIP-seq	a-H3K4me3 (WAKO 305-34...	N2|L3 staged worms_H3K4me3_ChIP-seq|L3 staged worms	N2	ChIP-Seq
SRX1132919	SRA281912	AR136_rep3_ELT2;_Caenorhabditis_elegans;_ChIP-Seq	AR136_rep3_ELT2;_Caenorhabditis_elegans;_ChIP-Seq	a-ELT-2 (455-2A4)|L3 staged worms_ELT2_ChIP-seq	a-ELT-2 (455-2A4)	N2|L3 staged worms_ELT2_ChIP-seq|L3 staged worms	N2	ChIP-Seq
SRX1132920	SRA281912	AR137_rep3_IgG;_Caenorhabditis_elegans;_ChIP-Seq	AR137_rep3_IgG;_Caenorhabditis_elegans;_ChIP-Seq	IgG|L3 staged worms_IgG_ChIP-seq	IgG	N2|L3 staged worms_IgG_ChIP-seq|L3 staged worms	N2	ChIP-Seq
SRX1132921	SRA281912	AR138_rep3_input;_Caenorhabditis_elegans;_ChIP-Seq	AR138_rep3_input;_Caenorhabditis_elegans;_ChIP-Seq	L3 staged worms_input	L3 staged worms_input	N2|L3 staged worms_input|L3 staged worms	N2	ChIP-Seq
SRX113600	SRA048919	H3K9me3_nucleosome-IP_from_eri-1(mg366)_mutant_C._elegans_that_underwent_ego-1_RNAi;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_nucleosome-IP_from_eri-1(mg366)_mutant_...	anti-H3K9me3 antibody|adult C. elegans	anti-H3K9me3 antibody	eri-1(mg366)|adult C. elegans|adult	eri-1(mg366)	ChIP-Seq
SRX113601	SRA048919	H3K9me3_nucleosome-IP_from_eri-1(mg366)_mutant_C._elegans_that_underwent_smg-1_(center_region)_RNAi;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_nucleosome-IP_from_eri-1(mg366)_mutant_...	anti-H3K9me3 antibody|adult C. elegans	anti-H3K9me3 antibody	eri-1(mg366)|adult C. elegans|adult	eri-1(mg366)	ChIP-Seq
SRX113602	SRA048919	H3K9me3_nucleosome-IP_from_eri-1(mg366)_mutant_C._elegans_that_underwent_lin-15B_RNAi;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_nucleosome-IP_from_eri-1(mg366)_mutant_...	anti-H3K9me3 antibody|embryonic C. elegans	anti-H3K9me3 antibody	eri-1(mg366)|embryonic C. elegans|embryo	eri-1(mg366)	ChIP-Seq
SRX113603	SRA048919	H3K9me3_nucleosome-IP_from_eri-1(mg366)_mutant_C._elegans_that_underwent_lir-1_RNAi;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_nucleosome-IP_from_eri-1(mg366)_mutant_...	anti-H3K9me3 antibody|embryonic C. elegans	anti-H3K9me3 antibody	eri-1(mg366)|embryonic C. elegans|embryo	eri-1(mg366)	ChIP-Seq
SRX113604	SRA048919	H3K9me3_nucleosome-IP_from_eri-1(mg366)_mutant_C._elegans_as_control_for_no_RNAi;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_nucleosome-IP_from_eri-1(mg366)_mutant_...	anti-H3K9me3 antibody|embryonic C. elegans	anti-H3K9me3 antibody	eri-1(mg366)|embryonic C. elegans|embryo	eri-1(mg366)	ChIP-Seq
SRX113605	SRA048919	H3K9me3_nucleosome-IP_from_wild_type_C._elegans_that_underwent_smg-1_(3'-UTR)_RNAi;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_nucleosome-IP_from_wild_type_C._elegans...	anti-H3K9me3 antibody|adult C. elegans	anti-H3K9me3 antibody	wild type|adult C. elegans|adult	wild type	ChIP-Seq
SRX113606	SRA048919	H3K9me3_nucleosome-IP_from_wild_type_C._elegans_that_underwent_smg-1_(5'_end)_RNAi;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_nucleosome-IP_from_wild_type_C._elegans...	anti-H3K9me3 antibody|adult C. elegans	anti-H3K9me3 antibody	wild type|adult C. elegans|adult	wild type	ChIP-Seq
SRX113607	SRA048919	H3K9me3_nucleosome-IP_from_wild_type_C._elegans_that_underwent_smg-1_(center_region)_RNAi;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_nucleosome-IP_from_wild_type_C._elegans...	anti-H3K9me3 antibody|adult C. elegans	anti-H3K9me3 antibody	wild type|adult C. elegans|adult	wild type	ChIP-Seq
SRX113608	SRA048919	H3K9me3_nucleosome-IP_from_nrde-2(gg091)_mutant_C._elegans_that_underwent_smg-1_(center_region)_RNAi;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_nucleosome-IP_from_nrde-2(gg091)_mutant...	anti-H3K9me3 antibody|adult C. elegans	anti-H3K9me3 antibody	nrde-2(gg091)|adult C. elegans|adult	nrde-2(gg091)	ChIP-Seq
SRX113609	SRA048919	H3K9me3_nucleosome-IP_from_rrf-3_(pk1426)_mutant_C._elegans_that_underwent_smg-1_(center_region)_RNAi;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_nucleosome-IP_from_rrf-3_(pk1426)_mutan...	anti-H3K9me3 antibody|adult C. elegans	anti-H3K9me3 antibody	rrf-3 (pk1426)|adult C. elegans|adult	rrf-3 (pk1426)	ChIP-Seq
SRX113610	SRA048919	H3K9me3_nucleosome-IP_from_rde-1(ne300)_mutant_C._elegans_that_underwent_smg-1_(center_region)_RNAi;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_nucleosome-IP_from_rde-1(ne300)_mutant_...	anti-H3K9me3 antibody|adult C. elegans	anti-H3K9me3 antibody	rde-1(ne300)|adult C. elegans|adult	rde-1(ne300)	ChIP-Seq
SRX113611	SRA048919	H3K9me3_nucleosome-IP_from_MAGO_C._elegans_that_underwent_smg-1_(center_region)_RNAi;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_nucleosome-IP_from_MAGO_C._elegans_that...	anti-H3K9me3 antibody|adult C. elegans	anti-H3K9me3 antibody	MAGO (ppw-1(tm914), sago-1(tm1195), sago-2(tm894), F58G1.1(tm1019), C06A1.4(tm887), and M03D4.6(tm1144)|adult C. elegans|adult	MAGO (ppw-1(tm914), sa...	ChIP-Seq
SRX113616	SRA048919	H3K9me3_nucleosome-IP_from_wild_type_C._elegans_from_a_multigenerational_RNAi_experiment,_P0_generation;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_nucleosome-IP_from_wild_type_C._elegans...	anti-H3K9me3 antibody|adult C. elegans	anti-H3K9me3 antibody	wild type|adult C. elegans|adult	wild type	ChIP-Seq
SRX113617	SRA048919	H3K9me3_nucleosome-IP_from_wild_type_C._elegans_from_a_multigenerational_RNAi_experiment,_F1_generation;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_nucleosome-IP_from_wild_type_C._elegans...	anti-H3K9me3 antibody|adult C. elegans	anti-H3K9me3 antibody	wild type|adult C. elegans|adult	wild type	ChIP-Seq
SRX113618	SRA048919	H3K9me3_nucleosome-IP_from_wild_type_C._elegans_from_a_multigenerational_RNAi_experiment,_F2_generation;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_nucleosome-IP_from_wild_type_C._elegans...	anti-H3K9me3 antibody|adult C. elegans	anti-H3K9me3 antibody	wild type|adult C. elegans|adult	wild type	ChIP-Seq
SRX113619	SRA048919	H3K9me3_nucleosome-IP_from_wild_type_C._elegans_from_a_multigenerational_RNAi_experiment,_F3_generation;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_nucleosome-IP_from_wild_type_C._elegans...	anti-H3K9me3 antibody|adult C. elegans	anti-H3K9me3 antibody	wild type|adult C. elegans|adult	wild type	ChIP-Seq
SRX113620	SRA048919	H3K9me3_nucleosome-IP_from_wild_type_C._elegans_from_a_time-course_RNAi_experiment,_24_hours;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_nucleosome-IP_from_wild_type_C._elegans...	anti-H3K9me3 antibody|larval L4 stage C. elegans	anti-H3K9me3 antibody	wild type|larval L4 stage C. elegans|larval L4 stage C. elegans	wild type	ChIP-Seq
SRX113621	SRA048919	H3K9me3_nucleosome-IP_from_wild_type_C._elegans_from_a_time-course_RNAi_experiment,_4_hours;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_nucleosome-IP_from_wild_type_C._elegans...	anti-H3K9me3 antibody|larval L4 stage C. elegans	anti-H3K9me3 antibody	wild type|larval L4 stage C. elegans|larval L4 stage C. elegans	wild type	ChIP-Seq
SRX118219	SRA049754	Snyder_GEI-11_Input_L3_rep1_extraction1_seq1_aliquote_1	Snyder_GEI-11_Input_L3_rep1_extraction1_seq1_al...	Snyder_GEI-11_Input_L3_rep1	Snyder_GEI-11_Input_L3...	OP179(official name : OP179 genotype : unc-119(ed3) III; wgIs179 unc-119(+) gei-11::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The GEI-11::EGFP fusion protein is expressed in the correct gei-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the GEI-11 transcription factor. made_by : R. Waterston )|Snyder_GEI-11_Input_L3_rep1|L3	OP179(official name : ...	ChIP-Seq
SRX118220	SRA049754	Snyder_GEI-11_Input_L3_rep2_extraction1_seq1_aliquote_1	Snyder_GEI-11_Input_L3_rep2_extraction1_seq1_al...	Snyder_GEI-11_Input_L3_rep2	Snyder_GEI-11_Input_L3...	OP179(official name : OP179 genotype : unc-119(ed3) III; wgIs179 unc-119(+) gei-11::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The GEI-11::EGFP fusion protein is expressed in the correct gei-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the GEI-11 transcription factor. made_by : R. Waterston )|Snyder_GEI-11_Input_L3_rep2|L3	OP179(official name : ...	ChIP-Seq
SRX118221	SRA049754	Snyder_GEI-11_GFP_L3_rep1_extraction1_seq1_aliquote_1	Snyder_GEI-11_GFP_L3_rep1_extraction1_seq1_aliq...	Snyder_GEI-11_GFP_L3_rep1	Snyder_GEI-11_GFP_L3_rep1	OP179(official name : OP179 genotype : unc-119(ed3) III; wgIs179 unc-119(+) gei-11::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The GEI-11::EGFP fusion protein is expressed in the correct gei-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the GEI-11 transcription factor. made_by : R. Waterston )|Snyder_GEI-11_GFP_L3_rep1|L3	OP179(official name : ...	ChIP-Seq
SRX118222	SRA049754	Snyder_GEI-11_GFP_L3_rep2_extraction1_seq1_aliquote_1	Snyder_GEI-11_GFP_L3_rep2_extraction1_seq1_aliq...	Snyder_GEI-11_GFP_L3_rep2	Snyder_GEI-11_GFP_L3_rep2	OP179(official name : OP179 genotype : unc-119(ed3) III; wgIs179 unc-119(+) gei-11::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The GEI-11::EGFP fusion protein is expressed in the correct gei-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the GEI-11 transcription factor. made_by : R. Waterston )|Snyder_GEI-11_GFP_L3_rep2|L3	OP179(official name : ...	ChIP-Seq
SRX118224	SRA049755	Snyder_CES1_Input_L3_rep1_extraction1_seq1_aliquote_1	Snyder_CES1_Input_L3_rep1_extraction1_seq1_aliq...	Snyder_CES1_Input_L3_rep1	Snyder_CES1_Input_L3_rep1	OP174(official name : OP174 genotype : unc-119(ed3); wgIs174(ces-1::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CES-1::EGFP fusion protein is expressed in the correct ces-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CES-1 transcription factor. made_by : S. Kim )|Snyder_CES1_Input_L3_rep1|L3	OP174(official name : ...	ChIP-Seq
SRX118225	SRA049755	Snyder_CES1_Input_L3_rep2_extraction1_seq1_aliquote_1	Snyder_CES1_Input_L3_rep2_extraction1_seq1_aliq...	Snyder_CES1_Input_L3_rep2	Snyder_CES1_Input_L3_rep2	OP174(official name : OP174 genotype : unc-119(ed3); wgIs174(ces-1::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CES-1::EGFP fusion protein is expressed in the correct ces-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CES-1 transcription factor. made_by : S. Kim )|Snyder_CES1_Input_L3_rep2|L3	OP174(official name : ...	ChIP-Seq
SRX118226	SRA049755	Snyder_CES1_GFP_L3_rep1_extraction1_seq1_aliquote_1	Snyder_CES1_GFP_L3_rep1_extraction1_seq1_aliquo...	Snyder_CES1_GFP_L3_rep1	Snyder_CES1_GFP_L3_rep1	OP174(official name : OP174 genotype : unc-119(ed3); wgIs174(ces-1::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CES-1::EGFP fusion protein is expressed in the correct ces-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CES-1 transcription factor. made_by : S. Kim )|Snyder_CES1_GFP_L3_rep1|L3	OP174(official name : ...	ChIP-Seq
SRX118227	SRA049755	Snyder_CES1_GFP_L3_rep2_extraction1_seq1_aliquote_1	Snyder_CES1_GFP_L3_rep2_extraction1_seq1_aliquo...	Snyder_CES1_GFP_L3_rep2	Snyder_CES1_GFP_L3_rep2	OP174(official name : OP174 genotype : unc-119(ed3); wgIs174(ces-1::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CES-1::EGFP fusion protein is expressed in the correct ces-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CES-1 transcription factor. made_by : S. Kim )|Snyder_CES1_GFP_L3_rep2|L3	OP174(official name : ...	ChIP-Seq
SRX120284	SRA050167	Snyder_FOS-1_Input_L1_rep1_extraction1_seq1_aliquote_1	Snyder_FOS-1_Input_L1_rep1_extraction1_seq1_ali...	Snyder_FOS-1_Input_L1_rep1 extraction1_seq1	Snyder_FOS-1_Input_L1_...	OP304(official name : OP304 genotype : unc119(ed3); wgIs304(fos-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The FOS-1::EGFP fusion protein is expressed in the correct fos-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the FOS-1 transcription factor. made_by : R Waterston )|Snyder_FOS-1_Input_L1_rep1 extraction1_seq1|fed L1	OP304(official name : ...	ChIP-Seq
SRX120285	SRA050167	Snyder_FOS-1_Input_L1_rep2_extraction1_seq1_aliquote_1	Snyder_FOS-1_Input_L1_rep2_extraction1_seq1_ali...	Snyder_FOS-1_Input_L1_rep2 extraction1_seq1	Snyder_FOS-1_Input_L1_...	OP304(official name : OP304 genotype : unc119(ed3); wgIs304(fos-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The FOS-1::EGFP fusion protein is expressed in the correct fos-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the FOS-1 transcription factor. made_by : R Waterston )|Snyder_FOS-1_Input_L1_rep2 extraction1_seq1|fed L1	OP304(official name : ...	ChIP-Seq
SRX120286	SRA050167	Snyder_FOS-1_GFP_L1_rep1_extraction1_seq1_aliquote_1	Snyder_FOS-1_GFP_L1_rep1_extraction1_seq1_aliqu...	Snyder_FOS-1_GFP_L1_rep1 extraction1_seq1	Snyder_FOS-1_GFP_L1_re...	OP304(official name : OP304 genotype : unc119(ed3); wgIs304(fos-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The FOS-1::EGFP fusion protein is expressed in the correct fos-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the FOS-1 transcription factor. made_by : R Waterston )|Snyder_FOS-1_GFP_L1_rep1 extraction1_seq1|fed L1	OP304(official name : ...	ChIP-Seq
SRX120287	SRA050167	Snyder_FOS-1_GFP_L1_rep2_extraction1_seq1_aliquote_1	Snyder_FOS-1_GFP_L1_rep2_extraction1_seq1_aliqu...	Snyder_FOS-1_GFP_L1_rep2 extraction1_seq1	Snyder_FOS-1_GFP_L1_re...	OP304(official name : OP304 genotype : unc119(ed3); wgIs304(fos-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The FOS-1::EGFP fusion protein is expressed in the correct fos-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the FOS-1 transcription factor. made_by : R Waterston )|Snyder_FOS-1_GFP_L1_rep2 extraction1_seq1|fed L1	OP304(official name : ...	ChIP-Seq
SRX1299429	SRA250443	H4K20me1_N2_L3_Rep2_spike-in_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H4K20me1_N2_L3_Rep2_spike-in_ChIPSeq;_Caenorhab...	H4K20me1 Abcam (ab9051)|whole worms	H4K20me1 Abcam (ab9051)	N2|whole worms|L3	N2	ChIP-Seq
SRX1299430	SRA250443	Input_N2_L3_spikein_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Input_N2_L3_spikein_Rep2;_Caenorhabditis_elegan...	none (input)|whole worms	none (input)	N2|whole worms|L3	N2	ChIP-Seq
SRX1353657	SRA305784	Input_wild-type_1;_Caenorhabditis_elegans;_ChIP-Seq	Input_wild-type_1;_Caenorhabditis_elegans;_ChIP...	none|Early embryo extracts	none	GW1|Early embryo extracts|early embryo	GW1	ChIP-Seq
SRX1353658	SRA305784	Input_wild-type_2;_Caenorhabditis_elegans;_ChIP-Seq	Input_wild-type_2;_Caenorhabditis_elegans;_ChIP...	none|Early embryo extracts	none	GW1|Early embryo extracts|early embryo	GW1	ChIP-Seq
SRX1353659	SRA305784	Input_met-2_set-25_1;_Caenorhabditis_elegans;_ChIP-Seq	Input_met-2_set-25_1;_Caenorhabditis_elegans;_C...	none|Early embryo extracts	none	GW638|Early embryo extracts|early embryo	GW638	ChIP-Seq
SRX1353660	SRA305784	Input_met-2_set-25_2;_Caenorhabditis_elegans;_ChIP-Seq	Input_met-2_set-25_2;_Caenorhabditis_elegans;_C...	none|Early embryo extracts	none	GW638|Early embryo extracts|early embryo	GW638	ChIP-Seq
SRX1353661	SRA305784	Input_cec-4_1;_Caenorhabditis_elegans;_ChIP-Seq	Input_cec-4_1;_Caenorhabditis_elegans;_ChIP-Seq	none|Early embryo extracts	none	GW828|Early embryo extracts|early embryo	GW828	ChIP-Seq
SRX1353662	SRA305784	Input_cec-4_2;_Caenorhabditis_elegans;_ChIP-Seq	Input_cec-4_2;_Caenorhabditis_elegans;_ChIP-Seq	none|Early embryo extracts	none	GW828|Early embryo extracts|early embryo	GW828	ChIP-Seq
SRX1353663	SRA305784	lem2_wild-type_1;_Caenorhabditis_elegans;_ChIP-Seq	lem2_wild-type_1;_Caenorhabditis_elegans;_ChIP-Seq	anti-LEM-2 (Novus Biologicals, catalog #48540002, lot# T01872A01)|Early embryo extracts	anti-LEM-2 (Novus Biol...	GW1|Early embryo extracts|early embryo	GW1	ChIP-Seq
SRX1353664	SRA305784	lem2_wild-type_2;_Caenorhabditis_elegans;_ChIP-Seq	lem2_wild-type_2;_Caenorhabditis_elegans;_ChIP-Seq	anti-LEM-2 (Novus Biologicals, catalog #48540002, lot# T01872A01)|Early embryo extracts	anti-LEM-2 (Novus Biol...	GW1|Early embryo extracts|early embryo	GW1	ChIP-Seq
SRX1353665	SRA305784	lem2_met-2_set-25_1;_Caenorhabditis_elegans;_ChIP-Seq	lem2_met-2_set-25_1;_Caenorhabditis_elegans;_Ch...	anti-LEM-2 (Novus Biologicals, catalog #48540002, lot# T01872A01)|Early embryo extracts	anti-LEM-2 (Novus Biol...	GW638|Early embryo extracts|early embryo	GW638	ChIP-Seq
SRX1353666	SRA305784	lem2_met-2_set-25_2;_Caenorhabditis_elegans;_ChIP-Seq	lem2_met-2_set-25_2;_Caenorhabditis_elegans;_Ch...	anti-LEM-2 (Novus Biologicals, catalog #48540002, lot# T01872A01)|Early embryo extracts	anti-LEM-2 (Novus Biol...	GW638|Early embryo extracts|early embryo	GW638	ChIP-Seq
SRX1353667	SRA305784	lem2_cec-4_1;_Caenorhabditis_elegans;_ChIP-Seq	lem2_cec-4_1;_Caenorhabditis_elegans;_ChIP-Seq	anti-LEM-2 (Novus Biologicals, catalog #48540002, lot# T01872A01)|Early embryo extracts	anti-LEM-2 (Novus Biol...	GW828|Early embryo extracts|early embryo	GW828	ChIP-Seq
SRX1353668	SRA305784	lem2_cec-4_2;_Caenorhabditis_elegans;_ChIP-Seq	lem2_cec-4_2;_Caenorhabditis_elegans;_ChIP-Seq	anti-LEM-2 (Novus Biologicals, catalog #48540002, lot# T01872A01)|Early embryo extracts	anti-LEM-2 (Novus Biol...	GW828|Early embryo extracts|early embryo	GW828	ChIP-Seq
SRX1388744	SRA307520	WT_15C_G3_rep2_ChIPinput;_Caenorhabditis_elegans;_ChIP-Seq	WT_15C_G3_rep2_ChIPinput;_Caenorhabditis_elegan...	ChIP input|Young adult whole animal	ChIP input	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX1388745	SRA307520	WT_23C_G2_rep2_ChIPinput;_Caenorhabditis_elegans;_ChIP-Seq	WT_23C_G2_rep2_ChIPinput;_Caenorhabditis_elegan...	ChIP input|Young adult whole animal	ChIP input	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX1388746	SRA307520	WT_23C_G4_rep2_ChIPinput;_Caenorhabditis_elegans;_ChIP-Seq	WT_23C_G4_rep2_ChIPinput;_Caenorhabditis_elegan...	ChIP input|Young adult whole animal	ChIP input	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX1388747	SRA307520	WT_23C_G6_rep2_ChIPinput;_Caenorhabditis_elegans;_ChIP-Seq	WT_23C_G6_rep2_ChIPinput;_Caenorhabditis_elegan...	ChIP input|Young adult whole animal	ChIP input	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX1388748	SRA307520	WT_p15C_G1_rep2_ChIPinput;_Caenorhabditis_elegans;_ChIP-Seq	WT_p15C_G1_rep2_ChIPinput;_Caenorhabditis_elega...	ChIP input|Young adult whole animal	ChIP input	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX1388749	SRA307520	WT_p15C_G2_rep2_ChIPinput;_Caenorhabditis_elegans;_ChIP-Seq	WT_p15C_G2_rep2_ChIPinput;_Caenorhabditis_elega...	ChIP input|Young adult whole animal	ChIP input	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX1388750	SRA307520	hrde-1_15C_G3_rep2_ChIPinput;_Caenorhabditis_elegans;_ChIP-Seq	hrde-1_15C_G3_rep2_ChIPinput;_Caenorhabditis_el...	ChIP input|Young adult whole animal	ChIP input	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX1388751	SRA307520	hrde-1_23C_G2_rep2_ChIPinput;_Caenorhabditis_elegans;_ChIP-Seq	hrde-1_23C_G2_rep2_ChIPinput;_Caenorhabditis_el...	ChIP input|Young adult whole animal	ChIP input	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX1388752	SRA307520	hrde-1_23C_G4_rep2_ChIPinput;_Caenorhabditis_elegans;_ChIP-Seq	hrde-1_23C_G4_rep2_ChIPinput;_Caenorhabditis_el...	ChIP input|Young adult whole animal	ChIP input	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX1388753	SRA307520	hrde-1_23C_G6_rep2_ChIPinput;_Caenorhabditis_elegans;_ChIP-Seq	hrde-1_23C_G6_rep2_ChIPinput;_Caenorhabditis_el...	ChIP input|Young adult whole animal	ChIP input	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX1388754	SRA307520	hrde-1_p15C_G1_rep2_ChIPinput;_Caenorhabditis_elegans;_ChIP-Seq	hrde-1_p15C_G1_rep2_ChIPinput;_Caenorhabditis_e...	ChIP input|Young adult whole animal	ChIP input	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX1388755	SRA307520	hrde-1_p15C_G2_rep2_ChIPinput;_Caenorhabditis_elegans;_ChIP-Seq	hrde-1_p15C_G2_rep2_ChIPinput;_Caenorhabditis_e...	ChIP input|Young adult whole animal	ChIP input	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX1388756	SRA307520	WT_15C_G3_rep2_S2ChIP;_Caenorhabditis_elegans;_ChIP-Seq	WT_15C_G3_rep2_S2ChIP;_Caenorhabditis_elegans;_...	Anti-RNA polymerase II CTD repeat YSPTSPS (phospho S2)|Young adult whole animal	Anti-RNA polymerase II...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX1388757	SRA307520	WT_23C_G2_rep2_S2ChIP;_Caenorhabditis_elegans;_ChIP-Seq	WT_23C_G2_rep2_S2ChIP;_Caenorhabditis_elegans;_...	Anti-RNA polymerase II CTD repeat YSPTSPS (phospho S2)|Young adult whole animal	Anti-RNA polymerase II...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX1388758	SRA307520	WT_23C_G4_rep2_S2ChIP;_Caenorhabditis_elegans;_ChIP-Seq	WT_23C_G4_rep2_S2ChIP;_Caenorhabditis_elegans;_...	Anti-RNA polymerase II CTD repeat YSPTSPS (phospho S2)|Young adult whole animal	Anti-RNA polymerase II...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX1388759	SRA307520	WT_23C_G6_rep2_S2ChIP;_Caenorhabditis_elegans;_ChIP-Seq	WT_23C_G6_rep2_S2ChIP;_Caenorhabditis_elegans;_...	Anti-RNA polymerase II CTD repeat YSPTSPS (phospho S2)|Young adult whole animal	Anti-RNA polymerase II...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX1388760	SRA307520	WT_p15C_G1_rep2_S2ChIP;_Caenorhabditis_elegans;_ChIP-Seq	WT_p15C_G1_rep2_S2ChIP;_Caenorhabditis_elegans;...	Anti-RNA polymerase II CTD repeat YSPTSPS (phospho S2)|Young adult whole animal	Anti-RNA polymerase II...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX1388761	SRA307520	WT_p15C_G2_rep2_S2ChIP;_Caenorhabditis_elegans;_ChIP-Seq	WT_p15C_G2_rep2_S2ChIP;_Caenorhabditis_elegans;...	Anti-RNA polymerase II CTD repeat YSPTSPS (phospho S2)|Young adult whole animal	Anti-RNA polymerase II...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX1388762	SRA307520	hrde-1_15C_G3_rep2_S2ChIP;_Caenorhabditis_elegans;_ChIP-Seq	hrde-1_15C_G3_rep2_S2ChIP;_Caenorhabditis_elega...	Anti-RNA polymerase II CTD repeat YSPTSPS (phospho S2)|Young adult whole animal	Anti-RNA polymerase II...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX1388763	SRA307520	hrde-1_23C_G2_rep2_S2ChIP;_Caenorhabditis_elegans;_ChIP-Seq	hrde-1_23C_G2_rep2_S2ChIP;_Caenorhabditis_elega...	Anti-RNA polymerase II CTD repeat YSPTSPS (phospho S2)|Young adult whole animal	Anti-RNA polymerase II...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX1388764	SRA307520	hrde-1_23C_G4_rep2_S2ChIP;_Caenorhabditis_elegans;_ChIP-Seq	hrde-1_23C_G4_rep2_S2ChIP;_Caenorhabditis_elega...	Anti-RNA polymerase II CTD repeat YSPTSPS (phospho S2)|Young adult whole animal	Anti-RNA polymerase II...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX1388765	SRA307520	hrde-1_23C_G6_rep2_S2ChIP;_Caenorhabditis_elegans;_ChIP-Seq	hrde-1_23C_G6_rep2_S2ChIP;_Caenorhabditis_elega...	Anti-RNA polymerase II CTD repeat YSPTSPS (phospho S2)|Young adult whole animal	Anti-RNA polymerase II...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX1388766	SRA307520	hrde-1_p15C_G1_rep2_S2ChIP;_Caenorhabditis_elegans;_ChIP-Seq	hrde-1_p15C_G1_rep2_S2ChIP;_Caenorhabditis_eleg...	Anti-RNA polymerase II CTD repeat YSPTSPS (phospho S2)|Young adult whole animal	Anti-RNA polymerase II...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX1388767	SRA307520	hrde-1_p15C_G2_rep2_S2ChIP;_Caenorhabditis_elegans;_ChIP-Seq	hrde-1_p15C_G2_rep2_S2ChIP;_Caenorhabditis_eleg...	Anti-RNA polymerase II CTD repeat YSPTSPS (phospho S2)|Young adult whole animal	Anti-RNA polymerase II...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX1388768	SRA307520	WT_15C_G3_rep2_H3K9me3ChIP;_Caenorhabditis_elegans;_ChIP-Seq	WT_15C_G3_rep2_H3K9me3ChIP;_Caenorhabditis_eleg...	Anti-Histone H3 (tri methyl K9)|Young adult whole animal	Anti-Histone H3 (tri m...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX1388769	SRA307520	WT_23C_G2_rep2_H3K9me3ChIP;_Caenorhabditis_elegans;_ChIP-Seq	WT_23C_G2_rep2_H3K9me3ChIP;_Caenorhabditis_eleg...	Anti-Histone H3 (tri methyl K9)|Young adult whole animal	Anti-Histone H3 (tri m...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX1388770	SRA307520	WT_23C_G4_rep2_H3K9me3ChIP;_Caenorhabditis_elegans;_ChIP-Seq	WT_23C_G4_rep2_H3K9me3ChIP;_Caenorhabditis_eleg...	Anti-Histone H3 (tri methyl K9)|Young adult whole animal	Anti-Histone H3 (tri m...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX1388771	SRA307520	WT_23C_G6_rep2_H3K9me3ChIP;_Caenorhabditis_elegans;_ChIP-Seq	WT_23C_G6_rep2_H3K9me3ChIP;_Caenorhabditis_eleg...	Anti-Histone H3 (tri methyl K9)|Young adult whole animal	Anti-Histone H3 (tri m...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX1388772	SRA307520	WT_p15C_G1_rep2_H3K9me3ChIP;_Caenorhabditis_elegans;_ChIP-Seq	WT_p15C_G1_rep2_H3K9me3ChIP;_Caenorhabditis_ele...	Anti-Histone H3 (tri methyl K9)|Young adult whole animal	Anti-Histone H3 (tri m...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX1388773	SRA307520	WT_p15C_G2_rep2_H3K9me3ChIP;_Caenorhabditis_elegans;_ChIP-Seq	WT_p15C_G2_rep2_H3K9me3ChIP;_Caenorhabditis_ele...	Anti-Histone H3 (tri methyl K9)|Young adult whole animal	Anti-Histone H3 (tri m...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX1388774	SRA307520	hrde-1_15C_G3_rep2_H3K9me3ChIP;_Caenorhabditis_elegans;_ChIP-Seq	hrde-1_15C_G3_rep2_H3K9me3ChIP;_Caenorhabditis_...	Anti-Histone H3 (tri methyl K9)|Young adult whole animal	Anti-Histone H3 (tri m...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX1388775	SRA307520	hrde-1_23C_G2_rep2_H3K9me3ChIP;_Caenorhabditis_elegans;_ChIP-Seq	hrde-1_23C_G2_rep2_H3K9me3ChIP;_Caenorhabditis_...	Anti-Histone H3 (tri methyl K9)|Young adult whole animal	Anti-Histone H3 (tri m...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX1388776	SRA307520	hrde-1_23C_G4_rep2_H3K9me3ChIP;_Caenorhabditis_elegans;_ChIP-Seq	hrde-1_23C_G4_rep2_H3K9me3ChIP;_Caenorhabditis_...	Anti-Histone H3 (tri methyl K9)|Young adult whole animal	Anti-Histone H3 (tri m...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX1388777	SRA307520	hrde-1_23C_G6_rep2_H3K9me3ChIP;_Caenorhabditis_elegans;_ChIP-Seq	hrde-1_23C_G6_rep2_H3K9me3ChIP;_Caenorhabditis_...	Anti-Histone H3 (tri methyl K9)|Young adult whole animal	Anti-Histone H3 (tri m...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX1388778	SRA307520	hrde-1_p15C_G1_rep2_H3K9me3ChIP;_Caenorhabditis_elegans;_ChIP-Seq	hrde-1_p15C_G1_rep2_H3K9me3ChIP;_Caenorhabditis...	Anti-Histone H3 (tri methyl K9)|Young adult whole animal	Anti-Histone H3 (tri m...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX1388779	SRA307520	hrde-1_p15C_G2_rep2_H3K9me3ChIP;_Caenorhabditis_elegans;_ChIP-Seq	hrde-1_p15C_G2_rep2_H3K9me3ChIP;_Caenorhabditis...	Anti-Histone H3 (tri methyl K9)|Young adult whole animal	Anti-Histone H3 (tri m...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX146413	SRA052550	Snyder_CEH-26_Input_LE_rep1_extraction1_seq1_aliquote_1	Snyder_CEH-26_Input_LE_rep1_extraction1_seq1_al...	Snyder_CEH-26_Input_LE_rep1	Snyder_CEH-26_Input_LE...	OP500(official name : OP500 genotype : unc119(ed3); wgIs500(ceh-26::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CEH-26::EGFP fusion protein is expressed in the correct ceh-26 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CEH-26 transcription factor. made_by : R. Waterston )|Snyder_CEH-26_Input_LE_rep1|late embryo	OP500(official name : ...	ChIP-Seq
SRX146414	SRA052550	Snyder_CEH-26_Input_LE_rep2_extraction2_seq1_aliquote_1	Snyder_CEH-26_Input_LE_rep2_extraction2_seq1_al...	Snyder_CEH-26_Input_LE_rep2	Snyder_CEH-26_Input_LE...	OP500(official name : OP500 genotype : unc119(ed3); wgIs500(ceh-26::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CEH-26::EGFP fusion protein is expressed in the correct ceh-26 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CEH-26 transcription factor. made_by : R. Waterston )|Snyder_CEH-26_Input_LE_rep2|late embryo	OP500(official name : ...	ChIP-Seq
SRX146415	SRA052550	Snyder_CEH-26_GFP_LE_rep1_extraction1_seq1_aliquote_1	Snyder_CEH-26_GFP_LE_rep1_extraction1_seq1_aliq...	Snyder_CEH-26_GFP_LE_rep1	Snyder_CEH-26_GFP_LE_rep1	OP500(official name : OP500 genotype : unc119(ed3); wgIs500(ceh-26::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CEH-26::EGFP fusion protein is expressed in the correct ceh-26 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CEH-26 transcription factor. made_by : R. Waterston )|Snyder_CEH-26_GFP_LE_rep1|late embryo	OP500(official name : ...	ChIP-Seq
SRX146416	SRA052550	Snyder_CEH-26_GFP_LE_rep2_extraction2_seq1_aliquote_1	Snyder_CEH-26_GFP_LE_rep2_extraction2_seq1_aliq...	Snyder_CEH-26_GFP_LE_rep2	Snyder_CEH-26_GFP_LE_rep2	OP500(official name : OP500 genotype : unc119(ed3); wgIs500(ceh-26::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CEH-26::EGFP fusion protein is expressed in the correct ceh-26 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CEH-26 transcription factor. made_by : R. Waterston )|Snyder_CEH-26_GFP_LE_rep2|late embryo	OP500(official name : ...	ChIP-Seq
SRX146417	SRA052551	Snyder_Ppie1_EFL1_Input_YA_rep1_extraction1_seq1_aliquote_1	Snyder_Ppie1_EFL1_Input_YA_rep1_extraction1_seq...	Snyder_Ppie1_EFL1_Input_YA_rep1	Snyder_Ppie1_EFL1_Inpu...	YL445(official name : YL445 genotype : unc119(ed3); vrIs81 pPIE-1::EFL-1::GFP FLAG: EFL-1 3?UTR genotype : unc-119 (+) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : made_by : )|Snyder_Ppie1_EFL1_Input_YA_rep1|Young Adult	YL445(official name : ...	ChIP-Seq
SRX146418	SRA052551	Snyder_Ppie1_EFL1_Input_YA_rep2_extraction2_seq1_aliquote_1	Snyder_Ppie1_EFL1_Input_YA_rep2_extraction2_seq...	Snyder_Ppie1_EFL1_Input_YA_rep2 extraction1_seq1	Snyder_Ppie1_EFL1_Inpu...	YL445(official name : YL445 genotype : unc119(ed3); vrIs81 pPIE-1::EFL-1::GFP FLAG: EFL-1 3?UTR genotype : unc-119 (+) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : made_by : )|Snyder_Ppie1_EFL1_Input_YA_rep2 extraction1_seq1|Young Adult	YL445(official name : ...	ChIP-Seq
SRX146419	SRA052551	Snyder_Ppie1_EFL1_GFP_YA_rep1_extraction1_seq1_aliquote_1	Snyder_Ppie1_EFL1_GFP_YA_rep1_extraction1_seq1_...	Snyder_Ppie1_EFL1_GFP_YA_rep1	Snyder_Ppie1_EFL1_GFP_...	YL445(official name : YL445 genotype : unc119(ed3); vrIs81 pPIE-1::EFL-1::GFP FLAG: EFL-1 3?UTR genotype : unc-119 (+) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : made_by : )|Snyder_Ppie1_EFL1_GFP_YA_rep1|Young Adult	YL445(official name : ...	ChIP-Seq
SRX146420	SRA052551	Snyder_Ppie1_EFL1_GFP_YA_rep2_extraction2_seq1_aliquote_1	Snyder_Ppie1_EFL1_GFP_YA_rep2_extraction2_seq1_...	Snyder_Ppie1_EFL1_GFP_YA_rep2	Snyder_Ppie1_EFL1_GFP_...	YL445(official name : YL445 genotype : unc119(ed3); vrIs81 pPIE-1::EFL-1::GFP FLAG: EFL-1 3?UTR genotype : unc-119 (+) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : made_by : )|Snyder_Ppie1_EFL1_GFP_YA_rep2|Young Adult	YL445(official name : ...	ChIP-Seq
SRX146421	SRA052552	Snyder_Ppie1_DPL1_Input_YA_rep1_extraction1_seq1_aliquote_1	Snyder_Ppie1_DPL1_Input_YA_rep1_extraction1_seq...	Snyder_Ppie1_DPL1_Input_YA_rep1	Snyder_Ppie1_DPL1_Inpu...	YL390(official name : YL390 genotype : unc119(ed3); vrIs48 pPIE-1::DPL-1::GFP FLAG: DPL-1 3?UTR genotype : unc-119 (+) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : made_by : )|Snyder_Ppie1_DPL1_Input_YA_rep1|Young Adult	YL390(official name : ...	ChIP-Seq
SRX146422	SRA052552	Snyder_Ppie1_DPL1_Input_YA_rep2_extraction2_seq1_aliquote_1	Snyder_Ppie1_DPL1_Input_YA_rep2_extraction2_seq...	Snyder_Ppie1_DPL1_Input_YA_rep2	Snyder_Ppie1_DPL1_Inpu...	YL390(official name : YL390 genotype : unc119(ed3); vrIs48 pPIE-1::DPL-1::GFP FLAG: DPL-1 3?UTR genotype : unc-119 (+) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : made_by : )|Snyder_Ppie1_DPL1_Input_YA_rep2|Young Adult	YL390(official name : ...	ChIP-Seq
SRX146423	SRA052552	Snyder_Ppie1_DPL1_GFP_YA_rep1_extraction1_seq1_aliquote_1	Snyder_Ppie1_DPL1_GFP_YA_rep1_extraction1_seq1_...	Snyder_Ppie1_DPL1_GFP_YA_rep1	Snyder_Ppie1_DPL1_GFP_...	YL390(official name : YL390 genotype : unc119(ed3); vrIs48 pPIE-1::DPL-1::GFP FLAG: DPL-1 3?UTR genotype : unc-119 (+) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : made_by : )|Snyder_Ppie1_DPL1_GFP_YA_rep1|Young Adult	YL390(official name : ...	ChIP-Seq
SRX146424	SRA052552	Snyder_Ppie1_DPL1_GFP_YA_rep2_extraction2_seq1_aliquote_1	Snyder_Ppie1_DPL1_GFP_YA_rep2_extraction2_seq1_...	Snyder_Ppie1_DPL1_GFP_YA_rep2	Snyder_Ppie1_DPL1_GFP_...	YL390(official name : YL390 genotype : unc119(ed3); vrIs48 pPIE-1::DPL-1::GFP FLAG: DPL-1 3?UTR genotype : unc-119 (+) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : made_by : )|Snyder_Ppie1_DPL1_GFP_YA_rep2|Young Adult	YL390(official name : ...	ChIP-Seq
SRX146458	SRA052557	Snyder_Pefl1_EFL1_Input_L1_rep1_extraction1_seq1_aliquote_1	Snyder_Pefl1_EFL1_Input_L1_rep1_extraction1_seq...	Snyder_Pefl1_EFL1_Input_L1_rep1	Snyder_Pefl1_EFL1_Inpu...	YL424(official name : YL424 genotype : unc-119(ed3); vrIs68pEFL-1::EFL-1::GFP FLAG: EFL-1 3?UTR genotype : unc-119 (+) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : made_by : )|Snyder_Pefl1_EFL1_Input_L1_rep1|fed L1	YL424(official name : ...	ChIP-Seq
SRX146459	SRA052557	Snyder_Pefl1_EFL1_Input_L1_rep2_extraction2_seq1_aliquote_1	Snyder_Pefl1_EFL1_Input_L1_rep2_extraction2_seq...	Snyder_Pefl1_EFL1_Input_L1_rep2	Snyder_Pefl1_EFL1_Inpu...	YL424(official name : YL424 genotype : unc-119(ed3); vrIs68pEFL-1::EFL-1::GFP FLAG: EFL-1 3?UTR genotype : unc-119 (+) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : made_by : )|Snyder_Pefl1_EFL1_Input_L1_rep2|fed L1	YL424(official name : ...	ChIP-Seq
SRX146460	SRA052557	Snyder_Pefl1_EFL1_GFP_L1_rep1_extraction1_seq1_aliquote_1	Snyder_Pefl1_EFL1_GFP_L1_rep1_extraction1_seq1_...	Snyder_Pefl1_EFL1_GFP_L1_rep1	Snyder_Pefl1_EFL1_GFP_...	YL424(official name : YL424 genotype : unc-119(ed3); vrIs68pEFL-1::EFL-1::GFP FLAG: EFL-1 3?UTR genotype : unc-119 (+) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : made_by : )|Snyder_Pefl1_EFL1_GFP_L1_rep1|fed L1	YL424(official name : ...	ChIP-Seq
SRX146461	SRA052557	Snyder_Pefl1_EFL1_GFP_L1_rep2_extraction2_seq1_aliquote_1	Snyder_Pefl1_EFL1_GFP_L1_rep2_extraction2_seq1_...	Snyder_Pefl1_EFL1_GFP_L1_rep2	Snyder_Pefl1_EFL1_GFP_...	YL424(official name : YL424 genotype : unc-119(ed3); vrIs68pEFL-1::EFL-1::GFP FLAG: EFL-1 3?UTR genotype : unc-119 (+) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : made_by : )|Snyder_Pefl1_EFL1_GFP_L1_rep2|fed L1	YL424(official name : ...	ChIP-Seq
SRX146462	SRA052558	Snyder_Pdpl1_DPL1_Input_L1_rep1_extraction1_seq1_aliquote_1	Snyder_Pdpl1_DPL1_Input_L1_rep1_extraction1_seq...	Snyder_Pdpl1_DPL1_Input_L1_rep1	Snyder_Pdpl1_DPL1_Inpu...	YL425(official name : YL425 genotype : unc-119(ed3) III; vrIs69pDPL-1::DPL-1::GFP FLAG: DPL-1 3?UTR genotype : unc-119 (+) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : made_by : )|Snyder_Pdpl1_DPL1_Input_L1_rep1|fed L1	YL425(official name : ...	ChIP-Seq
SRX146463	SRA052558	Snyder_Pdpl1_DPL1_Input_L1_rep2_extraction2_seq1_aliquote_1	Snyder_Pdpl1_DPL1_Input_L1_rep2_extraction2_seq...	Snyder_Pdpl1_DPL1_Input_L1_rep2	Snyder_Pdpl1_DPL1_Inpu...	YL425(official name : YL425 genotype : unc-119(ed3) III; vrIs69pDPL-1::DPL-1::GFP FLAG: DPL-1 3?UTR genotype : unc-119 (+) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : made_by : )|Snyder_Pdpl1_DPL1_Input_L1_rep2|fed L1	YL425(official name : ...	ChIP-Seq
SRX146464	SRA052558	Snyder_Pdpl1_DPL1_GFP_L1_rep1_extraction1_seq1_aliquote_1	Snyder_Pdpl1_DPL1_GFP_L1_rep1_extraction1_seq1_...	Snyder_Pdpl1_DPL1_GFP_L1_rep1	Snyder_Pdpl1_DPL1_GFP_...	YL425(official name : YL425 genotype : unc-119(ed3) III; vrIs69pDPL-1::DPL-1::GFP FLAG: DPL-1 3?UTR genotype : unc-119 (+) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : made_by : )|Snyder_Pdpl1_DPL1_GFP_L1_rep1|fed L1	YL425(official name : ...	ChIP-Seq
SRX146465	SRA052558	Snyder_Pdpl1_DPL1_GFP_L1_rep2_extraction2_seq1_aliquote_1	Snyder_Pdpl1_DPL1_GFP_L1_rep2_extraction2_seq1_...	Snyder_Pdpl1_DPL1_GFP_L1_rep2	Snyder_Pdpl1_DPL1_GFP_...	YL425(official name : YL425 genotype : unc-119(ed3) III; vrIs69pDPL-1::DPL-1::GFP FLAG: DPL-1 3?UTR genotype : unc-119 (+) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : made_by : )|Snyder_Pdpl1_DPL1_GFP_L1_rep2|fed L1	YL425(official name : ...	ChIP-Seq
SRX146466	SRA052559	Snyder_CES1_Input_L1_rep1_extraction1_seq1_aliquote_1	Snyder_CES1_Input_L1_rep1_extraction1_seq1_aliq...	Snyder_CES1_Input_L1_rep1	Snyder_CES1_Input_L1_rep1	OP174(official name : OP174 genotype : unc-119(ed3); wgIs174(ces-1::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CES-1::EGFP fusion protein is expressed in the correct ces-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CES-1 transcription factor. made_by : S. Kim )|Snyder_CES1_Input_L1_rep1|fed L1	OP174(official name : ...	ChIP-Seq
SRX146467	SRA052559	Snyder_CES1_Input_L1_rep2_extraction2_seq1_aliquote_1	Snyder_CES1_Input_L1_rep2_extraction2_seq1_aliq...	Snyder_CES1_Input_L1_rep2	Snyder_CES1_Input_L1_rep2	OP174(official name : OP174 genotype : unc-119(ed3); wgIs174(ces-1::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CES-1::EGFP fusion protein is expressed in the correct ces-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CES-1 transcription factor. made_by : S. Kim )|Snyder_CES1_Input_L1_rep2|fed L1	OP174(official name : ...	ChIP-Seq
SRX146468	SRA052559	Snyder_CES1_GFP_L1_rep1_extraction1_seq1_aliquote_1	Snyder_CES1_GFP_L1_rep1_extraction1_seq1_aliquo...	Snyder_CES1_GFP_L1_rep1	Snyder_CES1_GFP_L1_rep1	OP174(official name : OP174 genotype : unc-119(ed3); wgIs174(ces-1::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CES-1::EGFP fusion protein is expressed in the correct ces-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CES-1 transcription factor. made_by : S. Kim )|Snyder_CES1_GFP_L1_rep1|fed L1	OP174(official name : ...	ChIP-Seq
SRX146469	SRA052559	Snyder_CES1_GFP_L1_rep2_extraction2_seq1_aliquote_1	Snyder_CES1_GFP_L1_rep2_extraction2_seq1_aliquo...	Snyder_CES1_GFP_L1_rep2	Snyder_CES1_GFP_L1_rep2	OP174(official name : OP174 genotype : unc-119(ed3); wgIs174(ces-1::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CES-1::EGFP fusion protein is expressed in the correct ces-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CES-1 transcription factor. made_by : S. Kim )|Snyder_CES1_GFP_L1_rep2|fed L1	OP174(official name : ...	ChIP-Seq
SRX146487	SRA052577	Snyder_LIN15B_Input_L4_rep1_extraction1_seq1_aliquote_1	Snyder_LIN15B_Input_L4_rep1_extraction1_seq1_al...	Snyder_LIN15B_Input_L4_rep1	Snyder_LIN15B_Input_L4...	OP184(official name : OP184 genotype : unc119(ed3); wgIs184(lin-15B::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-15B::EGFP fusion protein is expressed in the correct lin-15B spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-15B transcription factor. made_by : S Kim )|Snyder_LIN15B_Input_L4_rep1|L4	OP184(official name : ...	ChIP-Seq
SRX146488	SRA052577	Snyder_LIN15B_Input_L4_rep2_extraction2_seq1_aliquote_1	Snyder_LIN15B_Input_L4_rep2_extraction2_seq1_al...	Snyder_LIN15B_Input_L4_rep2	Snyder_LIN15B_Input_L4...	OP184(official name : OP184 genotype : unc119(ed3); wgIs184(lin-15B::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-15B::EGFP fusion protein is expressed in the correct lin-15B spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-15B transcription factor. made_by : S Kim )|Snyder_LIN15B_Input_L4_rep2|L4	OP184(official name : ...	ChIP-Seq
SRX146489	SRA052577	Snyder_LIN15B_GFP_L4_rep1_extraction1_seq1_aliquote_1	Snyder_LIN15B_GFP_L4_rep1_extraction1_seq1_aliq...	Snyder_LIN15B_GFP_L4_rep1	Snyder_LIN15B_GFP_L4_rep1	OP184(official name : OP184 genotype : unc119(ed3); wgIs184(lin-15B::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-15B::EGFP fusion protein is expressed in the correct lin-15B spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-15B transcription factor. made_by : S Kim )|Snyder_LIN15B_GFP_L4_rep1|L4	OP184(official name : ...	ChIP-Seq
SRX146490	SRA052577	Snyder_LIN15B_GFP_L4_rep2_extraction2_seq1_aliquote_1	Snyder_LIN15B_GFP_L4_rep2_extraction2_seq1_aliq...	Snyder_LIN15B_GFP_L4_rep2	Snyder_LIN15B_GFP_L4_rep2	OP184(official name : OP184 genotype : unc119(ed3); wgIs184(lin-15B::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-15B::EGFP fusion protein is expressed in the correct lin-15B spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-15B transcription factor. made_by : S Kim )|Snyder_LIN15B_GFP_L4_rep2|L4	OP184(official name : ...	ChIP-Seq
SRX146498	SRA052584	Snyder_EOR-1_Input_L3_rep1_extraction1_seq1_aliquote_1	Snyder_EOR-1_Input_L3_rep1_extraction1_seq1_ali...	Snyder_EOR-1_Input_L3_rep1	Snyder_EOR-1_Input_L3_...	OP81(official name : OP81 genotype : unc-119(ed3) III; wgIs81 unc-119(+) eor-1::TY1::EGFP::3xFLAG outcross : 0 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The EOR-1::EGFP fusion protein is expressed in the correct eor-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the EOR-1 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_EOR-1_Input_L3_rep1|L3	OP81(official name : O...	ChIP-Seq
SRX146499	SRA052584	Snyder_EOR-1_Input_L3_rep2_extraction2_seq1_aliquote_1	Snyder_EOR-1_Input_L3_rep2_extraction2_seq1_ali...	Snyder_EOR-1_Input_L3_rep2	Snyder_EOR-1_Input_L3_...	OP81(official name : OP81 genotype : unc-119(ed3) III; wgIs81 unc-119(+) eor-1::TY1::EGFP::3xFLAG outcross : 0 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The EOR-1::EGFP fusion protein is expressed in the correct eor-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the EOR-1 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_EOR-1_Input_L3_rep2|L3	OP81(official name : O...	ChIP-Seq
SRX146500	SRA052584	Snyder_EOR-1_GFP_L3_rep1_extraction1_seq1_aliquote_1	Snyder_EOR-1_GFP_L3_rep1_extraction1_seq1_aliqu...	Snyder_EOR-1_GFP_L3_rep1	Snyder_EOR-1_GFP_L3_rep1	OP81(official name : OP81 genotype : unc-119(ed3) III; wgIs81 unc-119(+) eor-1::TY1::EGFP::3xFLAG outcross : 0 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The EOR-1::EGFP fusion protein is expressed in the correct eor-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the EOR-1 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_EOR-1_GFP_L3_rep1|L3	OP81(official name : O...	ChIP-Seq
SRX146501	SRA052584	Snyder_EOR-1_GFP_L3_rep2_extraction2_seq1_aliquote_1	Snyder_EOR-1_GFP_L3_rep2_extraction2_seq1_aliqu...	Snyder_EOR-1_GFP_L3_rep2	Snyder_EOR-1_GFP_L3_rep2	OP81(official name : OP81 genotype : unc-119(ed3) III; wgIs81 unc-119(+) eor-1::TY1::EGFP::3xFLAG outcross : 0 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The EOR-1::EGFP fusion protein is expressed in the correct eor-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the EOR-1 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_EOR-1_GFP_L3_rep2|L3	OP81(official name : O...	ChIP-Seq
SRX146502	SRA052585	Snyder_NHR11_Input_L2_rep1_extraction1_seq1_aliquote_1	Snyder_NHR11_Input_L2_rep1_extraction1_seq1_ali...	Snyder_NHR11_Input_L2_rep1	Snyder_NHR11_Input_L2_...	OP305(official name : OP305 genotype : unc119(ed3); wgIs305(nhr-11::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-11::EGFP fusion protein is expressed in the correct nhr-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-11 transcription factor. made_by : R Waterston )|Snyder_NHR11_Input_L2_rep1|L2	OP305(official name : ...	ChIP-Seq
SRX146503	SRA052585	Snyder_NHR11_Input_L2_rep2_extraction2_seq1_aliquote_1	Snyder_NHR11_Input_L2_rep2_extraction2_seq1_ali...	Snyder_NHR11_Input_L2_rep2	Snyder_NHR11_Input_L2_...	OP305(official name : OP305 genotype : unc119(ed3); wgIs305(nhr-11::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-11::EGFP fusion protein is expressed in the correct nhr-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-11 transcription factor. made_by : R Waterston )|Snyder_NHR11_Input_L2_rep2|L2	OP305(official name : ...	ChIP-Seq
SRX146504	SRA052585	Snyder_NHR11_GFP_L2_rep1_extraction1_seq1_aliquote_1	Snyder_NHR11_GFP_L2_rep1_extraction1_seq1_aliqu...	Snyder_NHR11_GFP_L2_rep1	Snyder_NHR11_GFP_L2_rep1	OP305(official name : OP305 genotype : unc119(ed3); wgIs305(nhr-11::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-11::EGFP fusion protein is expressed in the correct nhr-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-11 transcription factor. made_by : R Waterston )|Snyder_NHR11_GFP_L2_rep1|L2	OP305(official name : ...	ChIP-Seq
SRX146505	SRA052585	Snyder_NHR11_GFP_L2_rep2_extraction2_seq1_aliquote_1	Snyder_NHR11_GFP_L2_rep2_extraction2_seq1_aliqu...	Snyder_NHR11_GFP_L2_rep2	Snyder_NHR11_GFP_L2_rep2	OP305(official name : OP305 genotype : unc119(ed3); wgIs305(nhr-11::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-11::EGFP fusion protein is expressed in the correct nhr-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-11 transcription factor. made_by : R Waterston )|Snyder_NHR11_GFP_L2_rep2|L2	OP305(official name : ...	ChIP-Seq
SRX146506	SRA052586	Snyder_SEA2_GFP_L3_rep1_extraction1_seq1_aliquote_1	Snyder_SEA2_GFP_L3_rep1_extraction1_seq1_aliquo...	Snyder_SEA2_GFP_L3_rep1	Snyder_SEA2_GFP_L3_rep1	OP193(official name : OP193 genotype : unc-119(ed3); wgIs193(sea-2::TY1 EGFP FLAG C; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The SEA-2::EGFP fusion protein is expressed in the correct sea-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the SEA-2 transcription factor. made_by : )|Snyder_SEA2_GFP_L3_rep1|L3	OP193(official name : ...	ChIP-Seq
SRX146507	SRA052586	Snyder_SEA2_GFP_L3_rep2_extraction2_seq1_aliquote_1	Snyder_SEA2_GFP_L3_rep2_extraction2_seq1_aliquo...	Snyder_SEA2_GFP_L3_rep2	Snyder_SEA2_GFP_L3_rep2	OP193(official name : OP193 genotype : unc-119(ed3); wgIs193(sea-2::TY1 EGFP FLAG C; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The SEA-2::EGFP fusion protein is expressed in the correct sea-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the SEA-2 transcription factor. made_by : )|Snyder_SEA2_GFP_L3_rep2|L3	OP193(official name : ...	ChIP-Seq
SRX146508	SRA052586	Snyder_SEA2_Input_L3_rep1_extraction1_seq1_aliquote_1	Snyder_SEA2_Input_L3_rep1_extraction1_seq1_aliq...	Snyder_SEA2_Input_L3_rep1	Snyder_SEA2_Input_L3_rep1	OP193(official name : OP193 genotype : unc-119(ed3); wgIs193(sea-2::TY1 EGFP FLAG C; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The SEA-2::EGFP fusion protein is expressed in the correct sea-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the SEA-2 transcription factor. made_by : )|Snyder_SEA2_Input_L3_rep1|L3	OP193(official name : ...	ChIP-Seq
SRX146509	SRA052586	Snyder_SEA2_Input_L3_rep2_extraction2_seq1_aliquote_1	Snyder_SEA2_Input_L3_rep2_extraction2_seq1_aliq...	Snyder_SEA2_Input_L3_rep2	Snyder_SEA2_Input_L3_rep2	OP193(official name : OP193 genotype : unc-119(ed3); wgIs193(sea-2::TY1 EGFP FLAG C; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The SEA-2::EGFP fusion protein is expressed in the correct sea-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the SEA-2 transcription factor. made_by : )|Snyder_SEA2_Input_L3_rep2|L3	OP193(official name : ...	ChIP-Seq
SRX146510	SRA052587	Snyder_DAF12_Input_L3_rep1_extraction1_seq1_aliquote_1	Snyder_DAF12_Input_L3_rep1_extraction1_seq1_ali...	Snyder_DAF12_Input_L3_rep1	Snyder_DAF12_Input_L3_...	OP167(official name : OP167 genotype : unc119(ed3); wgIs167(daf-12::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The DAF-12::EGFP fusion protein is expressed in the correct daf-12 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the DAF-12 transcription factor. made_by : S Kim )|Snyder_DAF12_Input_L3_rep1|L3	OP167(official name : ...	ChIP-Seq
SRX146511	SRA052587	Snyder_DAF12_Input_L3_rep2_extraction2_seq1_aliquote_1	Snyder_DAF12_Input_L3_rep2_extraction2_seq1_ali...	Snyder_DAF12_Input_L3_rep2	Snyder_DAF12_Input_L3_...	OP167(official name : OP167 genotype : unc119(ed3); wgIs167(daf-12::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The DAF-12::EGFP fusion protein is expressed in the correct daf-12 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the DAF-12 transcription factor. made_by : S Kim )|Snyder_DAF12_Input_L3_rep2|L3	OP167(official name : ...	ChIP-Seq
SRX146512	SRA052587	Snyder_DAF12_GFP_L3_rep1_extraction1_seq1_aliquote_1	Snyder_DAF12_GFP_L3_rep1_extraction1_seq1_aliqu...	Snyder_DAF12_GFP_L3_rep1	Snyder_DAF12_GFP_L3_rep1	OP167(official name : OP167 genotype : unc119(ed3); wgIs167(daf-12::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The DAF-12::EGFP fusion protein is expressed in the correct daf-12 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the DAF-12 transcription factor. made_by : S Kim )|Snyder_DAF12_GFP_L3_rep1|L3	OP167(official name : ...	ChIP-Seq
SRX146513	SRA052587	Snyder_DAF12_GFP_L3_rep2_extraction2_seq1_aliquote_1	Snyder_DAF12_GFP_L3_rep2_extraction2_seq1_aliqu...	Snyder_DAF12_GFP_L3_rep2	Snyder_DAF12_GFP_L3_rep2	OP167(official name : OP167 genotype : unc119(ed3); wgIs167(daf-12::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The DAF-12::EGFP fusion protein is expressed in the correct daf-12 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the DAF-12 transcription factor. made_by : S Kim )|Snyder_DAF12_GFP_L3_rep2|L3	OP167(official name : ...	ChIP-Seq
SRX146514	SRA052588	Snyder_F16B12.6_Input_L1_rep1_extraction1_seq1_aliquote_1	Snyder_F16B12.6_Input_L1_rep1_extraction1_seq1_...	Snyder_F16B12.6_Input_L1_rep1	Snyder_F16B12.6_Input_...	OP114(official name : OP114 genotype : unc119(ed3); wgIs114(F16B12.6::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The F16B12.6::EGFP fusion protein is expressed in the correct F16B12.6 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the F16B12.6 transcription factor. made_by : R Waterston )|Snyder_F16B12.6_Input_L1_rep1|fed L1	OP114(official name : ...	ChIP-Seq
SRX146515	SRA052588	Snyder_F16B12.6_Input_L1_rep2_extraction2_seq1_aliquote_1	Snyder_F16B12.6_Input_L1_rep2_extraction2_seq1_...	Snyder_F16B12.6_Input_L1_rep2	Snyder_F16B12.6_Input_...	OP114(official name : OP114 genotype : unc119(ed3); wgIs114(F16B12.6::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The F16B12.6::EGFP fusion protein is expressed in the correct F16B12.6 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the F16B12.6 transcription factor. made_by : R Waterston )|Snyder_F16B12.6_Input_L1_rep2|fed L1	OP114(official name : ...	ChIP-Seq
SRX146516	SRA052588	Snyder_F16B12.6_GFP_L1_rep1_extraction1_seq1_aliquote_1	Snyder_F16B12.6_GFP_L1_rep1_extraction1_seq1_al...	Snyder_F16B12.6_GFP_L1_rep1	Snyder_F16B12.6_GFP_L1...	OP114(official name : OP114 genotype : unc119(ed3); wgIs114(F16B12.6::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The F16B12.6::EGFP fusion protein is expressed in the correct F16B12.6 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the F16B12.6 transcription factor. made_by : R Waterston )|Snyder_F16B12.6_GFP_L1_rep1|fed L1	OP114(official name : ...	ChIP-Seq
SRX146517	SRA052588	Snyder_F16B12.6_GFP_L1_rep2_extraction2_seq1_aliquote_1	Snyder_F16B12.6_GFP_L1_rep2_extraction2_seq1_al...	Snyder_F16B12.6_GFP_L1_rep2	Snyder_F16B12.6_GFP_L1...	OP114(official name : OP114 genotype : unc119(ed3); wgIs114(F16B12.6::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The F16B12.6::EGFP fusion protein is expressed in the correct F16B12.6 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the F16B12.6 transcription factor. made_by : R Waterston )|Snyder_F16B12.6_GFP_L1_rep2|fed L1	OP114(official name : ...	ChIP-Seq
SRX146518	SRA052589	Snyder_GEI-11_Input_L2_rep1_extraction1_seq1_aliquote_1	Snyder_GEI-11_Input_L2_rep1_extraction1_seq1_al...	Snyder_GEI-11_Input_L2_rep1	Snyder_GEI-11_Input_L2...	OP179(official name : OP179 genotype : unc-119(ed3) III; wgIs179 unc-119(+) gei-11::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The GEI-11::EGFP fusion protein is expressed in the correct gei-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the GEI-11 transcription factor. made_by : R. Waterston )|Snyder_GEI-11_Input_L2_rep1|L2	OP179(official name : ...	ChIP-Seq
SRX146519	SRA052589	Snyder_GEI-11_Input_L2_rep2_extraction2_seq1_aliquote_1	Snyder_GEI-11_Input_L2_rep2_extraction2_seq1_al...	Snyder_GEI-11_Input_L2_rep2	Snyder_GEI-11_Input_L2...	OP179(official name : OP179 genotype : unc-119(ed3) III; wgIs179 unc-119(+) gei-11::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The GEI-11::EGFP fusion protein is expressed in the correct gei-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the GEI-11 transcription factor. made_by : R. Waterston )|Snyder_GEI-11_Input_L2_rep2|L2	OP179(official name : ...	ChIP-Seq
SRX146520	SRA052589	Snyder_GEI-11_GFP_L2_rep1_extraction1_seq1_aliquote_1	Snyder_GEI-11_GFP_L2_rep1_extraction1_seq1_aliq...	Snyder_GEI-11_GFP_L2_rep1	Snyder_GEI-11_GFP_L2_rep1	OP179(official name : OP179 genotype : unc-119(ed3) III; wgIs179 unc-119(+) gei-11::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The GEI-11::EGFP fusion protein is expressed in the correct gei-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the GEI-11 transcription factor. made_by : R. Waterston )|Snyder_GEI-11_GFP_L2_rep1|L2	OP179(official name : ...	ChIP-Seq
SRX146521	SRA052589	Snyder_GEI-11_GFP_L2_rep2_extraction2_seq1_aliquote_1	Snyder_GEI-11_GFP_L2_rep2_extraction2_seq1_aliq...	Snyder_GEI-11_GFP_L2_rep2	Snyder_GEI-11_GFP_L2_rep2	OP179(official name : OP179 genotype : unc-119(ed3) III; wgIs179 unc-119(+) gei-11::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The GEI-11::EGFP fusion protein is expressed in the correct gei-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the GEI-11 transcription factor. made_by : R. Waterston )|Snyder_GEI-11_GFP_L2_rep2|L2	OP179(official name : ...	ChIP-Seq
SRX147611	SRA052687	Snyder_MEF-2_Input_L1_rep1_extraction1_seq1_aliquote_1	Snyder_MEF-2_Input_L1_rep1_extraction1_seq1_ali...	Snyder_MEF-2_Input_L1_rep1	Snyder_MEF-2_Input_L1_...	OP301(official name : OP301 genotype : unc119(ed3); wgIs301(mef-2::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The MEF-2::EGFP fusion protein is expressed in the correct mef-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the MEF-2 transcription factor. made_by : R Waterston )|Snyder_MEF-2_Input_L1_rep1|fed L1	OP301(official name : ...	ChIP-Seq
SRX147612	SRA052687	Snyder_MEF-2_Input_L1_rep2_extraction2_seq1_aliquote_1	Snyder_MEF-2_Input_L1_rep2_extraction2_seq1_ali...	Snyder_MEF-2_Input_L1_rep2	Snyder_MEF-2_Input_L1_...	OP301(official name : OP301 genotype : unc119(ed3); wgIs301(mef-2::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The MEF-2::EGFP fusion protein is expressed in the correct mef-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the MEF-2 transcription factor. made_by : R Waterston )|Snyder_MEF-2_Input_L1_rep2|fed L1	OP301(official name : ...	ChIP-Seq
SRX147613	SRA052687	Snyder_MEF-2_GFP_L1_rep1_extraction1_seq1_aliquote_1	Snyder_MEF-2_GFP_L1_rep1_extraction1_seq1_aliqu...	Snyder_MEF-2_GFP_L1_rep1	Snyder_MEF-2_GFP_L1_rep1	OP301(official name : OP301 genotype : unc119(ed3); wgIs301(mef-2::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The MEF-2::EGFP fusion protein is expressed in the correct mef-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the MEF-2 transcription factor. made_by : R Waterston )|Snyder_MEF-2_GFP_L1_rep1|fed L1	OP301(official name : ...	ChIP-Seq
SRX147614	SRA052687	Snyder_MEF-2_GFP_L1_rep2_extraction2_seq1_aliquote_1	Snyder_MEF-2_GFP_L1_rep2_extraction2_seq1_aliqu...	Snyder_MEF-2_GFP_L1_rep2	Snyder_MEF-2_GFP_L1_rep2	OP301(official name : OP301 genotype : unc119(ed3); wgIs301(mef-2::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The MEF-2::EGFP fusion protein is expressed in the correct mef-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the MEF-2 transcription factor. made_by : R Waterston )|Snyder_MEF-2_GFP_L1_rep2|fed L1	OP301(official name : ...	ChIP-Seq
SRX147615	SRA052688	Snyder_FOS-1_Input_L3_rep1_extraction1_seq1_aliquote_1	Snyder_FOS-1_Input_L3_rep1_extraction1_seq1_ali...	Snyder_FOS-1_Input_L3_rep1	Snyder_FOS-1_Input_L3_...	OP304(official name : OP304 genotype : unc119(ed3); wgIs304(fos-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The FOS-1::EGFP fusion protein is expressed in the correct fos-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the FOS-1 transcription factor. made_by : R Waterston )|Snyder_FOS-1_Input_L3_rep1|L3	OP304(official name : ...	ChIP-Seq
SRX147616	SRA052688	Snyder_FOS-1_Input_L3_rep2_extraction2_seq1_aliquote_1	Snyder_FOS-1_Input_L3_rep2_extraction2_seq1_ali...	Snyder_FOS-1_Input_L3_rep2	Snyder_FOS-1_Input_L3_...	OP304(official name : OP304 genotype : unc119(ed3); wgIs304(fos-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The FOS-1::EGFP fusion protein is expressed in the correct fos-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the FOS-1 transcription factor. made_by : R Waterston )|Snyder_FOS-1_Input_L3_rep2|L3	OP304(official name : ...	ChIP-Seq
SRX147617	SRA052688	Snyder_FOS-1_GFP_L3_rep1_extraction1_seq1_aliquote_1	Snyder_FOS-1_GFP_L3_rep1_extraction1_seq1_aliqu...	Snyder_FOS-1_GFP_L3_rep1	Snyder_FOS-1_GFP_L3_rep1	OP304(official name : OP304 genotype : unc119(ed3); wgIs304(fos-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The FOS-1::EGFP fusion protein is expressed in the correct fos-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the FOS-1 transcription factor. made_by : R Waterston )|Snyder_FOS-1_GFP_L3_rep1|L3	OP304(official name : ...	ChIP-Seq
SRX147618	SRA052688	Snyder_FOS-1_GFP_L3_rep2_extraction2_seq1_aliquote_1	Snyder_FOS-1_GFP_L3_rep2_extraction2_seq1_aliqu...	Snyder_FOS-1_GFP_L3_rep2	Snyder_FOS-1_GFP_L3_rep2	OP304(official name : OP304 genotype : unc119(ed3); wgIs304(fos-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The FOS-1::EGFP fusion protein is expressed in the correct fos-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the FOS-1 transcription factor. made_by : R Waterston )|Snyder_FOS-1_GFP_L3_rep2|L3	OP304(official name : ...	ChIP-Seq
SRX147619	SRA052689	Snyder_FOS-1_Input_L4_rep1_extraction1_seq1_aliquote_1	Snyder_FOS-1_Input_L4_rep1_extraction1_seq1_ali...	Snyder_FOS-1_Input_L4_rep1	Snyder_FOS-1_Input_L4_...	OP304(official name : OP304 genotype : unc119(ed3); wgIs304(fos-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The FOS-1::EGFP fusion protein is expressed in the correct fos-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the FOS-1 transcription factor. made_by : R Waterston )|Snyder_FOS-1_Input_L4_rep1|L4	OP304(official name : ...	ChIP-Seq
SRX147620	SRA052689	Snyder_FOS-1_Input_L4_rep2_extraction2_seq1	Snyder_FOS-1_Input_L4_rep2_extraction2_seq1	Snyder_FOS-1_Input_L4_rep2	Snyder_FOS-1_Input_L4_...	OP304(official name : OP304 genotype : unc119(ed3); wgIs304(fos-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The FOS-1::EGFP fusion protein is expressed in the correct fos-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the FOS-1 transcription factor. made_by : R Waterston )|Snyder_FOS-1_Input_L4_rep2|L4	OP304(official name : ...	ChIP-Seq
SRX147621	SRA052689	Snyder_FOS-1_GFP_L4_rep1_extraction1_seq1	Snyder_FOS-1_GFP_L4_rep1_extraction1_seq1	Snyder_FOS-1_GFP_L4_rep1	Snyder_FOS-1_GFP_L4_rep1	OP304(official name : OP304 genotype : unc119(ed3); wgIs304(fos-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The FOS-1::EGFP fusion protein is expressed in the correct fos-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the FOS-1 transcription factor. made_by : R Waterston )|Snyder_FOS-1_GFP_L4_rep1|L4	OP304(official name : ...	ChIP-Seq
SRX147622	SRA052689	Snyder_FOS-1_GFP_L4_rep2_extraction2_seq1	Snyder_FOS-1_GFP_L4_rep2_extraction2_seq1	Snyder_FOS-1_GFP_L4_rep2	Snyder_FOS-1_GFP_L4_rep2	OP304(official name : OP304 genotype : unc119(ed3); wgIs304(fos-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The FOS-1::EGFP fusion protein is expressed in the correct fos-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the FOS-1 transcription factor. made_by : R Waterston )|Snyder_FOS-1_GFP_L4_rep2|L4	OP304(official name : ...	ChIP-Seq
SRX147623	SRA052690	Snyder_ZK377.2_Input_L2_rep1_extraction1_seq1_aliquote_1	Snyder_ZK377.2_Input_L2_rep1_extraction1_seq1_a...	Snyder_ZK377.2_Input_L2_rep1	Snyder_ZK377.2_Input_L...	OP355(official name : OP355 genotype : unc-119(ed3) III; wgIs355(ZK377.2::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The sax-3::EGFP fusion protein is expressed in the correct sax-3 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the sax-3 transcription factor. The sax-3 gene is encoded by the ZK377.2 CDS. made_by : R Waterston )|Snyder_ZK377.2_Input_L2_rep1|L2	OP355(official name : ...	ChIP-Seq
SRX147624	SRA052690	Snyder_ZK377.2_Input_L2_rep2_extraction2_seq1_aliquote_1	Snyder_ZK377.2_Input_L2_rep2_extraction2_seq1_a...	Snyder_ZK377.2_Input_L2_rep2	Snyder_ZK377.2_Input_L...	OP355(official name : OP355 genotype : unc-119(ed3) III; wgIs355(ZK377.2::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The sax-3::EGFP fusion protein is expressed in the correct sax-3 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the sax-3 transcription factor. The sax-3 gene is encoded by the ZK377.2 CDS. made_by : R Waterston )|Snyder_ZK377.2_Input_L2_rep2|L2	OP355(official name : ...	ChIP-Seq
SRX147625	SRA052690	Snyder_ZK377.2_GFP_L2_rep1_extraction1_seq1_aliquote_1	Snyder_ZK377.2_GFP_L2_rep1_extraction1_seq1_ali...	Snyder_ZK377.2_GFP_L2_rep1	Snyder_ZK377.2_GFP_L2_...	OP355(official name : OP355 genotype : unc-119(ed3) III; wgIs355(ZK377.2::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The sax-3::EGFP fusion protein is expressed in the correct sax-3 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the sax-3 transcription factor. The sax-3 gene is encoded by the ZK377.2 CDS. made_by : R Waterston )|Snyder_ZK377.2_GFP_L2_rep1|L2	OP355(official name : ...	ChIP-Seq
SRX147626	SRA052690	Snyder_ZK377.2_GFP_L2_rep2_extraction2_seq1_aliquote_1	Snyder_ZK377.2_GFP_L2_rep2_extraction2_seq1_ali...	Snyder_ZK377.2_GFP_L2_rep2	Snyder_ZK377.2_GFP_L2_...	OP355(official name : OP355 genotype : unc-119(ed3) III; wgIs355(ZK377.2::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The sax-3::EGFP fusion protein is expressed in the correct sax-3 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the sax-3 transcription factor. The sax-3 gene is encoded by the ZK377.2 CDS. made_by : R Waterston )|Snyder_ZK377.2_GFP_L2_rep2|L2	OP355(official name : ...	ChIP-Seq
SRX147627	SRA052691	Snyder_NHR-77_Input_L2_rep1_extraction1_seq1_aliquote_1	Snyder_NHR-77_Input_L2_rep1_extraction1_seq1_al...	Snyder_NHR-77_Input_L2_rep1	Snyder_NHR-77_Input_L2...	OP353(official name : OP353 genotype : unc119(ed3); wgIs353(nhr-77::TY1 EGFP FLAG; unc119) outcross : 3 transgene : nhr-77 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-77::EGFP fusion protein is expressed in the correct nhr-77 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-77 transcription factor. made_by : R Waterston )|Snyder_NHR-77_Input_L2_rep1|L2	OP353(official name : ...	ChIP-Seq
SRX147628	SRA052691	Snyder_NHR-77_Input_L2_rep2_extraction2_seq1_aliquote_1	Snyder_NHR-77_Input_L2_rep2_extraction2_seq1_al...	Snyder_NHR-77_Input_L2_rep2	Snyder_NHR-77_Input_L2...	OP353(official name : OP353 genotype : unc119(ed3); wgIs353(nhr-77::TY1 EGFP FLAG; unc119) outcross : 3 transgene : nhr-77 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-77::EGFP fusion protein is expressed in the correct nhr-77 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-77 transcription factor. made_by : R Waterston )|Snyder_NHR-77_Input_L2_rep2|L2	OP353(official name : ...	ChIP-Seq
SRX147629	SRA052691	Snyder_NHR-77_GFP_L2_rep1_extraction1_seq1_aliquote_1	Snyder_NHR-77_GFP_L2_rep1_extraction1_seq1_aliq...	Snyder_NHR-77_GFP_L2_rep1	Snyder_NHR-77_GFP_L2_rep1	OP353(official name : OP353 genotype : unc119(ed3); wgIs353(nhr-77::TY1 EGFP FLAG; unc119) outcross : 3 transgene : nhr-77 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-77::EGFP fusion protein is expressed in the correct nhr-77 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-77 transcription factor. made_by : R Waterston )|Snyder_NHR-77_GFP_L2_rep1|L2	OP353(official name : ...	ChIP-Seq
SRX147630	SRA052691	Snyder_NHR-77_GFP_L2_rep2_extraction2_seq1_aliquote_1	Snyder_NHR-77_GFP_L2_rep2_extraction2_seq1_aliq...	Snyder_NHR-77_GFP_L2_rep2	Snyder_NHR-77_GFP_L2_rep2	OP353(official name : OP353 genotype : unc119(ed3); wgIs353(nhr-77::TY1 EGFP FLAG; unc119) outcross : 3 transgene : nhr-77 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-77::EGFP fusion protein is expressed in the correct nhr-77 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-77 transcription factor. made_by : R Waterston )|Snyder_NHR-77_GFP_L2_rep2|L2	OP353(official name : ...	ChIP-Seq
SRX147631	SRA052692	Snyder_NHR-77_Input_L4_rep1_extraction1_seq1_aliquote_1	Snyder_NHR-77_Input_L4_rep1_extraction1_seq1_al...	Snyder_NHR-77_Input_L4_rep1	Snyder_NHR-77_Input_L4...	OP353(official name : OP353 genotype : unc119(ed3); wgIs353(nhr-77::TY1 EGFP FLAG; unc119) outcross : 3 transgene : nhr-77 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-77::EGFP fusion protein is expressed in the correct nhr-77 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-77 transcription factor. made_by : R Waterston )|Snyder_NHR-77_Input_L4_rep1|L4	OP353(official name : ...	ChIP-Seq
SRX147632	SRA052692	Snyder_NHR-77_Input_L4_rep2_extraction2_seq1_aliquote_1	Snyder_NHR-77_Input_L4_rep2_extraction2_seq1_al...	Snyder_NHR-77_Input_L4_rep2	Snyder_NHR-77_Input_L4...	OP353(official name : OP353 genotype : unc119(ed3); wgIs353(nhr-77::TY1 EGFP FLAG; unc119) outcross : 3 transgene : nhr-77 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-77::EGFP fusion protein is expressed in the correct nhr-77 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-77 transcription factor. made_by : R Waterston )|Snyder_NHR-77_Input_L4_rep2|L4	OP353(official name : ...	ChIP-Seq
SRX147633	SRA052692	Snyder_NHR-77_GFP_L4_rep1_extraction1_seq1_aliquote_1	Snyder_NHR-77_GFP_L4_rep1_extraction1_seq1_aliq...	Snyder_NHR-77_GFP_L4_rep1	Snyder_NHR-77_GFP_L4_rep1	OP353(official name : OP353 genotype : unc119(ed3); wgIs353(nhr-77::TY1 EGFP FLAG; unc119) outcross : 3 transgene : nhr-77 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-77::EGFP fusion protein is expressed in the correct nhr-77 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-77 transcription factor. made_by : R Waterston )|Snyder_NHR-77_GFP_L4_rep1|L4	OP353(official name : ...	ChIP-Seq
SRX147634	SRA052692	Snyder_NHR-77_GFP_L4_rep2_extraction2_seq1_aliquote_1	Snyder_NHR-77_GFP_L4_rep2_extraction2_seq1_aliq...	Snyder_NHR-77_GFP_L4_rep2	Snyder_NHR-77_GFP_L4_rep2	OP353(official name : OP353 genotype : unc119(ed3); wgIs353(nhr-77::TY1 EGFP FLAG; unc119) outcross : 3 transgene : nhr-77 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-77::EGFP fusion protein is expressed in the correct nhr-77 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-77 transcription factor. made_by : R Waterston )|Snyder_NHR-77_GFP_L4_rep2|L4	OP353(official name : ...	ChIP-Seq
SRX147635	SRA052693	Snyder_NHR-77_Input_L3_rep1_extraction1_seq1_aliquote_1	Snyder_NHR-77_Input_L3_rep1_extraction1_seq1_al...	Snyder_NHR-77_Input_L3_rep1	Snyder_NHR-77_Input_L3...	OP353(official name : OP353 genotype : unc119(ed3); wgIs353(nhr-77::TY1 EGFP FLAG; unc119) outcross : 3 transgene : nhr-77 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-77::EGFP fusion protein is expressed in the correct nhr-77 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-77 transcription factor. made_by : R Waterston )|Snyder_NHR-77_Input_L3_rep1|L3	OP353(official name : ...	ChIP-Seq
SRX147636	SRA052693	Snyder_NHR-77_Input_L3_rep2_extraction2_seq1_aliquote_1	Snyder_NHR-77_Input_L3_rep2_extraction2_seq1_al...	Snyder_NHR-77_Input_L3_rep2	Snyder_NHR-77_Input_L3...	OP353(official name : OP353 genotype : unc119(ed3); wgIs353(nhr-77::TY1 EGFP FLAG; unc119) outcross : 3 transgene : nhr-77 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-77::EGFP fusion protein is expressed in the correct nhr-77 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-77 transcription factor. made_by : R Waterston )|Snyder_NHR-77_Input_L3_rep2|L3	OP353(official name : ...	ChIP-Seq
SRX147637	SRA052693	Snyder_NHR-77_GFP_L3_rep1_extraction1_seq1_aliquote_1	Snyder_NHR-77_GFP_L3_rep1_extraction1_seq1_aliq...	Snyder_NHR-77_GFP_L3_rep1	Snyder_NHR-77_GFP_L3_rep1	OP353(official name : OP353 genotype : unc119(ed3); wgIs353(nhr-77::TY1 EGFP FLAG; unc119) outcross : 3 transgene : nhr-77 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-77::EGFP fusion protein is expressed in the correct nhr-77 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-77 transcription factor. made_by : R Waterston )|Snyder_NHR-77_GFP_L3_rep1|L3	OP353(official name : ...	ChIP-Seq
SRX147638	SRA052693	Snyder_NHR-77_GFP_L3_rep2_extraction2_seq1_aliquote_1	Snyder_NHR-77_GFP_L3_rep2_extraction2_seq1_aliq...	Snyder_NHR-77_GFP_L3_rep2	Snyder_NHR-77_GFP_L3_rep2	OP353(official name : OP353 genotype : unc119(ed3); wgIs353(nhr-77::TY1 EGFP FLAG; unc119) outcross : 3 transgene : nhr-77 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-77::EGFP fusion protein is expressed in the correct nhr-77 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-77 transcription factor. made_by : R Waterston )|Snyder_NHR-77_GFP_L3_rep2|L3	OP353(official name : ...	ChIP-Seq
SRX147639	SRA052694	Snyder_NHR-116_Input_L2_rep1_extraction1_seq1_aliquote_1	Snyder_NHR-116_Input_L2_rep1_extraction1_seq1_a...	Snyder_NHR-116_Input_L2_rep1	Snyder_NHR-116_Input_L...	OP226(official name : OP226 genotype : unc119(ed3); wgIs226(nhr-116::TY1 EGFP FLAG; unc119) outcross : 3 transgene : nhr-116 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-116::EGFP fusion protein is expressed in the correct nhr-116 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-116 transcription factor. made_by : M Sarov )|Snyder_NHR-116_Input_L2_rep1|L2	OP226(official name : ...	ChIP-Seq
SRX147640	SRA052694	Snyder_NHR-116_Input_L2_rep2_extraction2_seq1_aliquote_1	Snyder_NHR-116_Input_L2_rep2_extraction2_seq1_a...	Snyder_NHR-116_Input_L2_rep2	Snyder_NHR-116_Input_L...	OP226(official name : OP226 genotype : unc119(ed3); wgIs226(nhr-116::TY1 EGFP FLAG; unc119) outcross : 3 transgene : nhr-116 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-116::EGFP fusion protein is expressed in the correct nhr-116 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-116 transcription factor. made_by : M Sarov )|Snyder_NHR-116_Input_L2_rep2|L2	OP226(official name : ...	ChIP-Seq
SRX147641	SRA052694	Snyder_NHR-116_GFP_L2_rep1_extraction1_seq1_aliquote_1	Snyder_NHR-116_GFP_L2_rep1_extraction1_seq1_ali...	Snyder_NHR-116_GFP_L2_rep1	Snyder_NHR-116_GFP_L2_...	OP226(official name : OP226 genotype : unc119(ed3); wgIs226(nhr-116::TY1 EGFP FLAG; unc119) outcross : 3 transgene : nhr-116 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-116::EGFP fusion protein is expressed in the correct nhr-116 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-116 transcription factor. made_by : M Sarov )|Snyder_NHR-116_GFP_L2_rep1|L2	OP226(official name : ...	ChIP-Seq
SRX147642	SRA052694	Snyder_NHR-116_GFP_L2_rep2_extraction2_seq1_aliquote_1	Snyder_NHR-116_GFP_L2_rep2_extraction2_seq1_ali...	Snyder_NHR-116_GFP_L2_rep2	Snyder_NHR-116_GFP_L2_...	OP226(official name : OP226 genotype : unc119(ed3); wgIs226(nhr-116::TY1 EGFP FLAG; unc119) outcross : 3 transgene : nhr-116 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-116::EGFP fusion protein is expressed in the correct nhr-116 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-116 transcription factor. made_by : M Sarov )|Snyder_NHR-116_GFP_L2_rep2|L2	OP226(official name : ...	ChIP-Seq
SRX147643	SRA052695	Snyder_F45C12.2_Input_L1_rep1_extraction1_seq1_aliquote_1	Snyder_F45C12.2_Input_L1_rep1_extraction1_seq1_...	Snyder_F45C12.2_Input_L1_rep1	Snyder_F45C12.2_Input_...	OP212(official name : OP212 genotype : unc-119(ed3); wgIs212(F45C12.2:TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The F45C12.2::EGFP fusion protein is expressed in the correct F45C12.2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the F45C12.2 transcription factor. made_by : Mihail Sarov )|Snyder_F45C12.2_Input_L1_rep1|fed L1	OP212(official name : ...	ChIP-Seq
SRX147644	SRA052695	Snyder_F45C12.2_Input_L1_rep2_extraction2_seq1_aliquote_1	Snyder_F45C12.2_Input_L1_rep2_extraction2_seq1_...	Snyder_F45C12.2_Input_L1_rep2	Snyder_F45C12.2_Input_...	OP212(official name : OP212 genotype : unc-119(ed3); wgIs212(F45C12.2:TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The F45C12.2::EGFP fusion protein is expressed in the correct F45C12.2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the F45C12.2 transcription factor. made_by : Mihail Sarov )|Snyder_F45C12.2_Input_L1_rep2|fed L1	OP212(official name : ...	ChIP-Seq
SRX147645	SRA052695	Snyder_F45C12.2_GFP_L1_rep1_extraction1_seq1_aliquote_1	Snyder_F45C12.2_GFP_L1_rep1_extraction1_seq1_al...	Snyder_F45C12.2_GFP_L1_rep1	Snyder_F45C12.2_GFP_L1...	OP212(official name : OP212 genotype : unc-119(ed3); wgIs212(F45C12.2:TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The F45C12.2::EGFP fusion protein is expressed in the correct F45C12.2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the F45C12.2 transcription factor. made_by : Mihail Sarov )|Snyder_F45C12.2_GFP_L1_rep1|fed L1	OP212(official name : ...	ChIP-Seq
SRX147646	SRA052695	Snyder_F45C12.2_GFP_L1_rep2_extraction2_seq1_aliquote_1	Snyder_F45C12.2_GFP_L1_rep2_extraction2_seq1_al...	Snyder_F45C12.2_GFP_L1_rep2	Snyder_F45C12.2_GFP_L1...	OP212(official name : OP212 genotype : unc-119(ed3); wgIs212(F45C12.2:TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The F45C12.2::EGFP fusion protein is expressed in the correct F45C12.2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the F45C12.2 transcription factor. made_by : Mihail Sarov )|Snyder_F45C12.2_GFP_L1_rep2|fed L1	OP212(official name : ...	ChIP-Seq
SRX148637	SRA052988	H3K9me3_chip-IP_from_nrde-3(gg066)_mutant_C._elegans_that_underwent_smg-1_RNAi;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_chip-IP_from_nrde-3(gg066)_mutant_C._el...	H3K9me3|adult C. elegans	H3K9me3	YY158, nrde-3(gg066)|adult C. elegans|adult	YY158, nrde-3(gg066)	ChIP-Seq
SRX148638	SRA052988	H3K9me3_chip-IP_from_nrde-4(gg129)_mutant_C._elegans_that_underwent_smg-1_RNAi;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_chip-IP_from_nrde-4(gg129)_mutant_C._el...	H3K9me3|adult C. elegans	H3K9me3	YY453, nrde-4(gg129)|adult C. elegans|adult	YY453, nrde-4(gg129)	ChIP-Seq
SRX148639	SRA052988	H3K9me3_chip-IP_from_glp-4(bn2)_mutant_C._elegans_that_underwent_smg-1_RNAi;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_chip-IP_from_glp-4(bn2)_mutant_C._elega...	H3K9me3|adult C. elegans	H3K9me3	SS104, glp-4(bn2)|adult C. elegans|adult	SS104, glp-4(bn2)	ChIP-Seq
SRX151400	SRA053391	Snyder_UNC-62_Input_D4YA_rep1_extraction1_seq1_aliquote_1	Snyder_UNC-62_Input_D4YA_rep1_extraction1_seq1_...	Snyder_UNC-62_Input_D4YA_rep1	Snyder_UNC-62_Input_D4...	OP600(official name : OP600 genotype : unc119(ed3); wgIs600(unc-62::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-62::EGFP fusion protein is expressed in the correct unc-62 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-62 transcription factor. made_by : S Kim )|Snyder_UNC-62_Input_D4YA_rep1|Day Four Young Adult	OP600(official name : ...	ChIP-Seq
SRX151401	SRA053391	Snyder_UNC-62_Input_D4YA_rep2_extraction2_seq1_aliquote_1	Snyder_UNC-62_Input_D4YA_rep2_extraction2_seq1_...	Snyder_UNC-62_Input_D4YA_rep2	Snyder_UNC-62_Input_D4...	OP600(official name : OP600 genotype : unc119(ed3); wgIs600(unc-62::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-62::EGFP fusion protein is expressed in the correct unc-62 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-62 transcription factor. made_by : S Kim )|Snyder_UNC-62_Input_D4YA_rep2|Day Four Young Adult	OP600(official name : ...	ChIP-Seq
SRX151402	SRA053391	Snyder_UNC-62_GFP_D4YA_rep1_extraction1_seq1_aliquote_1	Snyder_UNC-62_GFP_D4YA_rep1_extraction1_seq1_al...	Snyder_UNC-62_GFP_D4YA_rep1	Snyder_UNC-62_GFP_D4YA...	OP600(official name : OP600 genotype : unc119(ed3); wgIs600(unc-62::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-62::EGFP fusion protein is expressed in the correct unc-62 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-62 transcription factor. made_by : S Kim )|Snyder_UNC-62_GFP_D4YA_rep1|Day Four Young Adult	OP600(official name : ...	ChIP-Seq
SRX151403	SRA053391	Snyder_UNC-62_GFP_D4YA_rep2_extraction2_seq1_aliquote_1	Snyder_UNC-62_GFP_D4YA_rep2_extraction2_seq1_al...	Snyder_UNC-62_GFP_D4YA_rep2	Snyder_UNC-62_GFP_D4YA...	OP600(official name : OP600 genotype : unc119(ed3); wgIs600(unc-62::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-62::EGFP fusion protein is expressed in the correct unc-62 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-62 transcription factor. made_by : S Kim )|Snyder_UNC-62_GFP_D4YA_rep2|Day Four Young Adult	OP600(official name : ...	ChIP-Seq
SRX151404	SRA053392	Snyder_ZAG-1_Input_L4_rep1_extraction1_seq1_aliquote_1	Snyder_ZAG-1_Input_L4_rep1_extraction1_seq1_ali...	Snyder_ZAG-1_Input_L4_rep1	Snyder_ZAG-1_Input_L4_...	OP83(official name : OP83 genotype : unc119(ed3); wgIs83(zag-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ZAG-1::EGFP fusion protein is expressed in the correct zag-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZAG-1 transcription factor. made_by : R Waterston )|Snyder_ZAG-1_Input_L4_rep1|L4	OP83(official name : O...	ChIP-Seq
SRX151405	SRA053392	Snyder_ZAG-1_Input_L4_rep2_extraction2_seq1_aliquote_1	Snyder_ZAG-1_Input_L4_rep2_extraction2_seq1_ali...	Snyder_ZAG-1_Input_L4_rep2	Snyder_ZAG-1_Input_L4_...	OP83(official name : OP83 genotype : unc119(ed3); wgIs83(zag-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ZAG-1::EGFP fusion protein is expressed in the correct zag-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZAG-1 transcription factor. made_by : R Waterston )|Snyder_ZAG-1_Input_L4_rep2|L4	OP83(official name : O...	ChIP-Seq
SRX151406	SRA053392	Snyder_ZAG-1_GFP_L4_rep1_extraction1_seq1_aliquote_1	Snyder_ZAG-1_GFP_L4_rep1_extraction1_seq1_aliqu...	Snyder_ZAG-1_GFP_L4_rep1	Snyder_ZAG-1_GFP_L4_rep1	OP83(official name : OP83 genotype : unc119(ed3); wgIs83(zag-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ZAG-1::EGFP fusion protein is expressed in the correct zag-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZAG-1 transcription factor. made_by : R Waterston )|Snyder_ZAG-1_GFP_L4_rep1|L4	OP83(official name : O...	ChIP-Seq
SRX151407	SRA053392	Snyder_ZAG-1_GFP_L4_rep2_extraction2_seq1_aliquote_1	Snyder_ZAG-1_GFP_L4_rep2_extraction2_seq1_aliqu...	Snyder_ZAG-1_GFP_L4_rep2	Snyder_ZAG-1_GFP_L4_rep2	OP83(official name : OP83 genotype : unc119(ed3); wgIs83(zag-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ZAG-1::EGFP fusion protein is expressed in the correct zag-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZAG-1 transcription factor. made_by : R Waterston )|Snyder_ZAG-1_GFP_L4_rep2|L4	OP83(official name : O...	ChIP-Seq
SRX1674086	SRA402427	CstF64_WT_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	CstF64_WT_ChIP-seq;_Caenorhabditis_elegans;_ChI...	Blumenthal lab|Young adults	Blumenthal lab	Young adults	Young adults	ChIP-Seq
SRX1674087	SRA402427	CstF64_WT_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	CstF64_WT_rep1_ChIP-seq;_Caenorhabditis_elegans...	Blumenthal lab|Young adults	Blumenthal lab	Young adults	Young adults	ChIP-Seq
SRX1674088	SRA402427	CstF50_WT_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	CstF50_WT_ChIP-seq;_Caenorhabditis_elegans;_ChI...	Blumenthal lab|Young adults	Blumenthal lab	Young adults	Young adults	ChIP-Seq
SRX1674089	SRA402427	CstF50_WT_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	CstF50_WT_rep1_ChIP-seq;_Caenorhabditis_elegans...	Blumenthal lab|Young adults	Blumenthal lab	Young adults	Young adults	ChIP-Seq
SRX1674090	SRA402427	Total_RNAPII_WT_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	Total_RNAPII_WT_ChIP-seq;_Caenorhabditis_elegan...	8wg16 Millipore (05-952)|Young adults	8wg16 Millipore (05-952)	Young adults	Young adults	ChIP-Seq
SRX1674091	SRA402427	Total_RNAPII_WT_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	Total_RNAPII_WT_rep1_ChIP-seq;_Caenorhabditis_e...	Bentley lab|Young adults	Bentley lab	Young adults	Young adults	ChIP-Seq
SRX1674092	SRA402427	Total_RNAPII_WT_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	Total_RNAPII_WT_rep2_ChIP-seq;_Caenorhabditis_e...	Bentley lab|Young adults	Bentley lab	Young adults	Young adults	ChIP-Seq
SRX1674093	SRA402427	RNAPII_Ser2p_WT_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	RNAPII_Ser2p_WT_ChIP-seq;_Caenorhabditis_elegan...	Ser2p Bethyl (A300-654A)|Young adults	Ser2p Bethyl (A300-654A)	Young adults	Young adults	ChIP-Seq
SRX1674094	SRA402427	RNAPII_Ser2p_WT_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	RNAPII_Ser2p_WT_rep1_ChIP-seq;_Caenorhabditis_e...	Ser2p Bethyl (A300-654A)|Young adults	Ser2p Bethyl (A300-654A)	Young adults	Young adults	ChIP-Seq
SRX1674095	SRA402427	CstF64_in_RNAi_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	CstF64_in_RNAi_ChIP-seq;_Caenorhabditis_elegans...	Blumenthal lab|Young adults	Blumenthal lab	Young adults	Young adults	ChIP-Seq
SRX1674096	SRA402427	CstF64_in_RNAi_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	CstF64_in_RNAi_rep1_ChIP-seq;_Caenorhabditis_el...	Blumenthal lab|Young adults	Blumenthal lab	Young adults	Young adults	ChIP-Seq
SRX1674097	SRA402427	CstF64_in_RNAi_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	CstF64_in_RNAi_rep2_ChIP-seq;_Caenorhabditis_el...	Blumenthal lab|Young adults	Blumenthal lab	Young adults	Young adults	ChIP-Seq
SRX1674098	SRA402427	Total_RNAPII__in_RNAi_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	Total_RNAPII__in_RNAi_ChIP-seq;_Caenorhabditis_...	8wg16 Millipore (05-952)|Young adults	8wg16 Millipore (05-952)	Young adults	Young adults	ChIP-Seq
SRX1674099	SRA402427	Total_RNAPII__in_RNAi_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	Total_RNAPII__in_RNAi_rep1_ChIP-seq;_Caenorhabd...	8wg16 Millipore (05-952)|Young adults	8wg16 Millipore (05-952)	Young adults	Young adults	ChIP-Seq
SRX1674100	SRA402427	RNAPII_Ser2p_in_RNAi_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	RNAPII_Ser2p_in_RNAi_ChIP-seq;_Caenorhabditis_e...	Ser2p Bethyl (A300-654A)|Young adults	Ser2p Bethyl (A300-654A)	Young adults	Young adults	ChIP-Seq
SRX1674101	SRA402427	RNAPII_Ser2p_in_RNAi_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	RNAPII_Ser2p_in_RNAi_rep1_ChIP-seq;_Caenorhabdi...	Ser2p Bethyl (A300-654A)|Young adults	Ser2p Bethyl (A300-654A)	Young adults	Young adults	ChIP-Seq
SRX1674102	SRA402427	WT_H3K9me3;_Caenorhabditis_elegans;_ChIP-Seq	WT_H3K9me3;_Caenorhabditis_elegans;_ChIP-Seq	Abcam (ab8898)|Young adults	Abcam (ab8898)	Young adults	Young adults	ChIP-Seq
SRX1674103	SRA402427	WT_Input_DNA;_Caenorhabditis_elegans;_ChIP-Seq	WT_Input_DNA;_Caenorhabditis_elegans;_ChIP-Seq	None|Young adults	None	Young adults	Young adults	ChIP-Seq
SRX172525	SRA056509	H4K20me1_ChIP-seq_of_wild-type;_Caenorhabditis_elegans;_ChIP-Seq	H4K20me1_ChIP-seq_of_wild-type;_Caenorhabditis_...	anti-H4K20me1|L3 larvae, wild-type, H4K20me1 ChIP	anti-H4K20me1	N2|L3 larvae, wild-type, H4K20me1 ChIP|whole body|L3 larvae	N2	ChIP-Seq
SRX172526	SRA056509	H4K20me1_ChIP-seq_of_set-4_mutant,_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H4K20me1_ChIP-seq_of_set-4_mutant,_rep1;_Caenor...	anti-H4K20me1|L3 larvae, set-4 mutant, H4K20me1 ChIP	anti-H4K20me1	L3 larvae, set-4 mutant, H4K20me1 ChIP|whole body|L3 larvae	L3 larvae, set-4 mutan...	ChIP-Seq
SRX172527	SRA056509	H4K20me1_ChIP-seq_of_set-4_mutant,_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H4K20me1_ChIP-seq_of_set-4_mutant,_rep2;_Caenor...	anti-H4K20me1|L3 larvae, set-4 mutant, H4K20me1 ChIP	anti-H4K20me1	L3 larvae, set-4 mutant, H4K20me1 ChIP|whole body|L3 larvae	L3 larvae, set-4 mutan...	ChIP-Seq
SRX1769982	SRA426621	ChIP-seq_of_HSF-1_in_L2_larvae_at_20C,_replicate_1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_HSF-1_in_L2_larvae_at_20C,_replicat...	anti-GFP (clontech, #632592)|L2 larvae	anti-GFP (clontech, #6...	AM1061|L2 larvae|whole animal|L2 larvae	AM1061	ChIP-Seq
SRX1769983	SRA426621	ChIP-seq_of_HSF-1_in_L2_larvae_at_20C,_replicate_2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_HSF-1_in_L2_larvae_at_20C,_replicat...	anti-GFP (clontech, #632592)|L2 larvae	anti-GFP (clontech, #6...	AM1061|L2 larvae|whole animal|L2 larvae	AM1061	ChIP-Seq
SRX1769984	SRA426621	ChIP-seq_of_HSF-1_in_L2_larvae_at_34C,_replicate_1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_HSF-1_in_L2_larvae_at_34C,_replicat...	anti-GFP (clontech, #632592)|L2 larvae	anti-GFP (clontech, #6...	AM1061|L2 larvae|whole animal|L2 larvae	AM1061	ChIP-Seq
SRX1769985	SRA426621	ChIP-seq_of_HSF-1_in_L2_larvae_at_34C,_replicate_2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_HSF-1_in_L2_larvae_at_34C,_replicat...	anti-GFP (clontech, #632592)|L2 larvae	anti-GFP (clontech, #6...	AM1061|L2 larvae|whole animal|L2 larvae	AM1061	ChIP-Seq
SRX1769986	SRA426621	ChIP-seq_of_Pol_II_in_L2_larvae_at_20C,_replicate_1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_Pol_II_in_L2_larvae_at_20C,_replica...	anti-AMA-1 (Novus, #38520002)|L2 larvae	anti-AMA-1 (Novus, #38...	AM1061|L2 larvae|whole animal|L2 larvae	AM1061	ChIP-Seq
SRX1769987	SRA426621	ChIP-seq_of_Pol_II_in_L2_larvae_at_20C,_replicate_2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_Pol_II_in_L2_larvae_at_20C,_replica...	anti-AMA-1 (Novus, #38520002)|L2 larvae	anti-AMA-1 (Novus, #38...	AM1061|L2 larvae|whole animal|L2 larvae	AM1061	ChIP-Seq
SRX1769988	SRA426621	ChIP-seq_of_Pol_II_in_L2_larvae_at_34C,_replicate_1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_Pol_II_in_L2_larvae_at_34C,_replica...	anti-AMA-1 (Novus, #38520002)|L2 larvae	anti-AMA-1 (Novus, #38...	AM1061|L2 larvae|whole animal|L2 larvae	AM1061	ChIP-Seq
SRX1769989	SRA426621	ChIP-seq_of_Pol_II_in_L2_larvae_at_34C,_replicate_2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_Pol_II_in_L2_larvae_at_34C,_replica...	anti-AMA-1 (Novus, #38520002)|L2 larvae	anti-AMA-1 (Novus, #38...	AM1061|L2 larvae|whole animal|L2 larvae	AM1061	ChIP-Seq
SRX1769990	SRA426621	ChIP-seq_of_HSF-1_in_YA_animals__at_20C,_replicate_1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_HSF-1_in_YA_animals__at_20C,_replic...	anti-GFP (clontech, #632592)|young adults	anti-GFP (clontech, #6...	AM1061|young adults|whole animal|young adults	AM1061	ChIP-Seq
SRX1769991	SRA426621	ChIP-seq_of_HSF-1_in_YA_animals_at_20C,_replicate_2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_HSF-1_in_YA_animals_at_20C,_replica...	anti-GFP (clontech, #632592)|young adults	anti-GFP (clontech, #6...	AM1061|young adults|whole animal|young adults	AM1061	ChIP-Seq
SRX1769992	SRA426621	ChIP-seq_of_HSF-1_in_YA_animals_at_34C,_replicate_1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_HSF-1_in_YA_animals_at_34C,_replica...	anti-GFP (clontech, #632592)|young adults	anti-GFP (clontech, #6...	AM1061|young adults|whole animal|young adults	AM1061	ChIP-Seq
SRX1769993	SRA426621	ChIP-seq_of_HSF-1_in_YA_animals_at_34C,_replicate_2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_HSF-1_in_YA_animals_at_34C,_replica...	anti-GFP (clontech, #632592)|young adults	anti-GFP (clontech, #6...	AM1061|young adults|whole animal|young adults	AM1061	ChIP-Seq
SRX1769994	SRA426621	ChIP-seq_of_Pol_II_in_YA_animals_at_20C,_replicate_1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_Pol_II_in_YA_animals_at_20C,_replic...	anti-AMA-1 (Novus, #38520002)|young adults	anti-AMA-1 (Novus, #38...	AM1061|young adults|whole animal|young adults	AM1061	ChIP-Seq
SRX1769995	SRA426621	ChIP-seq_of_Pol_II_in_YA_animals_at_20C,_replicate_2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_Pol_II_in_YA_animals_at_20C,_replic...	anti-AMA-1 (Novus, #38520002)|young adults	anti-AMA-1 (Novus, #38...	AM1061|young adults|whole animal|young adults	AM1061	ChIP-Seq
SRX1769996	SRA426621	ChIP-seq_of_Pol_II_in_YA_animals_at_34C,_replicate_1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_Pol_II_in_YA_animals_at_34C,_replic...	anti-AMA-1 (Novus, #38520002)|young adults	anti-AMA-1 (Novus, #38...	AM1061|young adults|whole animal|young adults	AM1061	ChIP-Seq
SRX1769997	SRA426621	ChIP-seq_of_Pol_II_in_YA_animals_at_34C,_replicate_2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_Pol_II_in_YA_animals_at_34C,_replic...	anti-AMA-1 (Novus, #38520002)|young adults	anti-AMA-1 (Novus, #38...	AM1061|young adults|whole animal|young adults	AM1061	ChIP-Seq
SRX1769998	SRA426621	Input_DNA_for_ChIPs_in_L2_Larvae;_Caenorhabditis_elegans;_ChIP-Seq	Input_DNA_for_ChIPs_in_L2_Larvae;_Caenorhabditi...	Input|L2 larvae	Input	AM1061|L2 larvae|whole animal|L2 larvae	AM1061	ChIP-Seq
SRX1769999	SRA426621	Input_DNA_for_ChIPs_in_YA_animals;_Caenorhabditis_elegans;_ChIP-Seq	Input_DNA_for_ChIPs_in_YA_animals;_Caenorhabdit...	Input|young adults	Input	AM1061|young adults|whole animal|young adults	AM1061	ChIP-Seq
SRX1844113	SRA433807	CEBP-1_ChIP;_Caenorhabditis_elegans;_ChIP-Seq	CEBP-1_ChIP;_Caenorhabditis_elegans;_ChIP-Seq	C. elegans whole worm lysate	C. elegans whole worm ...	C. elegans whole worm lysate	C. elegans whole worm ...	ChIP-Seq
SRX1844114	SRA433807	Input_DNA;_Caenorhabditis_elegans;_ChIP-Seq	Input_DNA;_Caenorhabditis_elegans;_ChIP-Seq	C. elegans whole worm lysate	C. elegans whole worm ...	C. elegans whole worm lysate	C. elegans whole worm ...	ChIP-Seq
SRX188613	SRA058874	Snyder_EOR-1_POL-2_L3_replicate_1	Snyder_EOR-1_POL-2_L3_replicate_1	Snyder_EOR-1_POL-2_L3_rep1	Snyder_EOR-1_POL-2_L3_...	OP54(official name : OP54 genotype : unc-119(ed3) III; wgIs54 unc-119(+) egl-5::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The EOR-1::EGFP fusion protein is expressed in the correct egl-5 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the EOR-1 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_EOR-1_POL-2_L3_rep1|L3	OP54(official name : O...	ChIP-Seq
SRX188614	SRA058874	Snyder_EOR-1_POL-2_L3_replicate_2	Snyder_EOR-1_POL-2_L3_replicate_2	Snyder_EOR-1_POL-2_L3_rep2	Snyder_EOR-1_POL-2_L3_...	OP54(official name : OP54 genotype : unc-119(ed3) III; wgIs54 unc-119(+) egl-5::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The EOR-1::EGFP fusion protein is expressed in the correct egl-5 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the EOR-1 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_EOR-1_POL-2_L3_rep2|L3	OP54(official name : O...	ChIP-Seq
SRX188615	SRA058874	Snyder_EOR-1_Input_L3_replicate_1	Snyder_EOR-1_Input_L3_replicate_1	Snyder_EOR-1_Input_L3_rep1	Snyder_EOR-1_Input_L3_...	OP54(official name : OP54 genotype : unc-119(ed3) III; wgIs54 unc-119(+) egl-5::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The EOR-1::EGFP fusion protein is expressed in the correct egl-5 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the EOR-1 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_EOR-1_Input_L3_rep1|L3	OP54(official name : O...	ChIP-Seq
SRX188616	SRA058874	Snyder_EOR-1_Input_L3_replicate_2	Snyder_EOR-1_Input_L3_replicate_2	Snyder_EOR-1_Input_L3_rep2	Snyder_EOR-1_Input_L3_...	OP54(official name : OP54 genotype : unc-119(ed3) III; wgIs54 unc-119(+) egl-5::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The EOR-1::EGFP fusion protein is expressed in the correct egl-5 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the EOR-1 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_EOR-1_Input_L3_rep2|L3	OP54(official name : O...	ChIP-Seq
SRX188617	SRA058875	Snyder_EGL-5_POL-2_L3_replicate_1	Snyder_EGL-5_POL-2_L3_replicate_1	Snyder_EGL-5_POL-2_L3_rep1	Snyder_EGL-5_POL-2_L3_...	OP54(official name : OP54 genotype : unc-119(ed3) III; wgIs54 unc-119(+) egl-5::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The EGL-5::EGFP fusion protein is expressed in the correct egl-5 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the EGL-5 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_EGL-5_POL-2_L3_rep1|L3	OP54(official name : O...	ChIP-Seq
SRX188618	SRA058875	Snyder_EGL-5_POL-2_L3_replicate_2	Snyder_EGL-5_POL-2_L3_replicate_2	Snyder_EGL-5_POL-2_L3_rep2	Snyder_EGL-5_POL-2_L3_...	OP54(official name : OP54 genotype : unc-119(ed3) III; wgIs54 unc-119(+) egl-5::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The EGL-5::EGFP fusion protein is expressed in the correct egl-5 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the EGL-5 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_EGL-5_POL-2_L3_rep2|L3	OP54(official name : O...	ChIP-Seq
SRX188619	SRA058875	Snyder_EGL-5_Input_L3_replicate_1	Snyder_EGL-5_Input_L3_replicate_1	Snyder_EGL-5_Input_L3_rep1	Snyder_EGL-5_Input_L3_...	OP54(official name : OP54 genotype : unc-119(ed3) III; wgIs54 unc-119(+) egl-5::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The EGL-5::EGFP fusion protein is expressed in the correct egl-5 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the EGL-5 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_EGL-5_Input_L3_rep1|L3	OP54(official name : O...	ChIP-Seq
SRX188620	SRA058875	Snyder_EGL-5_Input_L3_replicate_2	Snyder_EGL-5_Input_L3_replicate_2	Snyder_EGL-5_Input_L3_rep2	Snyder_EGL-5_Input_L3_...	OP54(official name : OP54 genotype : unc-119(ed3) III; wgIs54 unc-119(+) egl-5::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The EGL-5::EGFP fusion protein is expressed in the correct egl-5 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the EGL-5 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_EGL-5_Input_L3_rep2|L3	OP54(official name : O...	ChIP-Seq
SRX1936233	SRA439731	H4K16ac_N2_L3_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H4K16ac_N2_L3_rep1;_Caenorhabditis_elegans;_ChI...	L3 worms	L3 worms	N2|L3 worms|L3	N2	ChIP-Seq
SRX1936234	SRA439731	H4K16ac_N2_L3_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H4K16ac_N2_L3_rep2;_Caenorhabditis_elegans;_ChI...	L3 worms	L3 worms	N2|L3 worms|L3	N2	ChIP-Seq
SRX1936235	SRA439731	H4K16ac_N2_L3_rep3;_Caenorhabditis_elegans;_ChIP-Seq	H4K16ac_N2_L3_rep3;_Caenorhabditis_elegans;_ChI...	L3 worms	L3 worms	N2|L3 worms|L3	N2	ChIP-Seq
SRX1936236	SRA439731	Input_N2_L3_rep1;_Caenorhabditis_elegans;_ChIP-Seq	Input_N2_L3_rep1;_Caenorhabditis_elegans;_ChIP-Seq	L3 worms	L3 worms	N2|L3 worms|L3	N2	ChIP-Seq
SRX1936237	SRA439731	Input_N2_L3_rep2;_Caenorhabditis_elegans;_ChIP-Seq	Input_N2_L3_rep2;_Caenorhabditis_elegans;_ChIP-Seq	L3 worms	L3 worms	N2|L3 worms|L3	N2	ChIP-Seq
SRX1936238	SRA439731	Input_N2_L3_rep3;_Caenorhabditis_elegans;_ChIP-Seq	Input_N2_L3_rep3;_Caenorhabditis_elegans;_ChIP-Seq	L3 worms	L3 worms	N2|L3 worms|L3	N2	ChIP-Seq
SRX1936239	SRA439731	H4K16ac_TY1072_L3_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H4K16ac_TY1072_L3_rep1;_Caenorhabditis_elegans;...	L3 worms	L3 worms	TY1072|L3 worms|L3	TY1072	ChIP-Seq
SRX1936240	SRA439731	H4K16ac_TY1072_L3_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H4K16ac_TY1072_L3_rep2;_Caenorhabditis_elegans;...	L3 worms	L3 worms	TY1072|L3 worms|L3	TY1072	ChIP-Seq
SRX1936241	SRA439731	H4K16ac_TY1072_L3_rep3;_Caenorhabditis_elegans;_ChIP-Seq	H4K16ac_TY1072_L3_rep3;_Caenorhabditis_elegans;...	L3 worms	L3 worms	TY1072|L3 worms|L3	TY1072	ChIP-Seq
SRX1936242	SRA439731	Input_TY1072_L3_rep1;_Caenorhabditis_elegans;_ChIP-Seq	Input_TY1072_L3_rep1;_Caenorhabditis_elegans;_C...	L3 worms	L3 worms	TY1072|L3 worms|L3	TY1072	ChIP-Seq
SRX1936243	SRA439731	Input_TY1072_L3_rep2;_Caenorhabditis_elegans;_ChIP-Seq	Input_TY1072_L3_rep2;_Caenorhabditis_elegans;_C...	L3 worms	L3 worms	TY1072|L3 worms|L3	TY1072	ChIP-Seq
SRX1936244	SRA439731	Input_TY1072_L3_rep3;_Caenorhabditis_elegans;_ChIP-Seq	Input_TY1072_L3_rep3;_Caenorhabditis_elegans;_C...	L3 worms	L3 worms	TY1072|L3 worms|L3	TY1072	ChIP-Seq
SRX1949396	SRA440532	LET-607_ChIP_in_staged_YA_rep_1;_Caenorhabditis_elegans;_ChIP-Seq	LET-607_ChIP_in_staged_YA_rep_1;_Caenorhabditis...	anti-GFP (gift from Kevin White)|staged young adult (YA) from YL529 (LET-607-GFP transgenic strain)	anti-GFP (gift from Ke...	YL529|staged young adult (YA) from YL529 (LET-607-GFP transgenic strain)|whole animal|YA	YL529	ChIP-Seq
SRX1949397	SRA440532	LET-607_ChIP_in_staged_YA_rep_2;_Caenorhabditis_elegans;_ChIP-Seq	LET-607_ChIP_in_staged_YA_rep_2;_Caenorhabditis...	anti-GFP (gift from Kevin White)|staged young adult (YA) from YL529 (LET-607-GFP transgenic strain)	anti-GFP (gift from Ke...	YL529|staged young adult (YA) from YL529 (LET-607-GFP transgenic strain)|whole animal|YA	YL529	ChIP-Seq
SRX1949398	SRA440532	Input_DNA_control_in_staged_YA;_Caenorhabditis_elegans;_ChIP-Seq	Input_DNA_control_in_staged_YA;_Caenorhabditis_...	none|staged young adult (YA) from YL529 (LET-607-GFP transgenic strain)	none	YL529|staged young adult (YA) from YL529 (LET-607-GFP transgenic strain)|whole animal|YA	YL529	ChIP-Seq
SRX1995023	SRA447732	input_of_H3K9me2_wt_C._elegans	input_of_H3K9me2_wt_C._elegans	NoAb	ND	N2|embryo|early embryo	N2	ChIP-Seq
SRX1995024	SRA447732	input_of_H3K9me2_wt_C._elegans	input_of_H3K9me2_wt_C._elegans	NoAb	ND	N2|embryo|early embryo	N2	ChIP-Seq
SRX1995035	SRA447732	ChIPseq_of_H3K9me2_wt_C._elegans	ChIPseq_of_H3K9me2_wt_C._elegans	NoAb	ND	N2|embryo|early embryo	N2	ChIP-Seq
SRX1995047	SRA447732	ChIPseq_of_H3K9me2_wt_C._elegans	ChIPseq_of_H3K9me2_wt_C._elegans	NoAb	ND	N2|embryo|early embryo	N2	ChIP-Seq
SRX1995058	SRA447732	input_of_H3K9me3_wt_C._elegans	input_of_H3K9me3_wt_C._elegans	NoAb	ND	N2|embryo|early embryo	N2	ChIP-Seq
SRX1995067	SRA447732	input_of_H3K9me3_wt_C._elegans	input_of_H3K9me3_wt_C._elegans	NoAb	ND	N2|embryo|early embryo	N2	ChIP-Seq
SRX1995068	SRA447732	ChIPseq_of_H3K9me3_wt_C._elegans	ChIPseq_of_H3K9me3_wt_C._elegans	NoAb	ND	N2|embryo|early embryo	N2	ChIP-Seq
SRX1995069	SRA447732	ChIPseq_of_H3K9me3_wt_C._elegans	ChIPseq_of_H3K9me3_wt_C._elegans	NoAb	ND	N2|embryo|early embryo	N2	ChIP-Seq
SRX2011718	SRA451100	KW2309-L4440-1input;_Caenorhabditis_elegans;_ChIP-Seq	KW2309-L4440-1input;_Caenorhabditis_elegans;_Ch...	none|mixed stage early embryos	none	KW2309|mixed stage early embryos	KW2309	ChIP-Seq
SRX2011719	SRA451100	KW2309-L4440-2input;_Caenorhabditis_elegans;_ChIP-Seq	KW2309-L4440-2input;_Caenorhabditis_elegans;_Ch...	none|mixed stage early embryos	none	KW2309|mixed stage early embryos	KW2309	ChIP-Seq
SRX2011720	SRA451100	KW2309-Sig-7RNAi-1input;_Caenorhabditis_elegans;_ChIP-Seq	KW2309-Sig-7RNAi-1input;_Caenorhabditis_elegans...	none|mixed stage early embryos	none	KW2309|mixed stage early embryos	KW2309	ChIP-Seq
SRX2011721	SRA451100	KW2309-Sig-7RNAi-2input;_Caenorhabditis_elegans;_ChIP-Seq	KW2309-Sig-7RNAi-2input;_Caenorhabditis_elegans...	none|mixed stage early embryos	none	KW2309|mixed stage early embryos	KW2309	ChIP-Seq
SRX2011722	SRA451100	KW2309-L4440-1Ama-1-CHIP;_Caenorhabditis_elegans;_ChIP-Seq	KW2309-L4440-1Ama-1-CHIP;_Caenorhabditis_elegan...	anti-AMA-1 (Novus Biological, Cat# 38520002)|mixed stage early embryos	anti-AMA-1 (Novus Biol...	KW2309|mixed stage early embryos	KW2309	ChIP-Seq
SRX2011723	SRA451100	KW2309-L4440-1Ama-2-CHIP;_Caenorhabditis_elegans;_ChIP-Seq	KW2309-L4440-1Ama-2-CHIP;_Caenorhabditis_elegan...	anti-AMA-1 (Novus Biological, Cat# 38520002)|mixed stage early embryos	anti-AMA-1 (Novus Biol...	KW2309|mixed stage early embryos	KW2309	ChIP-Seq
SRX2011724	SRA451100	KW2309-Sig-7RNAi-1Ama-1-CHIP;_Caenorhabditis_elegans;_ChIP-Seq	KW2309-Sig-7RNAi-1Ama-1-CHIP;_Caenorhabditis_el...	anti-AMA-1 (Novus Biological, Cat# 38520002)|mixed stage early embryos	anti-AMA-1 (Novus Biol...	KW2309|mixed stage early embryos	KW2309	ChIP-Seq
SRX2011725	SRA451100	KW2309-Sig-7RNAi-1Ama-2-CHIP;_Caenorhabditis_elegans;_ChIP-Seq	KW2309-Sig-7RNAi-1Ama-2-CHIP;_Caenorhabditis_el...	anti-AMA-1 (Novus Biological, Cat# 38520002)|mixed stage early embryos	anti-AMA-1 (Novus Biol...	KW2309|mixed stage early embryos	KW2309	ChIP-Seq
SRX2035133	SRA453366	WT_AA_H3K4me3_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	WT_AA_H3K4me3_Rep1;_Caenorhabditis_elegans;_ChI...	H3K4me3 (Abcam, #ab8580)|WT_AA_H3K4me3	H3K4me3 (Abcam, #ab8580)	WT_AA_H3K4me3|whole body|L3-L4 mix	WT_AA_H3K4me3	ChIP-Seq
SRX2035134	SRA453366	WT_AA_H3K4me3_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	WT_AA_H3K4me3_Rep2;_Caenorhabditis_elegans;_ChI...	H3K4me3 (Abcam, #ab8580)|WT_AA_H3K4me3	H3K4me3 (Abcam, #ab8580)	WT_AA_H3K4me3|whole body|L3-L4 mix	WT_AA_H3K4me3	ChIP-Seq
SRX2035135	SRA453366	WT_AA_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	WT_AA_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	none|WT_AA_Input	none	WT_AA_Input|whole body|L3-L4 mix	WT_AA_Input	ChIP-Seq
SRX2035136	SRA453366	WT_NT_H3K4me3_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	WT_NT_H3K4me3_Rep1;_Caenorhabditis_elegans;_ChI...	H3K4me3 (Abcam, #ab8580)|WT_NT_H3K4me3	H3K4me3 (Abcam, #ab8580)	WT_NT_H3K4me3|whole body|L3-L4 mix	WT_NT_H3K4me3	ChIP-Seq
SRX2035137	SRA453366	WT_NT_H3K4me3_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	WT_NT_H3K4me3_Rep2;_Caenorhabditis_elegans;_ChI...	H3K4me3 (Abcam, #ab8580)|WT_NT_H3K4me3	H3K4me3 (Abcam, #ab8580)	WT_NT_H3K4me3|whole body|L3-L4 mix	WT_NT_H3K4me3	ChIP-Seq
SRX2035138	SRA453366	WT_NT_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	WT_NT_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	none|WT_NT_Input	none	WT_NT_Input|whole body|L3-L4 mix	WT_NT_Input	ChIP-Seq
SRX208755	SRA062428	BC085_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	BC085_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	SDQ2357_AMA1 Novus Biologicals, catalog# 38520002, lot# G3048-029, Animal SDQ2357|Mixed-stage embryos	SDQ2357_AMA1 Novus Bio...	N2|Mixed-stage embryos	N2	ChIP-Seq
SRX208756	SRA062428	BC002_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	BC002_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	SDQ2357_AMA1 Novus Biologicals, catalog# 38520002, lot# G3048-029, Animal SDQ2357|Mixed-stage embryos	SDQ2357_AMA1 Novus Bio...	N2|Mixed-stage embryos	N2	ChIP-Seq
SRX208763	SRA062428	BC166_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	BC166_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	SDQ4154_IMB1 not commercial|Mixed-stage embryos	SDQ4154_IMB1 not comme...	N2|Mixed-stage embryos	N2	ChIP-Seq
SRX208764	SRA062428	KI026_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	KI026_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	SDQ4154_IMB1 not commercial|Mixed-stage embryos	SDQ4154_IMB1 not comme...	N2|Mixed-stage embryos	N2	ChIP-Seq
SRX208765	SRA062428	BC071_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	BC071_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	na (input)|Mixed-stage embryos	na (input)	N2|Mixed-stage embryos	N2	ChIP-Seq
SRX208766	SRA062428	BC089_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	BC089_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	na (input)|Mixed-stage embryos	na (input)	N2|Mixed-stage embryos	N2	ChIP-Seq
SRX208767	SRA062428	KI024_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	KI024_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	SDQ3897_NPP13 Novus Biologicals, catalog# 48580002, lot# G3048-202, Animal SDQ3897|Mixed-stage embryos	SDQ3897_NPP13 Novus Bi...	N2|Mixed-stage embryos	N2	ChIP-Seq
SRX208768	SRA062428	BC075_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	BC075_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	SY1539_NPP3 not commercial|Mixed-stage embryos	SY1539_NPP3 not commer...	N2|Mixed-stage embryos	N2	ChIP-Seq
SRX208769	SRA062428	BC076_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	BC076_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	SY1540_NPP3 not commercial|Mixed-stage embryos	SY1540_NPP3 not commer...	N2|Mixed-stage embryos	N2	ChIP-Seq
SRX208770	SRA062428	BC164_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	BC164_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	SY1539_NPP3 not commercial|Mixed-stage embryos	SY1539_NPP3 not commer...	N2|Mixed-stage embryos	N2	ChIP-Seq
SRX208771	SRA062428	BC177_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	BC177_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	SDQ4663_RPC1 Novus Biologicals, catalog# 53330002, lot# G3048-240A02, Animal SDQ4663|Mixed-stage embryos	SDQ4663_RPC1 Novus Bio...	N2|Mixed-stage embryos	N2	ChIP-Seq
SRX208772	SRA062428	BC178_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	BC178_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	SDQ4663_RPC1 Novus Biologicals, catalog# 53330002, lot# G3048-240A02, Animal SDQ4663|Mixed-stage embryos	SDQ4663_RPC1 Novus Bio...	N2|Mixed-stage embryos	N2	ChIP-Seq
SRX208773	SRA062428	BC179_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	BC179_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	SDQ4663_RPC1 Novus Biologicals, catalog# 53330002, lot# G3048-240A02, Animal SDQ4663|Mixed-stage embryos	SDQ4663_RPC1 Novus Bio...	N2|Mixed-stage embryos	N2	ChIP-Seq
SRX208774	SRA062428	BC180_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	BC180_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	SDQ4663_RPC1 Novus Biologicals, catalog# 53330002, lot# G3048-240A02, Animal SDQ4663|Mixed-stage embryos	SDQ4663_RPC1 Novus Bio...	N2|Mixed-stage embryos	N2	ChIP-Seq
SRX208775	SRA062428	BC057_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	BC057_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	SDQ0839_TBP1 Novus Biologicals, catalog# 29610002, lot# G3048-022, Animal SDQ0839|Mixed-stage embryos	SDQ0839_TBP1 Novus Bio...	N2|Mixed-stage embryos	N2	ChIP-Seq
SRX208776	SRA062428	BC257_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	BC257_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	SDQ0839_TBP1 Novus Biologicals, catalog# 29610002, lot# G3048-022, Animal SDQ0839|Mixed-stage embryos	SDQ0839_TBP1 Novus Bio...	N2|Mixed-stage embryos	N2	ChIP-Seq
SRX208777	SRA062428	BC258_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	BC258_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	SDQ0839_TBP1 Novus Biologicals, catalog# 29610002, lot# G3048-022, Animal SDQ0839|Mixed-stage embryos	SDQ0839_TBP1 Novus Bio...	N2|Mixed-stage embryos	N2	ChIP-Seq
SRX208778	SRA062428	FW002_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	FW002_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	SDQ0839_TBP1 Novus Biologicals, catalog# 29610002, lot# G3048-022, Animal SDQ0839|Mixed-stage embryos	SDQ0839_TBP1 Novus Bio...	N2|Mixed-stage embryos	N2	ChIP-Seq
SRX212235	SRA063049	DPY-27_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	DPY-27_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	DPY-27 polyclonal rabbit antibody (#699) was generated in: CHUANG, P. T., D. G. ALBERTSON and B. J. MEYER, 1994 DPY-27:a chromosome condensation protein homolog that regulates C. elegans dosage compensation through association with the X chromosome. Cell 79: 459-474.|Wild-type embryos	DPY-27 polyclonal rabb...	Wild-type embryos|Embryo	Wild-type embryos	ChIP-Seq
SRX212236	SRA063049	IgG;_Caenorhabditis_elegans;_ChIP-Seq	IgG;_Caenorhabditis_elegans;_ChIP-Seq	Rabbit IgG from Santa Cruz Biotechnology (sc-2027, Lot # A2609)|Wild-type embryos	Rabbit IgG from Santa ...	Wild-type embryos|Embryo	Wild-type embryos	ChIP-Seq
SRX2144165	SRA464362	H3K9me3_ChIP-seq_WT_oma-1_RNAi;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_ChIP-seq_WT_oma-1_RNAi;_Caenorhabditis_...	Anti-Histone H3 (tri methyl K9)|DNA extracted from fragmented chromatin|Young adult whole animal	Anti-Histone H3 (tri m...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX2144166	SRA464362	H3K9me3_ChIP-seq_set-32_oma-1_RNAi;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_ChIP-seq_set-32_oma-1_RNAi;_Caenorhabdi...	Anti-Histone H3 (tri methyl K9)|DNA extracted from fragmented chromatin|Young adult whole animal	Anti-Histone H3 (tri m...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX2144167	SRA464362	H3K9me3_ChIP-seq_met-2set-25_oma-1_RNAi;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_ChIP-seq_met-2set-25_oma-1_RNAi;_Caenor...	Anti-Histone H3 (tri methyl K9)|DNA extracted from fragmented chromatin|Young adult whole animal	Anti-Histone H3 (tri m...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX2144168	SRA464362	H3K9me3_ChIP-seq_met-2set-25set-32_oma-1_RNAi;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_ChIP-seq_met-2set-25set-32_oma-1_RNAi;_...	Anti-Histone H3 (tri methyl K9)|DNA extracted from fragmented chromatin|Young adult whole animal	Anti-Histone H3 (tri m...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX2144169	SRA464362	H3K9me3_ChIP-seq_hrde-1_oma-1_RNAi;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_ChIP-seq_hrde-1_oma-1_RNAi;_Caenorhabdi...	Anti-Histone H3 (tri methyl K9)|DNA extracted from fragmented chromatin|Young adult whole animal	Anti-Histone H3 (tri m...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX2144170	SRA464362	Pol_II_ChIP-seq_WT_oma-1_RNAi;_Caenorhabditis_elegans;_ChIP-Seq	Pol_II_ChIP-seq_WT_oma-1_RNAi;_Caenorhabditis_e...	Anti-RNA polymerase II CTD repeat YSPTSPS (phospho S2)|DNA extracted from fragmented chromatin|Young adult whole animal	Anti-RNA polymerase II...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX2144171	SRA464362	Pol_II_ChIP-seq_set-32_oma-1_RNAi;_Caenorhabditis_elegans;_ChIP-Seq	Pol_II_ChIP-seq_set-32_oma-1_RNAi;_Caenorhabdit...	Anti-RNA polymerase II CTD repeat YSPTSPS (phospho S2)|DNA extracted from fragmented chromatin|Young adult whole animal	Anti-RNA polymerase II...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX2144172	SRA464362	Pol_II_ChIP-seq_met-2set-25_oma-1_RNAi;_Caenorhabditis_elegans;_ChIP-Seq	Pol_II_ChIP-seq_met-2set-25_oma-1_RNAi;_Caenorh...	Anti-RNA polymerase II CTD repeat YSPTSPS (phospho S2)|DNA extracted from fragmented chromatin|Young adult whole animal	Anti-RNA polymerase II...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX2144173	SRA464362	Pol_II_ChIP-seq_met-2set-25set-32_oma-1_RNAi;_Caenorhabditis_elegans;_ChIP-Seq	Pol_II_ChIP-seq_met-2set-25set-32_oma-1_RNAi;_C...	Anti-RNA polymerase II CTD repeat YSPTSPS (phospho S2)|DNA extracted from fragmented chromatin|Young adult whole animal	Anti-RNA polymerase II...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX2144174	SRA464362	Pol_II_ChIP-seq_hrde-1_oma-1_RNAi;_Caenorhabditis_elegans;_ChIP-Seq	Pol_II_ChIP-seq_hrde-1_oma-1_RNAi;_Caenorhabdit...	Anti-RNA polymerase II CTD repeat YSPTSPS (phospho S2)|DNA extracted from fragmented chromatin|Young adult whole animal	Anti-RNA polymerase II...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX2144175	SRA464362	H3K9me3_ChIP-seq_WT_GFP_RNAi;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_ChIP-seq_WT_GFP_RNAi;_Caenorhabditis_el...	Anti-Histone H3 (tri methyl K9)|DNA extracted from immunoprecipitated chromatin|Young adult whole animal	Anti-Histone H3 (tri m...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX2144176	SRA464362	H3K9me3_ChIP-seq_set-32_GFP_RNAi;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_ChIP-seq_set-32_GFP_RNAi;_Caenorhabditi...	Anti-Histone H3 (tri methyl K9)|DNA extracted from immunoprecipitated chromatin|Young adult whole animal	Anti-Histone H3 (tri m...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX2144177	SRA464362	H3K9me3_ChIP-seq_met-2set-25_GFP_RNAi;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_ChIP-seq_met-2set-25_GFP_RNAi;_Caenorha...	Anti-Histone H3 (tri methyl K9)|DNA extracted from immunoprecipitated chromatin|Young adult whole animal	Anti-Histone H3 (tri m...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX2144178	SRA464362	H3K9me3_ChIP-seq_met-2set-25set-32_GFP_RNAi;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_ChIP-seq_met-2set-25set-32_GFP_RNAi;_Ca...	Anti-Histone H3 (tri methyl K9)|DNA extracted from immunoprecipitated chromatin|Young adult whole animal	Anti-Histone H3 (tri m...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX2144179	SRA464362	H3K9me3_ChIP-seq_hrde-1_GFP_RNAi;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_ChIP-seq_hrde-1_GFP_RNAi;_Caenorhabditi...	Anti-Histone H3 (tri methyl K9)|DNA extracted from immunoprecipitated chromatin|Young adult whole animal	Anti-Histone H3 (tri m...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX2144180	SRA464362	Pol_II_ChIP-seq_WT_GFP_RNAi;_Caenorhabditis_elegans;_ChIP-Seq	Pol_II_ChIP-seq_WT_GFP_RNAi;_Caenorhabditis_ele...	Anti-RNA polymerase II CTD repeat YSPTSPS (phospho S2)|DNA extracted from immunoprecipitated chromatin|Young adult whole animal	Anti-RNA polymerase II...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX2144181	SRA464362	Pol_II_ChIP-seq_set-32_GFP_RNAi;_Caenorhabditis_elegans;_ChIP-Seq	Pol_II_ChIP-seq_set-32_GFP_RNAi;_Caenorhabditis...	Anti-RNA polymerase II CTD repeat YSPTSPS (phospho S2)|DNA extracted from immunoprecipitated chromatin|Young adult whole animal	Anti-RNA polymerase II...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX2144182	SRA464362	Pol_II_ChIP-seq_met-2set-25_GFP_RNAi;_Caenorhabditis_elegans;_ChIP-Seq	Pol_II_ChIP-seq_met-2set-25_GFP_RNAi;_Caenorhab...	Anti-RNA polymerase II CTD repeat YSPTSPS (phospho S2)|DNA extracted from immunoprecipitated chromatin|Young adult whole animal	Anti-RNA polymerase II...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX2144183	SRA464362	Pol_II_ChIP-seq_met-2set-25set-32_GFP_RNAi;_Caenorhabditis_elegans;_ChIP-Seq	Pol_II_ChIP-seq_met-2set-25set-32_GFP_RNAi;_Cae...	Anti-RNA polymerase II CTD repeat YSPTSPS (phospho S2)|DNA extracted from immunoprecipitated chromatin|Young adult whole animal	Anti-RNA polymerase II...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX2144184	SRA464362	Pol_II_ChIP-seq_hrde-1_GFP_RNAi;_Caenorhabditis_elegans;_ChIP-Seq	Pol_II_ChIP-seq_hrde-1_GFP_RNAi;_Caenorhabditis...	Anti-RNA polymerase II CTD repeat YSPTSPS (phospho S2)|DNA extracted from immunoprecipitated chromatin|Young adult whole animal	Anti-RNA polymerase II...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX2144185	SRA464362	ChIP_Input_WT;_Caenorhabditis_elegans;_ChIP-Seq	ChIP_Input_WT;_Caenorhabditis_elegans;_ChIP-Seq	ChIP Input|DNA extracted from immunoprecipitated chromatin|Young adult whole animal	ChIP Input	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX2144186	SRA464362	ChIP_Input_set-32;_Caenorhabditis_elegans;_ChIP-Seq	ChIP_Input_set-32;_Caenorhabditis_elegans;_ChIP...	ChIP Input|DNA extracted from immunoprecipitated chromatin|Young adult whole animal	ChIP Input	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX2144187	SRA464362	ChIP_Input_met-2set-25;_Caenorhabditis_elegans;_ChIP-Seq	ChIP_Input_met-2set-25;_Caenorhabditis_elegans;...	ChIP Input|DNA extracted from immunoprecipitated chromatin|Young adult whole animal	ChIP Input	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX2144188	SRA464362	ChIP_Input_met-2set-25set-32;_Caenorhabditis_elegans;_ChIP-Seq	ChIP_Input_met-2set-25set-32;_Caenorhabditis_el...	ChIP Input|DNA extracted from immunoprecipitated chromatin|Young adult whole animal	ChIP Input	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX2144189	SRA464362	ChIP_Input_hrde-1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP_Input_hrde-1;_Caenorhabditis_elegans;_ChIP...	ChIP Input|DNA extracted from immunoprecipitated chromatin|Young adult whole animal	ChIP Input	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX2144190	SRA464362	H3K9me3_ChIP-seq_WT_OP50;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_ChIP-seq_WT_OP50;_Caenorhabditis_elegan...	Anti-Histone H3 (tri methyl K9)|DNA extracted from immunoprecipitated chromatin|Young adult whole animal	Anti-Histone H3 (tri m...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX2144191	SRA464362	H3K9me3_ChIP-seq_set-32_OP50;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_ChIP-seq_set-32_OP50;_Caenorhabditis_el...	Anti-Histone H3 (tri methyl K9)|DNA extracted from immunoprecipitated chromatin|Young adult whole animal	Anti-Histone H3 (tri m...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX2144192	SRA464362	H3K9me3_ChIP-seq_met-2set-25_OP50;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_ChIP-seq_met-2set-25_OP50;_Caenorhabdit...	Anti-Histone H3 (tri methyl K9)|DNA extracted from immunoprecipitated chromatin|Young adult whole animal	Anti-Histone H3 (tri m...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX2144193	SRA464362	H3K9me3_ChIP-seq_met-2set-25set-32_OP50;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_ChIP-seq_met-2set-25set-32_OP50;_Caenor...	Anti-Histone H3 (tri methyl K9)|DNA extracted from immunoprecipitated chromatin|Young adult whole animal	Anti-Histone H3 (tri m...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX2144194	SRA464362	H3K9me3_ChIP-seq_hrde-1_OP50;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_ChIP-seq_hrde-1_OP50;_Caenorhabditis_el...	Anti-Histone H3 (tri methyl K9)|DNA extracted from immunoprecipitated chromatin|Young adult whole animal	Anti-Histone H3 (tri m...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX2163949	SRA471419	H3K4me3_N2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_N2_ChIPSeq;_Caenorhabditis_elegans;_ChI...	H3K4me3 (Abcam ab8580)|whole organism	H3K4me3 (Abcam ab8580)	wild type Bristol N2|whole organism|L4	wild type Bristol N2	ChIP-Seq
SRX2163950	SRA471419	H3K4me3_rbr-2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_rbr-2_ChIPSeq;_Caenorhabditis_elegans;_...	H3K4me3 (Abcam ab8580)|whole organism	H3K4me3 (Abcam ab8580)	rbr-2(tm3141)|whole organism|L4	rbr-2(tm3141)	ChIP-Seq
SRX2163951	SRA471419	IgG_N2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	IgG_N2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	IgG (Sigma-Aldrich I8140)|whole organism	IgG (Sigma-Aldrich I8140)	wild type Bristol N2|whole organism|L4	wild type Bristol N2	ChIP-Seq
SRX2163952	SRA471419	IgG_rbr-2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	IgG_rbr-2_ChIPSeq;_Caenorhabditis_elegans;_ChIP...	IgG (Sigma-Aldrich I8140)|whole organism	IgG (Sigma-Aldrich I8140)	rbr-2(tm3141)|whole organism|L4	rbr-2(tm3141)	ChIP-Seq
SRX216728	SRA062121	daf-2_DAF-16::GFP_ChIP-Seq_IN	daf-2_DAF-16::GFP_ChIP-Seq_IN	NoAb	ND	GR1895|daf-2_DAF-16::GFP_IN	GR1895	ChIP-Seq
SRX216729	SRA062121	daf-2_SWSN-1::GFP_ChIP-Seq_IN	daf-2_SWSN-1::GFP_ChIP-Seq_IN	NoAb	ND	GR1900|daf-2_SWSN-1::GFP_IN	GR1900	ChIP-Seq
SRX216753	SRA062121	daf-2_DAF-16::GFP_ChIP-Seq_IP	daf-2_DAF-16::GFP_ChIP-Seq_IP	NoAb	ND	GR1895|daf-2_DAF-16::GFP_IP	GR1895	ChIP-Seq
SRX216754	SRA062121	daf-2_swsn-1_DAF-16::GFP_ChIP-Seq_IN	daf-2_swsn-1_DAF-16::GFP_ChIP-Seq_IN	NoAb	ND	GR1907|daf-2_swsn-1_DAF-16::GFP_IN	GR1907	ChIP-Seq
SRX216755	SRA062121	daf-2_swsn-1_DAF-16::GFP_ChIP-Seq_IP	daf-2_swsn-1_DAF-16::GFP_ChIP-Seq_IP	NoAb	ND	GR1907|daf-2_swsn-1_DAF-16::GFP_IP	GR1907	ChIP-Seq
SRX216757	SRA062121	daf-2_SWSN-1::GFP_ChIP-Seq_IP	daf-2_SWSN-1::GFP_ChIP-Seq_IP	NoAb	ND	GR1900|daf-2_SWSN-1::GFP_IP	GR1900	ChIP-Seq
SRX216758	SRA062121	daf-2_daf-16_SWSN-1::GFP_ChIP_IN	daf-2_daf-16_SWSN-1::GFP_ChIP_IN	NoAb	ND	GR1909|daf-2_daf-16_SWSN-1::GFP_IN	GR1909	ChIP-Seq
SRX216759	SRA062121	daf-2_daf-16_SWSN-1::GFP_ChIP_IP	daf-2_daf-16_SWSN-1::GFP_ChIP_IP	NoAb	ND	GR1909|daf-2_daf-16_SWSN-1::GFP_IP	GR1909	ChIP-Seq
SRX216761	SRA062121	daf-2_SWSN-4::GFP_ChIP_IN	daf-2_SWSN-4::GFP_ChIP_IN	NoAb	ND	GR1908|daf-2_SWSN-4::GFP_IN	GR1908	ChIP-Seq
SRX216762	SRA062121	daf-2_SWSN-4::GFP_ChIP_IP	daf-2_SWSN-4::GFP_ChIP_IP	NoAb	ND	GR1908|daf-2_SWSN-4::GFP_IP	GR1908	ChIP-Seq
SRX216763	SRA062121	daf-2_daf-16_SWSN-4::GFP_ChIP_IN	daf-2_daf-16_SWSN-4::GFP_ChIP_IN	NoAb	ND	GR1910|daf-2_daf-16_SWSN-4::GFP_IN	GR1910	ChIP-Seq
SRX216764	SRA062121	daf-2_daf-16_SWSN-4::GFP_ChIP_IP	daf-2_daf-16_SWSN-4::GFP_ChIP_IP	NoAb	ND	GR1910|daf-2_daf-16_SWSN-4::GFP_IP	GR1910	ChIP-Seq
SRX2170085	SRA472615	whole_L4_stage_wildtype_C._elegans_gDNA;_Caenorhabditis_elegans;_Bisulfite-Seq	whole_L4_stage_wildtype_C._elegans_gDNA;_Caenor...	Bisulfite-seq	Bisulfite-seq	N2|whole L4 stage wildtype C. elegans gDNA|L4	N2	Bisulfite-Seq
SRX2202775	SRA481141	H3K9me2_YA_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me2_YA_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me2 (WAKO, 302-32369, lot number 11005)|young adults, H3K9me2 ChIP	H3K9me2 (WAKO, 302-323...	young adults, H3K9me2 ChIP|whole body	young adults, H3K9me2 ...	ChIP-Seq
SRX2202776	SRA481141	H3K9me2_YA_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me2_YA_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me2 (WAKO, 302-32369, lot number 11005)|young adults, H3K9me2 ChIP	H3K9me2 (WAKO, 302-323...	young adults, H3K9me2 ChIP|whole body	young adults, H3K9me2 ...	ChIP-Seq
SRX2202779	SRA481141	HPL-2_YA_rep1;_Caenorhabditis_elegans;_ChIP-Seq	HPL-2_YA_rep1;_Caenorhabditis_elegans;_ChIP-Seq	HPL-2 (Strategic Diagnostics Inc., Q2324)|young adults, HPL-2 ChIP	HPL-2 (Strategic Diagn...	young adults, HPL-2 ChIP|whole body	young adults, HPL-2 ChIP	ChIP-Seq
SRX2202780	SRA481141	HPL-2_YA_rep2;_Caenorhabditis_elegans;_ChIP-Seq	HPL-2_YA_rep2;_Caenorhabditis_elegans;_ChIP-Seq	HPL-2 (Strategic Diagnostics Inc., Q2324)|young adults, HPL-2 ChIP	HPL-2 (Strategic Diagn...	young adults, HPL-2 ChIP|whole body	young adults, HPL-2 ChIP	ChIP-Seq
SRX2202781	SRA481141	LET-418_YA_rep1;_Caenorhabditis_elegans;_ChIP-Seq	LET-418_YA_rep1;_Caenorhabditis_elegans;_ChIP-Seq	LET-418 (Strategic Diagnostics Inc., Q3861)|young adults, LET-418 ChIP	LET-418 (Strategic Dia...	young adults, LET-418 ChIP|whole body	young adults, LET-418 ...	ChIP-Seq
SRX2202782	SRA481141	LET-418_YA_rep2;_Caenorhabditis_elegans;_ChIP-Seq	LET-418_YA_rep2;_Caenorhabditis_elegans;_ChIP-Seq	LET-418 (Strategic Diagnostics Inc., Q3861)|young adults, LET-418 ChIP	LET-418 (Strategic Dia...	young adults, LET-418 ChIP|whole body	young adults, LET-418 ...	ChIP-Seq
SRX2202783	SRA481141	LIN-13_YA_rep1;_Caenorhabditis_elegans;_ChIP-Seq	LIN-13_YA_rep1;_Caenorhabditis_elegans;_ChIP-Seq	LIN-13 (Strategic Diagnostics Inc., Q0838)|young adults, LIN-13 ChIP	LIN-13 (Strategic Diag...	young adults, LIN-13 ChIP|whole body	young adults, LIN-13 ChIP	ChIP-Seq
SRX2202784	SRA481141	LIN-13_YA_rep2;_Caenorhabditis_elegans;_ChIP-Seq	LIN-13_YA_rep2;_Caenorhabditis_elegans;_ChIP-Seq	LIN-13 (Strategic Diagnostics Inc., Q0838)|young adults, LIN-13 ChIP	LIN-13 (Strategic Diag...	young adults, LIN-13 ChIP|whole body	young adults, LIN-13 ChIP	ChIP-Seq
SRX2202785	SRA481141	LIN-61_YA_rep1;_Caenorhabditis_elegans;_ChIP-Seq	LIN-61_YA_rep1;_Caenorhabditis_elegans;_ChIP-Seq	LIN-61 (Strategic Diagnostics Inc., Q3520)|young adults, LIN-61 ChIP	LIN-61 (Strategic Diag...	young adults, LIN-61 ChIP|whole body	young adults, LIN-61 ChIP	ChIP-Seq
SRX2202786	SRA481141	LIN-61_YA_rep2;_Caenorhabditis_elegans;_ChIP-Seq	LIN-61_YA_rep2;_Caenorhabditis_elegans;_ChIP-Seq	LIN-61 (Strategic Diagnostics Inc., Q3520)|young adults, LIN-61 ChIP	LIN-61 (Strategic Diag...	young adults, LIN-61 ChIP|whole body	young adults, LIN-61 ChIP	ChIP-Seq
SRX2202787	SRA481141	MET-2_YA_rep1;_Caenorhabditis_elegans;_ChIP-Seq	MET-2_YA_rep1;_Caenorhabditis_elegans;_ChIP-Seq	MET-2 (Strategic Diagnostics Inc., Q2943)|young adults, MET-2 ChIP	MET-2 (Strategic Diagn...	young adults, MET-2 ChIP|whole body	young adults, MET-2 ChIP	ChIP-Seq
SRX2202788	SRA481141	MET-2_YA_rep2;_Caenorhabditis_elegans;_ChIP-Seq	MET-2_YA_rep2;_Caenorhabditis_elegans;_ChIP-Seq	MET-2 (Strategic Diagnostics Inc., Q2943)|young adults, MET-2 ChIP	MET-2 (Strategic Diagn...	young adults, MET-2 ChIP|whole body	young adults, MET-2 ChIP	ChIP-Seq
SRX2202789	SRA481141	Summed_input_EGS;_Caenorhabditis_elegans;_ChIP-Seq	Summed_input_EGS;_Caenorhabditis_elegans;_ChIP-Seq	none|young adults, input EGS	none	young adults, input EGS|whole body	young adults, input EGS	ChIP-Seq
SRX2202790	SRA481141	Summed_input_FRM;_Caenorhabditis_elegans;_ChIP-Seq	Summed_input_FRM;_Caenorhabditis_elegans;_ChIP-Seq	none|young adults, input FRM	none	young adults, input FRM|whole body	young adults, input FRM	ChIP-Seq
SRX222632	SRA066058	Snyder_AHA-1_Input_L4_rep1	Snyder_AHA-1_Input_L4_rep1	Snyder_AHA-1_Input_L4_rep1	Snyder_AHA-1_Input_L4_...	OP124(official name : OP124 genotype : unc-119(ed3); wgIs124(aha-1::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The AHA-1::EGFP fusion protein is expressed in the correct aha-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the AHA-1 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_AHA-1_Input_L4_rep1|L4	OP124(official name : ...	ChIP-Seq
SRX222633	SRA066058	Snyder_AHA-1_Input_L4_rep2	Snyder_AHA-1_Input_L4_rep2	Snyder_AHA-1_Input_L4_rep2	Snyder_AHA-1_Input_L4_...	OP124(official name : OP124 genotype : unc-119(ed3); wgIs124(aha-1::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The AHA-1::EGFP fusion protein is expressed in the correct aha-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the AHA-1 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_AHA-1_Input_L4_rep2|L4	OP124(official name : ...	ChIP-Seq
SRX222634	SRA066058	Snyder_AHA-1_GFP_L4_rep1	Snyder_AHA-1_GFP_L4_rep1	Snyder_AHA-1_GFP_L4_rep1	Snyder_AHA-1_GFP_L4_rep1	OP124(official name : OP124 genotype : unc-119(ed3); wgIs124(aha-1::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The AHA-1::EGFP fusion protein is expressed in the correct aha-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the AHA-1 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_AHA-1_GFP_L4_rep1|L4	OP124(official name : ...	ChIP-Seq
SRX222635	SRA066058	Snyder_AHA-1_GFP_L4_rep2	Snyder_AHA-1_GFP_L4_rep2	Snyder_AHA-1_GFP_L4_rep2	Snyder_AHA-1_GFP_L4_rep2	OP124(official name : OP124 genotype : unc-119(ed3); wgIs124(aha-1::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The AHA-1::EGFP fusion protein is expressed in the correct aha-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the AHA-1 transcription factor. made_by : R. Waterston and S. Kim )|Snyder_AHA-1_GFP_L4_rep2|L4	OP124(official name : ...	ChIP-Seq
SRX222636	SRA066059	Snyder_C16A3.4_Input_L1_rep1_GTAT	Snyder_C16A3.4_Input_L1_rep1_GTAT	Snyder_C16A3.4_Input_L1_rep1_GTAT	Snyder_C16A3.4_Input_L...	OP345(official name : OP345 genotype : unc119(ed3); wgIs345(C16A3.4::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The C16A3.4::EGFP fusion protein has broad expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the C16A3.4 transcription factor. made_by : Bob Waterston's lab from UW )|Snyder_C16A3.4_Input_L1_rep1_GTAT|fed L1	OP345(official name : ...	ChIP-Seq
SRX222637	SRA066059	Snyder_C16A3.4_Input_L1_rep2_CATT	Snyder_C16A3.4_Input_L1_rep2_CATT	Snyder_C16A3.4_Input_L1_rep2_CATT	Snyder_C16A3.4_Input_L...	OP345(official name : OP345 genotype : unc119(ed3); wgIs345(C16A3.4::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The C16A3.4::EGFP fusion protein has broad expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the C16A3.4 transcription factor. made_by : Bob Waterston's lab from UW )|Snyder_C16A3.4_Input_L1_rep2_CATT|fed L1	OP345(official name : ...	ChIP-Seq
SRX222638	SRA066059	Snyder_C16A3.4_GFP_L1_rep1_GTAT	Snyder_C16A3.4_GFP_L1_rep1_GTAT	Snyder_C16A3.4_GFP_L1_rep1_GTAT	Snyder_C16A3.4_GFP_L1_...	OP345(official name : OP345 genotype : unc119(ed3); wgIs345(C16A3.4::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The C16A3.4::EGFP fusion protein has broad expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the C16A3.4 transcription factor. made_by : Bob Waterston's lab from UW )|Snyder_C16A3.4_GFP_L1_rep1_GTAT|fed L1	OP345(official name : ...	ChIP-Seq
SRX222639	SRA066059	Snyder_C16A3.4_GFP_L1_rep2_CATT	Snyder_C16A3.4_GFP_L1_rep2_CATT	Snyder_C16A3.4_GFP_L1_rep2_CATT	Snyder_C16A3.4_GFP_L1_...	OP345(official name : OP345 genotype : unc119(ed3); wgIs345(C16A3.4::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The C16A3.4::EGFP fusion protein has broad expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the C16A3.4 transcription factor. made_by : Bob Waterston's lab from UW )|Snyder_C16A3.4_GFP_L1_rep2_CATT|fed L1	OP345(official name : ...	ChIP-Seq
SRX222640	SRA066060	Snyder_DPL-1_Input_L4_rep1_GTAT	Snyder_DPL-1_Input_L4_rep1_GTAT	Snyder_DPL-1_Input_L4_rep1_GTAT	Snyder_DPL-1_Input_L4_...	OP105(official name : OP105 genotype : unc119(ed3); wgIs105(dpl-1::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The DPL-1::EGFP fusion protein has broad expression pattern description : but silence in germline cells. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the DPL-1 transcription factor. made_by : Bob Waterston's lab from UW )|Snyder_DPL-1_Input_L4_rep1_GTAT|L4	OP105(official name : ...	ChIP-Seq
SRX222641	SRA066060	Snyder_DPL-1_Input_L4_rep2_ACGT	Snyder_DPL-1_Input_L4_rep2_ACGT	Snyder_DPL-1_Input_L4_rep2_ACGT	Snyder_DPL-1_Input_L4_...	OP105(official name : OP105 genotype : unc119(ed3); wgIs105(dpl-1::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The DPL-1::EGFP fusion protein has broad expression pattern description : but silence in germline cells. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the DPL-1 transcription factor. made_by : Bob Waterston's lab from UW )|Snyder_DPL-1_Input_L4_rep2_ACGT|L4	OP105(official name : ...	ChIP-Seq
SRX222642	SRA066060	Snyder_DPL-1_GFP_L4_rep1_TGCT	Snyder_DPL-1_GFP_L4_rep1_TGCT	Snyder_DPL-1_GFP_L4_rep1_TGCT	Snyder_DPL-1_GFP_L4_re...	OP105(official name : OP105 genotype : unc119(ed3); wgIs105(dpl-1::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The DPL-1::EGFP fusion protein has broad expression pattern description : but silence in germline cells. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the DPL-1 transcription factor. made_by : Bob Waterston's lab from UW )|Snyder_DPL-1_GFP_L4_rep1_TGCT|L4	OP105(official name : ...	ChIP-Seq
SRX222643	SRA066060	Snyder_DPL-1_GFP_L4_rep2_ACGT	Snyder_DPL-1_GFP_L4_rep2_ACGT	Snyder_DPL-1_GFP_L4_rep2_ACGT	Snyder_DPL-1_GFP_L4_re...	OP105(official name : OP105 genotype : unc119(ed3); wgIs105(dpl-1::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The DPL-1::EGFP fusion protein has broad expression pattern description : but silence in germline cells. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the DPL-1 transcription factor. made_by : Bob Waterston's lab from UW )|Snyder_DPL-1_GFP_L4_rep2_ACGT|L4	OP105(official name : ...	ChIP-Seq
SRX2228847	SRA482737	SDC2_N2_MxEmb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SDC2_N2_MxEmb_rep1_ChIP-seq;_Caenorhabditis_ele...	SDC-2|whole worms	SDC-2	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2228848	SRA482737	SDC2_N2_MxEmb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SDC2_N2_MxEmb_rep2_ChIP-seq;_Caenorhabditis_ele...	SDC-2|whole worms	SDC-2	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2228849	SRA482737	SDC2_N2_MxEmb_rep3_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SDC2_N2_MxEmb_rep3_ChIP-seq;_Caenorhabditis_ele...	SDC-2|whole worms	SDC-2	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2228850	SRA482737	SDC2_N2_MxEmb_rep4_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SDC2_N2_MxEmb_rep4_ChIP-seq;_Caenorhabditis_ele...	SDC-2|whole worms	SDC-2	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2228851	SRA482737	SDC2_N2_MxEmb_rep5_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SDC2_N2_MxEmb_rep5_ChIP-seq;_Caenorhabditis_ele...	SDC-2|whole worms	SDC-2	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2228852	SRA482737	SDC3_N2_MxEmb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SDC3_N2_MxEmb_rep1_ChIP-seq;_Caenorhabditis_ele...	SDC-3|whole worms	SDC-3	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2228853	SRA482737	SDC3_N2_MxEmb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SDC3_N2_MxEmb_rep2_ChIP-seq;_Caenorhabditis_ele...	SDC-3|whole worms	SDC-3	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2228854	SRA482737	SDC3_N2_MxEmb_rep3_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SDC3_N2_MxEmb_rep3_ChIP-seq;_Caenorhabditis_ele...	SDC-3|whole worms	SDC-3	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2228855	SRA482737	SDC3_N2_MxEmb_rep4_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SDC3_N2_MxEmb_rep4_ChIP-seq;_Caenorhabditis_ele...	SDC-3|whole worms	SDC-3	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2228856	SRA482737	SDC3_N2_MxEmb_rep5_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SDC3_N2_MxEmb_rep5_ChIP-seq;_Caenorhabditis_ele...	SDC-3|whole worms	SDC-3	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2228857	SRA482737	DPY30_N2_MxEmb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	DPY30_N2_MxEmb_rep1_ChIP-seq;_Caenorhabditis_el...	DPY-30|whole worms	DPY-30	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2228858	SRA482737	DPY30_N2_MxEmb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	DPY30_N2_MxEmb_rep2_ChIP-seq;_Caenorhabditis_el...	DPY-30|whole worms	DPY-30	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2228859	SRA482737	DPY30_N2_MxEmb_rep3_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	DPY30_N2_MxEmb_rep3_ChIP-seq;_Caenorhabditis_el...	DPY-30|whole worms	DPY-30	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2228860	SRA482737	DPY30_N2_MxEmb_rep4_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	DPY30_N2_MxEmb_rep4_ChIP-seq;_Caenorhabditis_el...	DPY-30|whole worms	DPY-30	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2228861	SRA482737	DPY30_N2_MxEmb_rep5_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	DPY30_N2_MxEmb_rep5_ChIP-seq;_Caenorhabditis_el...	DPY-30|whole worms	DPY-30	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2228862	SRA482737	DPY27_N2_MxEmb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	DPY27_N2_MxEmb_rep1_ChIP-seq;_Caenorhabditis_el...	DPY-27|whole worms	DPY-27	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2228863	SRA482737	DPY27_N2_MxEmb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	DPY27_N2_MxEmb_rep2_ChIP-seq;_Caenorhabditis_el...	DPY-27|whole worms	DPY-27	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2228864	SRA482737	DPY27_N2_MxEmb_rep3_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	DPY27_N2_MxEmb_rep3_ChIP-seq;_Caenorhabditis_el...	DPY-27|whole worms	DPY-27	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2228865	SRA482737	DPY27_N2_MxEmb_rep4_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	DPY27_N2_MxEmb_rep4_ChIP-seq;_Caenorhabditis_el...	DPY-27|whole worms	DPY-27	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2228866	SRA482737	H3K4me3_N2_MxEmb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_N2_MxEmb_rep1_ChIP-seq;_Caenorhabditis_...	H3K4me3|whole worms	H3K4me3	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2228867	SRA482737	H3K4me3_N2_MxEmb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_N2_MxEmb_rep2_ChIP-seq;_Caenorhabditis_...	H3K4me3|whole worms	H3K4me3	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2228868	SRA482737	H3K4me3_N2_MxEmb_rep3_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_N2_MxEmb_rep3_ChIP-seq;_Caenorhabditis_...	H3K4me3|whole worms	H3K4me3	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2228869	SRA482737	H3_N2_MxEmb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3_N2_MxEmb_rep1_ChIP-seq;_Caenorhabditis_elega...	H3|whole worms	H3	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2228870	SRA482737	H3_N2_MxEmb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3_N2_MxEmb_rep2_ChIP-seq;_Caenorhabditis_elega...	H3|whole worms	H3	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2228871	SRA482737	H3_TY1072_MxEmb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3_TY1072_MxEmb_rep1_ChIP-seq;_Caenorhabditis_e...	H3|whole worms	H3	TY1072|whole worms|mixed embryo	TY1072	ChIP-Seq
SRX2228872	SRA482737	H3_TY1072_MxEmb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3_TY1072_MxEmb_rep2_ChIP-seq;_Caenorhabditis_e...	H3|whole worms	H3	TY1072|whole worms|mixed embryo	TY1072	ChIP-Seq
SRX2228873	SRA482737	SDC2_TY2205_MxEmb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SDC2_TY2205_MxEmb_rep1_ChIP-seq;_Caenorhabditis...	SDC-2|whole worms	SDC-2	TY2205|whole worms|mixed embryo	TY2205	ChIP-Seq
SRX2228874	SRA482737	SDC2_TY2205_MxEmb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SDC2_TY2205_MxEmb_rep2_ChIP-seq;_Caenorhabditis...	SDC-2|whole worms	SDC-2	TY2205|whole worms|mixed embryo	TY2205	ChIP-Seq
SRX2228875	SRA482737	SDC2_TY1072_MxEmb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SDC2_TY1072_MxEmb_rep1_ChIP-seq;_Caenorhabditis...	SDC-2|whole worms	SDC-2	TY1072|whole worms|mixed embryo	TY1072	ChIP-Seq
SRX2228876	SRA482737	SDC2_TY1072_MxEmb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SDC2_TY1072_MxEmb_rep2_ChIP-seq;_Caenorhabditis...	SDC-2|whole worms	SDC-2	TY1072|whole worms|mixed embryo	TY1072	ChIP-Seq
SRX2228877	SRA482737	SDC2_TY1072_MxEmb_rep3_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SDC2_TY1072_MxEmb_rep3_ChIP-seq;_Caenorhabditis...	SDC-2|whole worms	SDC-2	TY1072|whole worms|mixed embryo	TY1072	ChIP-Seq
SRX2228878	SRA482737	DPY27_ERC38_MxEmb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	DPY27_ERC38_MxEmb_rep1_ChIP-seq;_Caenorhabditis...	DPY-27|whole worms	DPY-27	ERC38|whole worms|mixed embryo	ERC38	ChIP-Seq
SRX2228879	SRA482737	DPY27_ERC38_MxEmb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	DPY27_ERC38_MxEmb_rep2_ChIP-seq;_Caenorhabditis...	DPY-27|whole worms	DPY-27	ERC38|whole worms|mixed embryo	ERC38	ChIP-Seq
SRX2228880	SRA482737	DPY27_ERC38_MxEmb_rep3_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	DPY27_ERC38_MxEmb_rep3_ChIP-seq;_Caenorhabditis...	DPY-27|whole worms	DPY-27	ERC38|whole worms|mixed embryo	ERC38	ChIP-Seq
SRX2228881	SRA482737	SDC3_ERC38_MxEmb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SDC3_ERC38_MxEmb_rep1_ChIP-seq;_Caenorhabditis_...	SDC-3|whole worms	SDC-3	ERC38|whole worms|mixed embryo	ERC38	ChIP-Seq
SRX2228882	SRA482737	SDC3_ERC38_MxEmb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SDC3_ERC38_MxEmb_rep2_ChIP-seq;_Caenorhabditis_...	SDC-3|whole worms	SDC-3	ERC38|whole worms|mixed embryo	ERC38	ChIP-Seq
SRX2228883	SRA482737	SDC3_ERC38_MxEmb_rep3_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SDC3_ERC38_MxEmb_rep3_ChIP-seq;_Caenorhabditis_...	SDC-3|whole worms	SDC-3	ERC38|whole worms|mixed embryo	ERC38	ChIP-Seq
SRX2228884	SRA482737	SDC3_ERC38_MxEmb_rep4_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SDC3_ERC38_MxEmb_rep4_ChIP-seq;_Caenorhabditis_...	SDC-3|whole worms	SDC-3	ERC38|whole worms|mixed embryo	ERC38	ChIP-Seq
SRX2228885	SRA482737	DPY27_ERC54_MxEmb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	DPY27_ERC54_MxEmb_rep1_ChIP-seq;_Caenorhabditis...	DPY-27|whole worms	DPY-27	ERC54|whole worms|mixed embryo	ERC54	ChIP-Seq
SRX2228886	SRA482737	DPY27_ERC54_MxEmb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	DPY27_ERC54_MxEmb_rep2_ChIP-seq;_Caenorhabditis...	DPY-27|whole worms	DPY-27	ERC54|whole worms|mixed embryo	ERC54	ChIP-Seq
SRX2228887	SRA482737	DPY27_ERC64_MxEmb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	DPY27_ERC64_MxEmb_rep1_ChIP-seq;_Caenorhabditis...	DPY-27|whole worms	DPY-27	ERC64|whole worms|mixed embryo	ERC64	ChIP-Seq
SRX2228888	SRA482737	DPY27_ERC64_MxEmb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	DPY27_ERC64_MxEmb_rep2_ChIP-seq;_Caenorhabditis...	DPY-27|whole worms	DPY-27	ERC64|whole worms|mixed embryo	ERC64	ChIP-Seq
SRX2228889	SRA482737	DPY27_ERC64_MxEmb_rep3_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	DPY27_ERC64_MxEmb_rep3_ChIP-seq;_Caenorhabditis...	DPY-27|whole worms	DPY-27	ERC64|whole worms|mixed embryo	ERC64	ChIP-Seq
SRX2228890	SRA482737	DPY27_ERC51_MxEmb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	DPY27_ERC51_MxEmb_rep1_ChIP-seq;_Caenorhabditis...	DPY-27|whole worms	DPY-27	ERC51|whole worms|mixed embryo	ERC51	ChIP-Seq
SRX2228891	SRA482737	DPY27_ERC51_MxEmb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	DPY27_ERC51_MxEmb_rep2_ChIP-seq;_Caenorhabditis...	DPY-27|whole worms	DPY-27	ERC51|whole worms|mixed embryo	ERC51	ChIP-Seq
SRX2228892	SRA482737	DPY27_ERC51_MxEmb_rep3_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	DPY27_ERC51_MxEmb_rep3_ChIP-seq;_Caenorhabditis...	DPY-27|whole worms	DPY-27	ERC51|whole worms|mixed embryo	ERC51	ChIP-Seq
SRX2228893	SRA482737	EE4_input_N2_MxEmb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	EE4_input_N2_MxEmb_ChIP-seq;_Caenorhabditis_ele...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2228894	SRA482737	LW53_input_N2_MxEmb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	LW53_input_N2_MxEmb_ChIP-seq;_Caenorhabditis_el...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2228895	SRA482737	LW78_input_N2_MxEmb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	LW78_input_N2_MxEmb_ChIP-seq;_Caenorhabditis_el...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2228896	SRA482737	SE243_input_TY1072_MxEmb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SE243_input_TY1072_MxEmb_ChIP-seq;_Caenorhabdit...	INPUT|whole worms	INPUT	TY1072|whole worms|mixed embryo	TY1072	ChIP-Seq
SRX2228897	SRA482737	LW43_input_TY1072_MxEmb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	LW43_input_TY1072_MxEmb_ChIP-seq;_Caenorhabditi...	INPUT|whole worms	INPUT	TY1072|whole worms|mixed embryo	TY1072	ChIP-Seq
SRX2228898	SRA482737	SE35_input_TT2205_MxEmb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SE35_input_TT2205_MxEmb_ChIP-seq;_Caenorhabditi...	INPUT|whole worms	INPUT	TY2205|whole worms|mixed embryo	TY2205	ChIP-Seq
SRX2228899	SRA482737	SE344_input_TY2205_MxEmb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SE344_input_TY2205_MxEmb_ChIP-seq;_Caenorhabdit...	INPUT|whole worms	INPUT	TY2205|whole worms|mixed embryo	TY2205	ChIP-Seq
SRX2228900	SRA482737	LW44_input_TY1072_MxEmb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	LW44_input_TY1072_MxEmb_ChIP-seq;_Caenorhabditi...	INPUT|whole worms	INPUT	TY1072|whole worms|mixed embryo	TY1072	ChIP-Seq
SRX2228901	SRA482737	SE365_input_ERC38_MxEmb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SE365_input_ERC38_MxEmb_ChIP-seq;_Caenorhabditi...	INPUT|whole worms	INPUT	ERC38|whole worms|mixed embryo	ERC38	ChIP-Seq
SRX2228902	SRA482737	SE389_input_ERC38_MxEmb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SE389_input_ERC38_MxEmb_ChIP-seq;_Caenorhabditi...	INPUT|whole worms	INPUT	ERC38|whole worms|mixed embryo	ERC38	ChIP-Seq
SRX2228903	SRA482737	SE391_input_ERC38_MxEmb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SE391_input_ERC38_MxEmb_ChIP-seq;_Caenorhabditi...	INPUT|whole worms	INPUT	ERC38|whole worms|mixed embryo	ERC38	ChIP-Seq
SRX2228904	SRA482737	SEA167_input_ERC54_MxEmb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SEA167_input_ERC54_MxEmb_ChIP-seq;_Caenorhabdit...	INPUT|whole worms	INPUT	ERC54|whole worms|mixed embryo	ERC54	ChIP-Seq
SRX2228905	SRA482737	SEA166_input_ERC54_MxEmb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SEA166_input_ERC54_MxEmb_ChIP-seq;_Caenorhabdit...	INPUT|whole worms	INPUT	ERC54|whole worms|mixed embryo	ERC54	ChIP-Seq
SRX2228906	SRA482737	SEA214_input_ERC64_MxEmb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SEA214_input_ERC64_MxEmb_ChIP-seq;_Caenorhabdit...	INPUT|whole worms	INPUT	ERC64|whole worms|mixed embryo	ERC64	ChIP-Seq
SRX2228907	SRA482737	SEA164_input_ERC51_MxEmb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SEA164_input_ERC51_MxEmb_ChIP-seq;_Caenorhabdit...	INPUT|whole worms	INPUT	ERC51|whole worms|mixed embryo	ERC51	ChIP-Seq
SRX2228908	SRA482737	SEA196_input_ERC51_MxEmb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SEA196_input_ERC51_MxEmb_ChIP-seq;_Caenorhabdit...	INPUT|whole worms	INPUT	ERC51|whole worms|mixed embryo	ERC51	ChIP-Seq
SRX2228909	SRA482737	SEA197_input_ERC51_MxEmb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SEA197_input_ERC51_MxEmb_ChIP-seq;_Caenorhabdit...	INPUT|whole worms	INPUT	ERC51|whole worms|mixed embryo	ERC51	ChIP-Seq
SRX2228910	SRA482737	EE6_input_N2_MxEmb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	EE6_input_N2_MxEmb_ChIP-seq;_Caenorhabditis_ele...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2228911	SRA482737	EE13_input_N2_MxEmb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	EE13_input_N2_MxEmb_ChIP-seq;_Caenorhabditis_el...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2228912	SRA482737	SE210_input_N2_MxEmb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SE210_input_N2_MxEmb_ChIP-seq;_Caenorhabditis_e...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2228913	SRA482737	SE176_input_N2_MxEmb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SE176_input_N2_MxEmb_ChIP-seq;_Caenorhabditis_e...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2228914	SRA482737	EE9_input_N2_MxEmb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	EE9_input_N2_MxEmb_ChIP-seq;_Caenorhabditis_ele...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2228915	SRA482737	EE14_input_N2_MxEmb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	EE14_input_N2_MxEmb_ChIP-seq;_Caenorhabditis_el...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2228916	SRA482737	CJ43_input_N2_MxEmb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	CJ43_input_N2_MxEmb_ChIP-seq;_Caenorhabditis_el...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2228917	SRA482737	CJ19_input_N2_MxEmb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	CJ19_input_N2_MxEmb_ChIP-seq;_Caenorhabditis_el...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2228918	SRA482737	EE8_input_N2_MxEmb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	EE8_input_N2_MxEmb_ChIP-seq;_Caenorhabditis_ele...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX2249332	SRA485397	IgG_N2_1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	IgG_N2_1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	IgG (Sigma-Aldrich, catalog# I8140)|whole embryo	IgG (Sigma-Aldrich, ca...	Bristol N2|whole embryo|mixed stage (embryonic)	Bristol N2	ChIP-Seq
SRX2249333	SRA485397	IgG_N2_2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	IgG_N2_2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	IgG (Sigma-Aldrich, catalog# I8140)|whole embryo	IgG (Sigma-Aldrich, ca...	Bristol N2|whole embryo|mixed stage (embryonic)	Bristol N2	ChIP-Seq
SRX2249334	SRA485397	H3K23me2_N2_1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3K23me2_N2_1_ChIPSeq;_Caenorhabditis_elegans;_...	H3K23me2 (Active Motif, catalog# 39653, lot# 28209001)|whole embryo	H3K23me2 (Active Motif...	Bristol N2|whole embryo|mixed stage (embryonic)	Bristol N2	ChIP-Seq
SRX2249335	SRA485397	H3K23me2_N2_2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3K23me2_N2_2_ChIPSeq;_Caenorhabditis_elegans;_...	H3K23me2 (Active Motif, catalog# 39653, lot# 28209001)|whole embryo	H3K23me2 (Active Motif...	Bristol N2|whole embryo|mixed stage (embryonic)	Bristol N2	ChIP-Seq
SRX2332995	SRA491319	Early_Embryo_replicate_A;_Caenorhabditis_elegans;_ATAC-seq	Early_Embryo_replicate_A;_Caenorhabditis_elegan...	ATAC-seq	ATAC-seq	N2|whole organisms|early embryo	N2	ATAC-seq
SRX2332996	SRA491319	Larval_stage_3_replicate_A;_Caenorhabditis_elegans;_ATAC-seq	Larval_stage_3_replicate_A;_Caenorhabditis_eleg...	ATAC-seq	ATAC-seq	N2|whole organisms|larval stage 3	N2	ATAC-seq
SRX2332997	SRA491319	Young_adult_replicate_A;_Caenorhabditis_elegans;_ATAC-seq	Young_adult_replicate_A;_Caenorhabditis_elegans...	ATAC-seq	ATAC-seq	N2|whole organisms|young adult	N2	ATAC-seq
SRX2332998	SRA491319	Early_Embryo_replicate_B;_Caenorhabditis_elegans;_ATAC-seq	Early_Embryo_replicate_B;_Caenorhabditis_elegan...	ATAC-seq	ATAC-seq	N2|whole organisms|early embryo	N2	ATAC-seq
SRX2332999	SRA491319	Larval_stage_3_replicate_B;_Caenorhabditis_elegans;_ATAC-seq	Larval_stage_3_replicate_B;_Caenorhabditis_eleg...	ATAC-seq	ATAC-seq	N2|whole organisms|larval stage 3	N2	ATAC-seq
SRX2333000	SRA491319	Young_adult_replicate_B;_Caenorhabditis_elegans;_ATAC-seq	Young_adult_replicate_B;_Caenorhabditis_elegans...	ATAC-seq	ATAC-seq	N2|whole organisms|young adult	N2	ATAC-seq
SRX2333001	SRA491319	Early_Embryo_replicate_C;_Caenorhabditis_elegans;_ATAC-seq	Early_Embryo_replicate_C;_Caenorhabditis_elegan...	ATAC-seq	ATAC-seq	N2|whole organisms|early embryo	N2	ATAC-seq
SRX2333002	SRA491319	Larval_stage_3_replicate_C;_Caenorhabditis_elegans;_ATAC-seq	Larval_stage_3_replicate_C;_Caenorhabditis_eleg...	ATAC-seq	ATAC-seq	N2|whole organisms|larval stage 3	N2	ATAC-seq
SRX2333003	SRA491319	Young_adult_replicate_C;_Caenorhabditis_elegans;_ATAC-seq	Young_adult_replicate_C;_Caenorhabditis_elegans...	ATAC-seq	ATAC-seq	N2|whole organisms|young adult	N2	ATAC-seq
SRX2333004	SRA491319	input_control;_Caenorhabditis_elegans;_ATAC-seq	input_control;_Caenorhabditis_elegans;_ATAC-seq	ATAC-seq	ATAC-seq	N2|whole organisms|NA	N2	ATAC-seq
SRX233415	SRA066478	Snyder_DPL-1_GFP_L1v2_rep1_Input_GTAT	Snyder_DPL-1_GFP_L1v2_rep1_Input_GTAT	Snyder_DPL-1_GFP_L1v2_rep1_Input_GTAT	Snyder_DPL-1_GFP_L1v2_...	OP105(official name : OP105 genotype : unc119(ed3); wgIs105(dpl-1::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The DPL-1::EGFP fusion protein has broad expression pattern description : but silence in germline cells. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the DPL-1 transcription factor. made_by : Bob Waterston's lab from UW )|Snyder_DPL-1_GFP_L1v2_rep1_Input_GTAT|fed L1	OP105(official name : ...	ChIP-Seq
SRX233416	SRA066478	Snyder_DPL-1_GFP_L1v2_rep2_Input_CATT	Snyder_DPL-1_GFP_L1v2_rep2_Input_CATT	Snyder_DPL-1_GFP_L1v2_rep2_Input_CATT	Snyder_DPL-1_GFP_L1v2_...	OP105(official name : OP105 genotype : unc119(ed3); wgIs105(dpl-1::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The DPL-1::EGFP fusion protein has broad expression pattern description : but silence in germline cells. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the DPL-1 transcription factor. made_by : Bob Waterston's lab from UW )|Snyder_DPL-1_GFP_L1v2_rep2_Input_CATT|fed L1	OP105(official name : ...	ChIP-Seq
SRX233417	SRA066478	Snyder_DPL-1_GFP_L1v2_rep1_GFP_GTAT	Snyder_DPL-1_GFP_L1v2_rep1_GFP_GTAT	Snyder_DPL-1_GFP_L1v2_rep1_GFP_GTAT	Snyder_DPL-1_GFP_L1v2_...	OP105(official name : OP105 genotype : unc119(ed3); wgIs105(dpl-1::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The DPL-1::EGFP fusion protein has broad expression pattern description : but silence in germline cells. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the DPL-1 transcription factor. made_by : Bob Waterston's lab from UW )|Snyder_DPL-1_GFP_L1v2_rep1_GFP_GTAT|fed L1	OP105(official name : ...	ChIP-Seq
SRX233418	SRA066478	Snyder_DPL-1_GFP_L1v2_rep2_GTP_CATT	Snyder_DPL-1_GFP_L1v2_rep2_GTP_CATT	Snyder_DPL-1_GFP_L1v2_rep2_GFP_CATT	Snyder_DPL-1_GFP_L1v2_...	OP105(official name : OP105 genotype : unc119(ed3); wgIs105(dpl-1::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The DPL-1::EGFP fusion protein has broad expression pattern description : but silence in germline cells. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the DPL-1 transcription factor. made_by : Bob Waterston's lab from UW )|Snyder_DPL-1_GFP_L1v2_rep2_GFP_CATT|fed L1	OP105(official name : ...	ChIP-Seq
SRX233439	SRA066479	Snyder_F45C12.2_Input_L2_rep1_ACGT	Snyder_F45C12.2_Input_L2_rep1_ACGT	Snyder_F45C12.2_Input_L2_rep1_ACGT	Snyder_F45C12.2_Input_...	OP212(official name : OP212 genotype : unc119(ed3); wgIs212(F45C12.2:TY1 EGFP FLAG; unc119) outcross : 3 transgene : F45C12.2 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The F45C12.2::EGFP fusion protein is expressed in the correct F45C12.2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the F45C12.2 transcription factor. made_by : Mihail Sarov )|Snyder_F45C12.2_Input_L2_rep1_ACGT|L2	OP212(official name : ...	ChIP-Seq
SRX233440	SRA066479	Snyder_F45C12.2_Input_L2_rep2_TGCT	Snyder_F45C12.2_Input_L2_rep2_TGCT	Snyder_F45C12.2_Input_L2_rep2_TGCT	Snyder_F45C12.2_Input_...	OP212(official name : OP212 genotype : unc119(ed3); wgIs212(F45C12.2:TY1 EGFP FLAG; unc119) outcross : 3 transgene : F45C12.2 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The F45C12.2::EGFP fusion protein is expressed in the correct F45C12.2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the F45C12.2 transcription factor. made_by : Mihail Sarov )|Snyder_F45C12.2_Input_L2_rep2_TGCT|L2	OP212(official name : ...	ChIP-Seq
SRX233441	SRA066479	Snyder_F45C12.2_GFP_L2_rep1_ACGT	Snyder_F45C12.2_GFP_L2_rep1_ACGT	Snyder_F45C12.2_GFP_L2_rep1_ACGT	Snyder_F45C12.2_GFP_L2...	OP212(official name : OP212 genotype : unc119(ed3); wgIs212(F45C12.2:TY1 EGFP FLAG; unc119) outcross : 3 transgene : F45C12.2 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The F45C12.2::EGFP fusion protein is expressed in the correct F45C12.2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the F45C12.2 transcription factor. made_by : Mihail Sarov )|Snyder_F45C12.2_GFP_L2_rep1_ACGT|L2	OP212(official name : ...	ChIP-Seq
SRX233442	SRA066479	Snyder_F45C12.2_GFP_L2_rep2_TGCT	Snyder_F45C12.2_GFP_L2_rep2_TGCT	Snyder_F45C12.2_GFP_L2_rep2_TGCT	Snyder_F45C12.2_GFP_L2...	OP212(official name : OP212 genotype : unc119(ed3); wgIs212(F45C12.2:TY1 EGFP FLAG; unc119) outcross : 3 transgene : F45C12.2 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The F45C12.2::EGFP fusion protein is expressed in the correct F45C12.2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the F45C12.2 transcription factor. made_by : Mihail Sarov )|Snyder_F45C12.2_GFP_L2_rep2_TGCT|L2	OP212(official name : ...	ChIP-Seq
SRX233443	SRA066480	Snyder_ALY-2_Input_L2_rep1_GTAT	Snyder_ALY-2_Input_L2_rep1_GTAT	Snyder_ALY-2_Input_L2_rep1_GTAT	Snyder_ALY-2_Input_L2_...	OP217(official name : OP217 genotype : unc-119(ed3); wgIs217(aly-2:TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ALY-2::EGFP fusion protein is expressed in the correct aly-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ALY-2 transcription factor. made_by : Mihail Sarov )|Snyder_ALY-2_Input_L2_rep1_GTAT|L2	OP217(official name : ...	ChIP-Seq
SRX233444	SRA066480	Snyder_ALY-2_Input_L2_rep2_CATT	Snyder_ALY-2_Input_L2_rep2_CATT	Snyder_ALY-2_Input_L2_rep2_CATT	Snyder_ALY-2_Input_L2_...	OP217(official name : OP217 genotype : unc-119(ed3); wgIs217(aly-2:TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ALY-2::EGFP fusion protein is expressed in the correct aly-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ALY-2 transcription factor. made_by : Mihail Sarov )|Snyder_ALY-2_Input_L2_rep2_CATT|L2	OP217(official name : ...	ChIP-Seq
SRX233445	SRA066480	Snyder_ALY-2_GFP_L2_rep1_GTAT	Snyder_ALY-2_GFP_L2_rep1_GTAT	Snyder_ALY-2_GFP_L2_rep1_GTAT	Snyder_ALY-2_GFP_L2_re...	OP217(official name : OP217 genotype : unc-119(ed3); wgIs217(aly-2:TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ALY-2::EGFP fusion protein is expressed in the correct aly-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ALY-2 transcription factor. made_by : Mihail Sarov )|Snyder_ALY-2_GFP_L2_rep1_GTAT|L2	OP217(official name : ...	ChIP-Seq
SRX233446	SRA066480	Snyder_ALY-2_GFP_L2_rep2_CATT	Snyder_ALY-2_GFP_L2_rep2_CATT	Snyder_ALY-2_GFP_L2_rep2_CATT	Snyder_ALY-2_GFP_L2_re...	OP217(official name : OP217 genotype : unc-119(ed3); wgIs217(aly-2:TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ALY-2::EGFP fusion protein is expressed in the correct aly-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ALY-2 transcription factor. made_by : Mihail Sarov )|Snyder_ALY-2_GFP_L2_rep2_CATT|L2	OP217(official name : ...	ChIP-Seq
SRX233447	SRA066481	Snyder_R02D3.7_GFP_L3_rep1_Input_ACGT	Snyder_R02D3.7_GFP_L3_rep1_Input_ACGT	Snyder_R02D3.7_GFP_L3_rep1_Input_ACGT	Snyder_R02D3.7_GFP_L3_...	OP218(official name : OP218 genotype : unc-119(ed3); wgIs218(R02D3.7:TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The R02D3.7::EGFP fusion protein is expressed in the correct R02D3.7 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the RO2D3.7 transcription factor. made_by : Mihail Sarov )|Snyder_R02D3.7_GFP_L3_rep1_Input_ACGT|L3	OP218(official name : ...	ChIP-Seq
SRX233448	SRA066481	Snyder_R02D3.7_GFP_L3_rep2_Input_TGCT	Snyder_R02D3.7_GFP_L3_rep2_Input_TGCT	Snyder_R02D3.7_GFP_L3_rep2_Input_TGCT	Snyder_R02D3.7_GFP_L3_...	OP218(official name : OP218 genotype : unc-119(ed3); wgIs218(R02D3.7:TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The R02D3.7::EGFP fusion protein is expressed in the correct R02D3.7 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the RO2D3.7 transcription factor. made_by : Mihail Sarov )|Snyder_R02D3.7_GFP_L3_rep2_Input_TGCT|L3	OP218(official name : ...	ChIP-Seq
SRX233449	SRA066481	Snyder_R02D3.7_GFP_L3_rep1_GFP_CATT	Snyder_R02D3.7_GFP_L3_rep1_GFP_CATT	Snyder_R02D3.7_GFP_L3_rep1_GFP_CATT	Snyder_R02D3.7_GFP_L3_...	OP218(official name : OP218 genotype : unc-119(ed3); wgIs218(R02D3.7:TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The R02D3.7::EGFP fusion protein is expressed in the correct R02D3.7 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the RO2D3.7 transcription factor. made_by : Mihail Sarov )|Snyder_R02D3.7_GFP_L3_rep1_GFP_CATT|L3	OP218(official name : ...	ChIP-Seq
SRX233450	SRA066481	Snyder_R02D3.7_GFP_L3_rep2_GFP_ACGT	Snyder_R02D3.7_GFP_L3_rep2_GFP_ACGT	Snyder_R02D3.7_GFP_L3_rep2_GFP_ACGT	Snyder_R02D3.7_GFP_L3_...	OP218(official name : OP218 genotype : unc-119(ed3); wgIs218(R02D3.7:TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The R02D3.7::EGFP fusion protein is expressed in the correct R02D3.7 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the RO2D3.7 transcription factor. made_by : Mihail Sarov )|Snyder_R02D3.7_GFP_L3_rep2_GFP_ACGT|L3	OP218(official name : ...	ChIP-Seq
SRX233451	SRA066482	Snyder_LIN-15B_GFP_L1_rep1_Input_CATT	Snyder_LIN-15B_GFP_L1_rep1_Input_CATT	Snyder_LIN-15B_GFP_L1_rep1_Input_CATT	Snyder_LIN-15B_GFP_L1_...	OP184(official name : OP184 genotype : unc119(ed3); wgIs184(lin-15B::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-15B::EGFP fusion protein is expressed in the correct lin-15B spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-15B transcription factor. made_by : S Kim )|Snyder_LIN-15B_GFP_L1_rep1_Input_CATT|fed L1	OP184(official name : ...	ChIP-Seq
SRX233452	SRA066482	Snyder_LIN-15B_GFP_L1_rep2_Input_GTAT	Snyder_LIN-15B_GFP_L1_rep2_Input_GTAT	Snyder_LIN-15B_GFP_L1_rep2_Input_GTAT	Snyder_LIN-15B_GFP_L1_...	OP184(official name : OP184 genotype : unc119(ed3); wgIs184(lin-15B::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-15B::EGFP fusion protein is expressed in the correct lin-15B spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-15B transcription factor. made_by : S Kim )|Snyder_LIN-15B_GFP_L1_rep2_Input_GTAT|fed L1	OP184(official name : ...	ChIP-Seq
SRX233453	SRA066482	Snyder_LIN-15B_GFP_L1_rep1_GFP_GTAT	Snyder_LIN-15B_GFP_L1_rep1_GFP_GTAT	Snyder_LIN-15B_GFP_L1_rep1_GFP_GTAT	Snyder_LIN-15B_GFP_L1_...	OP184(official name : OP184 genotype : unc119(ed3); wgIs184(lin-15B::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-15B::EGFP fusion protein is expressed in the correct lin-15B spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-15B transcription factor. made_by : S Kim )|Snyder_LIN-15B_GFP_L1_rep1_GFP_GTAT|fed L1	OP184(official name : ...	ChIP-Seq
SRX233454	SRA066482	Snyder_LIN-15B_GFP_L1_rep2_GFP_CATT	Snyder_LIN-15B_GFP_L1_rep2_GFP_CATT	Snyder_LIN-15B_GFP_L1_rep2_GFP_CATT	Snyder_LIN-15B_GFP_L1_...	OP184(official name : OP184 genotype : unc119(ed3); wgIs184(lin-15B::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-15B::EGFP fusion protein is expressed in the correct lin-15B spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-15B transcription factor. made_by : S Kim )|Snyder_LIN-15B_GFP_L1_rep2_GFP_CATT|fed L1	OP184(official name : ...	ChIP-Seq
SRX233455	SRA066483	Snyder_NHR-77_GFP_L1_rep1_Input_GTAT	Snyder_NHR-77_GFP_L1_rep1_Input_GTAT	Snyder_NHR-77_GFP_L1_rep1_Input_GTAT	Snyder_NHR-77_GFP_L1_r...	OP353(official name : OP353 genotype : unc119(ed3); wgIs353(nhr-77::TY1 EGFP FLAG; unc119) outcross : 3 transgene : nhr-77 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-77::EGFP fusion protein is expressed in the correct nhr-77 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-77 transcription factor. made_by : R Waterston )|Snyder_NHR-77_GFP_L1_rep1_Input_GTAT|fed L1	OP353(official name : ...	ChIP-Seq
SRX233456	SRA066483	Snyder_NHR-77_GFP_L1_rep2_Input_CATT	Snyder_NHR-77_GFP_L1_rep2_Input_CATT	Snyder_NHR-77_GFP_L1_rep2_Input_CATT	Snyder_NHR-77_GFP_L1_r...	OP353(official name : OP353 genotype : unc119(ed3); wgIs353(nhr-77::TY1 EGFP FLAG; unc119) outcross : 3 transgene : nhr-77 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-77::EGFP fusion protein is expressed in the correct nhr-77 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-77 transcription factor. made_by : R Waterston )|Snyder_NHR-77_GFP_L1_rep2_Input_CATT|fed L1	OP353(official name : ...	ChIP-Seq
SRX233457	SRA066483	Snyder_NHR-77_GFP_L1_rep1_GFP_ACGT	Snyder_NHR-77_GFP_L1_rep1_GFP_ACGT	Snyder_NHR-77_GFP_L1_rep1_GFP_ACGT	Snyder_NHR-77_GFP_L1_r...	OP353(official name : OP353 genotype : unc119(ed3); wgIs353(nhr-77::TY1 EGFP FLAG; unc119) outcross : 3 transgene : nhr-77 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-77::EGFP fusion protein is expressed in the correct nhr-77 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-77 transcription factor. made_by : R Waterston )|Snyder_NHR-77_GFP_L1_rep1_GFP_ACGT|fed L1	OP353(official name : ...	ChIP-Seq
SRX233458	SRA066483	Snyder_NHR-77_GFP_L1_rep2_GFP_TGCT	Snyder_NHR-77_GFP_L1_rep2_GFP_TGCT	Snyder_NHR-77_GFP_L1_rep2_GFP_TGCT	Snyder_NHR-77_GFP_L1_r...	OP353(official name : OP353 genotype : unc119(ed3); wgIs353(nhr-77::TY1 EGFP FLAG; unc119) outcross : 3 transgene : nhr-77 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-77::EGFP fusion protein is expressed in the correct nhr-77 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-77 transcription factor. made_by : R Waterston )|Snyder_NHR-77_GFP_L1_rep2_GFP_TGCT|fed L1	OP353(official name : ...	ChIP-Seq
SRX233459	SRA066484	Snyder_Pges-1_LIN-35_YL398_L1_rep1_Input_GTAT	Snyder_Pges-1_LIN-35_YL398_L1_rep1_Input_GTAT	Snyder_Pges-1_LIN-35_YL398_L1_rep1_Input_GTAT	Snyder_Pges-1_LIN-35_Y...	YL398(official name : YL398 genotype : unc-119(ed3) III; vrIs55pGES-1::LIN-35::GFP FLAG: LIN-35 3'-UTR genotype : unc-119 (+) outcross : 0 mutagen : None tags : GFP::3xFlag description : The LIN-35::GFP fusion protein is driven by the ges-1 promoter and is expressed in the intestine. made_by : Michelle Kudron in Reinke lab )|Snyder_Pges-1_LIN-35_YL398_L1_rep1_Input_GTAT|fed L1	YL398(official name : ...	ChIP-Seq
SRX233460	SRA066484	Snyder_Pges-1_LIN-35_YL398_L1_rep2_Input_CATT	Snyder_Pges-1_LIN-35_YL398_L1_rep2_Input_CATT	Snyder_Pges-1_LIN-35_YL398_L1_rep2_Input_CATT	Snyder_Pges-1_LIN-35_Y...	YL398(official name : YL398 genotype : unc-119(ed3) III; vrIs55pGES-1::LIN-35::GFP FLAG: LIN-35 3'-UTR genotype : unc-119 (+) outcross : 0 mutagen : None tags : GFP::3xFlag description : The LIN-35::GFP fusion protein is driven by the ges-1 promoter and is expressed in the intestine. made_by : Michelle Kudron in Reinke lab )|Snyder_Pges-1_LIN-35_YL398_L1_rep2_Input_CATT|fed L1	YL398(official name : ...	ChIP-Seq
SRX233461	SRA066484	Snyder_Pges-1_LIN-35_YL398_L1_rep1_GFP_GTAT	Snyder_Pges-1_LIN-35_YL398_L1_rep1_GFP_GTAT	Snyder_Pges-1_LIN-35_YL398_L1_rep1_GFP_GTAT	Snyder_Pges-1_LIN-35_Y...	YL398(official name : YL398 genotype : unc-119(ed3) III; vrIs55pGES-1::LIN-35::GFP FLAG: LIN-35 3'-UTR genotype : unc-119 (+) outcross : 0 mutagen : None tags : GFP::3xFlag description : The LIN-35::GFP fusion protein is driven by the ges-1 promoter and is expressed in the intestine. made_by : Michelle Kudron in Reinke lab )|Snyder_Pges-1_LIN-35_YL398_L1_rep1_GFP_GTAT|fed L1	YL398(official name : ...	ChIP-Seq
SRX233462	SRA066484	Snyder_Pges-1_LIN-35_YL398_L1_rep2_GFP_GTAT	Snyder_Pges-1_LIN-35_YL398_L1_rep2_GFP_GTAT	Snyder_Pges-1_LIN-35_YL398_L1_rep2_GFP_GTAT	Snyder_Pges-1_LIN-35_Y...	YL398(official name : YL398 genotype : unc-119(ed3) III; vrIs55pGES-1::LIN-35::GFP FLAG: LIN-35 3'-UTR genotype : unc-119 (+) outcross : 0 mutagen : None tags : GFP::3xFlag description : The LIN-35::GFP fusion protein is driven by the ges-1 promoter and is expressed in the intestine. made_by : Michelle Kudron in Reinke lab )|Snyder_Pges-1_LIN-35_YL398_L1_rep2_GFP_GTAT|fed L1	YL398(official name : ...	ChIP-Seq
SRX233693	SRA066523	Snyder_ZK377.2_GFP_L4_rep1_Input_ACGT	Snyder_ZK377.2_GFP_L4_rep1_Input_ACGT	Snyder_ZK377.2_GFP_L4_rep1_Input_ACGT	Snyder_ZK377.2_GFP_L4_...	OP355(official name : OP355 genotype : unc-119(ed3) III; wgIs355(ZK377.2::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The sax-3::EGFP fusion protein is expressed in the correct sax-3 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the sax-3 transcription factor. The sax-3 gene is encoded by the ZK377.2 CDS. made_by : R Waterston )|Snyder_ZK377.2_GFP_L4_rep1_Input_ACGT|L4	OP355(official name : ...	ChIP-Seq
SRX233694	SRA066523	Snyder_ZK377.2_GFP_L4_rep2_Input_TGCT	Snyder_ZK377.2_GFP_L4_rep2_Input_TGCT	Snyder_ZK377.2_GFP_L4_rep2_Input_TGCT	Snyder_ZK377.2_GFP_L4_...	OP355(official name : OP355 genotype : unc-119(ed3) III; wgIs355(ZK377.2::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The sax-3::EGFP fusion protein is expressed in the correct sax-3 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the sax-3 transcription factor. The sax-3 gene is encoded by the ZK377.2 CDS. made_by : R Waterston )|Snyder_ZK377.2_GFP_L4_rep2_Input_TGCT|L4	OP355(official name : ...	ChIP-Seq
SRX233695	SRA066523	Snyder_ZK377.2_GFP_L4_rep1_GFP_ACGT	Snyder_ZK377.2_GFP_L4_rep1_GFP_ACGT	Snyder_ZK377.2_GFP_L4_rep1_GFP_ACGT	Snyder_ZK377.2_GFP_L4_...	OP355(official name : OP355 genotype : unc-119(ed3) III; wgIs355(ZK377.2::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The sax-3::EGFP fusion protein is expressed in the correct sax-3 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the sax-3 transcription factor. The sax-3 gene is encoded by the ZK377.2 CDS. made_by : R Waterston )|Snyder_ZK377.2_GFP_L4_rep1_GFP_ACGT|L4	OP355(official name : ...	ChIP-Seq
SRX233696	SRA066523	Snyder_ZK377.2_GFP_L4_rep2_GFP_TGCT	Snyder_ZK377.2_GFP_L4_rep2_GFP_TGCT	Snyder_ZK377.2_GFP_L4_rep2_GFP_TGCT	Snyder_ZK377.2_GFP_L4_...	OP355(official name : OP355 genotype : unc-119(ed3) III; wgIs355(ZK377.2::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The sax-3::EGFP fusion protein is expressed in the correct sax-3 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the sax-3 transcription factor. The sax-3 gene is encoded by the ZK377.2 CDS. made_by : R Waterston )|Snyder_ZK377.2_GFP_L4_rep2_GFP_TGCT|L4	OP355(official name : ...	ChIP-Seq
SRX234910	SRA066560	Snyder_ZK377.2_GFP_L1_rep1_Input_GTAT	Snyder_ZK377.2_GFP_L1_rep1_Input_GTAT	Snyder_ZK377.2_GFP_L1_rep1_Input_GTAT	Snyder_ZK377.2_GFP_L1_...	OP355(official name : OP355 genotype : unc-119(ed3) III; wgIs355(ZK377.2::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The sax-3::EGFP fusion protein is expressed in the correct sax-3 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the sax-3 transcription factor. The sax-3 gene is encoded by the ZK377.2 CDS. made_by : R Waterston )|Snyder_ZK377.2_GFP_L1_rep1_Input_GTAT|fed L1	OP355(official name : ...	ChIP-Seq
SRX234911	SRA066560	Snyder_ZK377.2_GFP_L1_rep2_Input_CATT	Snyder_ZK377.2_GFP_L1_rep2_Input_CATT	Snyder_ZK377.2_GFP_L1_rep2_Input_CATT	Snyder_ZK377.2_GFP_L1_...	OP355(official name : OP355 genotype : unc-119(ed3) III; wgIs355(ZK377.2::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The sax-3::EGFP fusion protein is expressed in the correct sax-3 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the sax-3 transcription factor. The sax-3 gene is encoded by the ZK377.2 CDS. made_by : R Waterston )|Snyder_ZK377.2_GFP_L1_rep2_Input_CATT|fed L1	OP355(official name : ...	ChIP-Seq
SRX234912	SRA066560	Snyder_ZK377.2_GFP_L1_rep1_GFP_GTAT	Snyder_ZK377.2_GFP_L1_rep1_GFP_GTAT	Snyder_ZK377.2_GFP_L1_rep1_GFP_GTAT	Snyder_ZK377.2_GFP_L1_...	OP355(official name : OP355 genotype : unc-119(ed3) III; wgIs355(ZK377.2::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The sax-3::EGFP fusion protein is expressed in the correct sax-3 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the sax-3 transcription factor. The sax-3 gene is encoded by the ZK377.2 CDS. made_by : R Waterston )|Snyder_ZK377.2_GFP_L1_rep1_GFP_GTAT|fed L1	OP355(official name : ...	ChIP-Seq
SRX234913	SRA066560	Snyder_ZK377.2_GFP_L1_rep2_GFP_CATT	Snyder_ZK377.2_GFP_L1_rep2_GFP_CATT	Snyder_ZK377.2_GFP_L1_rep2_GFP_CATT	Snyder_ZK377.2_GFP_L1_...	OP355(official name : OP355 genotype : unc-119(ed3) III; wgIs355(ZK377.2::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The sax-3::EGFP fusion protein is expressed in the correct sax-3 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the sax-3 transcription factor. The sax-3 gene is encoded by the ZK377.2 CDS. made_by : R Waterston )|Snyder_ZK377.2_GFP_L1_rep2_GFP_CATT|fed L1	OP355(official name : ...	ChIP-Seq
SRX234914	SRA066561	Snyder_ZK377.2_GFP_L3_rep1_Input_GTAT	Snyder_ZK377.2_GFP_L3_rep1_Input_GTAT	Snyder_ZK377.2_GFP_L3_rep1_Input_GTAT	Snyder_ZK377.2_GFP_L3_...	OP355(official name : OP355 genotype : unc-119(ed3) III; wgIs355(ZK377.2::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The sax-3::EGFP fusion protein is expressed in the correct sax-3 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the sax-3 transcription factor. The sax-3 gene is encoded by the ZK377.2 CDS. made_by : R Waterston )|Snyder_ZK377.2_GFP_L3_rep1_Input_GTAT|L3	OP355(official name : ...	ChIP-Seq
SRX234915	SRA066561	Snyder_ZK377.2_GFP_L3_rep2_Input_CATT	Snyder_ZK377.2_GFP_L3_rep2_Input_CATT	Snyder_ZK377.2_GFP_L3_rep2_Input_CATT	Snyder_ZK377.2_GFP_L3_...	OP355(official name : OP355 genotype : unc-119(ed3) III; wgIs355(ZK377.2::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The sax-3::EGFP fusion protein is expressed in the correct sax-3 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the sax-3 transcription factor. The sax-3 gene is encoded by the ZK377.2 CDS. made_by : R Waterston )|Snyder_ZK377.2_GFP_L3_rep2_Input_CATT|L3	OP355(official name : ...	ChIP-Seq
SRX234916	SRA066561	Snyder_ZK377.2_GFP_L3_rep1_GFP_ACGT	Snyder_ZK377.2_GFP_L3_rep1_GFP_ACGT	Snyder_ZK377.2_GFP_L3_rep1_GFP_ACGT	Snyder_ZK377.2_GFP_L3_...	OP355(official name : OP355 genotype : unc-119(ed3) III; wgIs355(ZK377.2::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The sax-3::EGFP fusion protein is expressed in the correct sax-3 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the sax-3 transcription factor. The sax-3 gene is encoded by the ZK377.2 CDS. made_by : R Waterston )|Snyder_ZK377.2_GFP_L3_rep1_GFP_ACGT|L3	OP355(official name : ...	ChIP-Seq
SRX234917	SRA066561	Snyder_ZK377.2_GFP_L3_rep2_GFP_TGCT	Snyder_ZK377.2_GFP_L3_rep2_GFP_TGCT	Snyder_ZK377.2_GFP_L3_rep2_GFP_TGCT	Snyder_ZK377.2_GFP_L3_...	OP355(official name : OP355 genotype : unc-119(ed3) III; wgIs355(ZK377.2::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The sax-3::EGFP fusion protein is expressed in the correct sax-3 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the sax-3 transcription factor. The sax-3 gene is encoded by the ZK377.2 CDS. made_by : R Waterston )|Snyder_ZK377.2_GFP_L3_rep2_GFP_TGCT|L3	OP355(official name : ...	ChIP-Seq
SRX234918	SRA066562	Snyder_NHR-116_GFP_L4_rep1_Input_ACGT	Snyder_NHR-116_GFP_L4_rep1_Input_ACGT	Snyder_NHR-116_GFP_L4_rep1_Input_ACGT	Snyder_NHR-116_GFP_L4_...	OP226(official name : OP226 genotype : unc119(ed3); wgIs226(nhr-116::TY1 EGFP FLAG; unc119) outcross : 3 transgene : nhr-116 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-116::EGFP fusion protein is expressed in the correct nhr-116 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-116 transcription factor. made_by : M Sarov )|Snyder_NHR-116_GFP_L4_rep1_Input_ACGT|L4	OP226(official name : ...	ChIP-Seq
SRX234919	SRA066562	Snyder_NHR-116_GFP_L4_rep2_Input_TGCT	Snyder_NHR-116_GFP_L4_rep2_Input_TGCT	Snyder_NHR-116_GFP_L4_rep2_Input_TGCT	Snyder_NHR-116_GFP_L4_...	OP226(official name : OP226 genotype : unc119(ed3); wgIs226(nhr-116::TY1 EGFP FLAG; unc119) outcross : 3 transgene : nhr-116 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-116::EGFP fusion protein is expressed in the correct nhr-116 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-116 transcription factor. made_by : M Sarov )|Snyder_NHR-116_GFP_L4_rep2_Input_TGCT|L4	OP226(official name : ...	ChIP-Seq
SRX234920	SRA066562	Snyder_NHR-116_GFP_L4_rep1_GFP_ACGT	Snyder_NHR-116_GFP_L4_rep1_GFP_ACGT	Snyder_NHR-116_GFP_L4_rep1_GFP_ACGT	Snyder_NHR-116_GFP_L4_...	OP226(official name : OP226 genotype : unc119(ed3); wgIs226(nhr-116::TY1 EGFP FLAG; unc119) outcross : 3 transgene : nhr-116 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-116::EGFP fusion protein is expressed in the correct nhr-116 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-116 transcription factor. made_by : M Sarov )|Snyder_NHR-116_GFP_L4_rep1_GFP_ACGT|L4	OP226(official name : ...	ChIP-Seq
SRX234921	SRA066562	Snyder_NHR-116_GFP_L4_rep2_GFP_TGCT	Snyder_NHR-116_GFP_L4_rep2_GFP_TGCT	Snyder_NHR-116_GFP_L4_rep2_GFP_TGCT	Snyder_NHR-116_GFP_L4_...	OP226(official name : OP226 genotype : unc119(ed3); wgIs226(nhr-116::TY1 EGFP FLAG; unc119) outcross : 3 transgene : nhr-116 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-116::EGFP fusion protein is expressed in the correct nhr-116 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-116 transcription factor. made_by : M Sarov )|Snyder_NHR-116_GFP_L4_rep2_GFP_TGCT|L4	OP226(official name : ...	ChIP-Seq
SRX234922	SRA066563	Snyder_Pges-1_HPL-2_YL416_L1_rep1_Input_ACGT	Snyder_Pges-1_HPL-2_YL416_L1_rep1_Input_ACGT	Snyder_Pges-1_HPL-2_YL416_L1_rep1_Input_ACGT	Snyder_Pges-1_HPL-2_YL...	YL416(official name : YL416 genotype : unc-119(ed3) III; vrIs64pGES-1::HPL-2::GFP FLAG: HPL-2 3'-UTR genotype : unc-119 (+) outcross : 0 mutagen : None tags : GFP::3xFlag description : The HPL-2::GFP fusion protein is driven by the ges-1 promoter and is expressed in the intestine. made_by : Michelle Kudron in Reinke lab )|Snyder_Pges-1_HPL-2_YL416_L1_rep1_Input_ACGT|fed L1	YL416(official name : ...	ChIP-Seq
SRX234923	SRA066563	Snyder_Pges-1_HPL-2_YL416_L1_rep2_Input_ACGT	Snyder_Pges-1_HPL-2_YL416_L1_rep2_Input_ACGT	Snyder_Pges-1_HPL-2_YL416_L1_rep2_Input_ACGT	Snyder_Pges-1_HPL-2_YL...	YL416(official name : YL416 genotype : unc-119(ed3) III; vrIs64pGES-1::HPL-2::GFP FLAG: HPL-2 3'-UTR genotype : unc-119 (+) outcross : 0 mutagen : None tags : GFP::3xFlag description : The HPL-2::GFP fusion protein is driven by the ges-1 promoter and is expressed in the intestine. made_by : Michelle Kudron in Reinke lab )|Snyder_Pges-1_HPL-2_YL416_L1_rep2_Input_ACGT|fed L1	YL416(official name : ...	ChIP-Seq
SRX234924	SRA066563	Snyder_Pges-1_HPL-2_YL416_L1_rep1_GFP_ACGT	Snyder_Pges-1_HPL-2_YL416_L1_rep1_GFP_ACGT	Snyder_Pges-1_HPL-2_YL416_L1_rep1_GFP_ACGT	Snyder_Pges-1_HPL-2_YL...	YL416(official name : YL416 genotype : unc-119(ed3) III; vrIs64pGES-1::HPL-2::GFP FLAG: HPL-2 3'-UTR genotype : unc-119 (+) outcross : 0 mutagen : None tags : GFP::3xFlag description : The HPL-2::GFP fusion protein is driven by the ges-1 promoter and is expressed in the intestine. made_by : Michelle Kudron in Reinke lab )|Snyder_Pges-1_HPL-2_YL416_L1_rep1_GFP_ACGT|fed L1	YL416(official name : ...	ChIP-Seq
SRX234925	SRA066563	Snyder_Pges-1_HPL-2_YL416_L1_rep2_GFP_ACGT	Snyder_Pges-1_HPL-2_YL416_L1_rep2_GFP_ACGT	Snyder_Pges-1_HPL-2_YL416_L1_rep2_GFP_ACGT	Snyder_Pges-1_HPL-2_YL...	YL416(official name : YL416 genotype : unc-119(ed3) III; vrIs64pGES-1::HPL-2::GFP FLAG: HPL-2 3'-UTR genotype : unc-119 (+) outcross : 0 mutagen : None tags : GFP::3xFlag description : The HPL-2::GFP fusion protein is driven by the ges-1 promoter and is expressed in the intestine. made_by : Michelle Kudron in Reinke lab )|Snyder_Pges-1_HPL-2_YL416_L1_rep2_GFP_ACGT|fed L1	YL416(official name : ...	ChIP-Seq
SRX2350718	SRA494606	WT_early_rep1_ChIPseq_H3K9me3;_Caenorhabditis_elegans;_ChIP-Seq	WT_early_rep1_ChIPseq_H3K9me3;_Caenorhabditis_e...	Anti-Histone H3 (tri methyl K9)|Whole animal, young adult	Anti-Histone H3 (tri m...	N2|Whole animal, young adult	N2	ChIP-Seq
SRX2350719	SRA494606	WT_late_rep1_ChIPseq_H3K9me3;_Caenorhabditis_elegans;_ChIP-Seq	WT_late_rep1_ChIPseq_H3K9me3;_Caenorhabditis_el...	Anti-Histone H3 (tri methyl K9)|Whole animal, young adult	Anti-Histone H3 (tri m...	N2|Whole animal, young adult	N2	ChIP-Seq
SRX2350720	SRA494606	morc-1_early_rep1_ChIPseq_H3K9me3;_Caenorhabditis_elegans;_ChIP-Seq	morc-1_early_rep1_ChIPseq_H3K9me3;_Caenorhabdit...	Anti-Histone H3 (tri methyl K9)|Whole animal, young adult	Anti-Histone H3 (tri m...	morc-1(tm6048)|Whole animal, young adult	morc-1(tm6048)	ChIP-Seq
SRX2350721	SRA494606	morc-1_late_rep1_ChIPseq_H3K9me3;_Caenorhabditis_elegans;_ChIP-Seq	morc-1_late_rep1_ChIPseq_H3K9me3;_Caenorhabditi...	Anti-Histone H3 (tri methyl K9)|Whole animal, young adult	Anti-Histone H3 (tri m...	morc-1(tm6048)|Whole animal, young adult	morc-1(tm6048)	ChIP-Seq
SRX2350722	SRA494606	morc-1_late_rep2_ChIPseq_H3K9me3;_Caenorhabditis_elegans;_ChIP-Seq	morc-1_late_rep2_ChIPseq_H3K9me3;_Caenorhabditi...	Anti-Histone H3 (tri methyl K9)|Whole animal, young adult	Anti-Histone H3 (tri m...	morc-1(tm6048)|Whole animal, young adult	morc-1(tm6048)	ChIP-Seq
SRX2350723	SRA494606	hrde-1_early_rep1_ChIPseq_H3K9me3;_Caenorhabditis_elegans;_ChIP-Seq	hrde-1_early_rep1_ChIPseq_H3K9me3;_Caenorhabdit...	Anti-Histone H3 (tri methyl K9)|Whole animal, young adult	Anti-Histone H3 (tri m...	hrde-1(tm1200)|Whole animal, young adult	hrde-1(tm1200)	ChIP-Seq
SRX2350724	SRA494606	hrde-1_late_rep1_ChIPseq_H3K9me3;_Caenorhabditis_elegans;_ChIP-Seq	hrde-1_late_rep1_ChIPseq_H3K9me3;_Caenorhabditi...	Anti-Histone H3 (tri methyl K9)|Whole animal, young adult	Anti-Histone H3 (tri m...	hrde-1(tm1200)|Whole animal, young adult	hrde-1(tm1200)	ChIP-Seq
SRX2350725	SRA494606	hrde-1_late_rep2_ChIPseq_H3K9me3;_Caenorhabditis_elegans;_ChIP-Seq	hrde-1_late_rep2_ChIPseq_H3K9me3;_Caenorhabditi...	Anti-Histone H3 (tri methyl K9)|Whole animal, young adult	Anti-Histone H3 (tri m...	hrde-1(tm1200)|Whole animal, young adult	hrde-1(tm1200)	ChIP-Seq
SRX2350726	SRA494606	WT_early_rep1_ChIPseq_input;_Caenorhabditis_elegans;_ChIP-Seq	WT_early_rep1_ChIPseq_input;_Caenorhabditis_ele...	None|Whole animal, young adult	None	N2|Whole animal, young adult	N2	ChIP-Seq
SRX2350727	SRA494606	WT_late_rep1_ChIPseq_input;_Caenorhabditis_elegans;_ChIP-Seq	WT_late_rep1_ChIPseq_input;_Caenorhabditis_eleg...	None|Whole animal, young adult	None	N2|Whole animal, young adult	N2	ChIP-Seq
SRX2350728	SRA494606	morc-1_early_rep1_ChIPseq_input;_Caenorhabditis_elegans;_ChIP-Seq	morc-1_early_rep1_ChIPseq_input;_Caenorhabditis...	None|Whole animal, young adult	None	morc-1(tm6048)|Whole animal, young adult	morc-1(tm6048)	ChIP-Seq
SRX2350729	SRA494606	morc-1_late_rep1_ChIPseq_input;_Caenorhabditis_elegans;_ChIP-Seq	morc-1_late_rep1_ChIPseq_input;_Caenorhabditis_...	None|Whole animal, young adult	None	morc-1(tm6048)|Whole animal, young adult	morc-1(tm6048)	ChIP-Seq
SRX2350730	SRA494606	hrde-1_early_rep1_ChIPseq_input;_Caenorhabditis_elegans;_ChIP-Seq	hrde-1_early_rep1_ChIPseq_input;_Caenorhabditis...	None|Whole animal, young adult	None	hrde-1(tm1200)|Whole animal, young adult	hrde-1(tm1200)	ChIP-Seq
SRX2350731	SRA494606	hrde-1_late_rep1_ChIPseq_input;_Caenorhabditis_elegans;_ChIP-Seq	hrde-1_late_rep1_ChIPseq_input;_Caenorhabditis_...	None|Whole animal, young adult	None	hrde-1(tm1200)|Whole animal, young adult	hrde-1(tm1200)	ChIP-Seq
SRX2350732	SRA494606	met-1_early_rep1_ChIPseq_input;_Caenorhabditis_elegans;_ChIP-Seq	met-1_early_rep1_ChIPseq_input;_Caenorhabditis_...	None|Whole animal, young adult	None	met-1(xk4)|Whole animal, young adult	met-1(xk4)	ChIP-Seq
SRX2350733	SRA494606	met-1_late_rep1_ChIPseq_input;_Caenorhabditis_elegans;_ChIP-Seq	met-1_late_rep1_ChIPseq_input;_Caenorhabditis_e...	None|Whole animal, young adult	None	met-1(xk4)|Whole animal, young adult	met-1(xk4)	ChIP-Seq
SRX2350734	SRA494606	met-1_morc-1_early_rep1_ChIPseq_input;_Caenorhabditis_elegans;_ChIP-Seq	met-1_morc-1_early_rep1_ChIPseq_input;_Caenorha...	None|Whole animal, young adult	None	met-1(xk4); morc-1(tm6048)|Whole animal, young adult	met-1(xk4); morc-1(tm6...	ChIP-Seq
SRX2350735	SRA494606	met-1_morc-1_late_rep1_ChIPseq_input;_Caenorhabditis_elegans;_ChIP-Seq	met-1_morc-1_late_rep1_ChIPseq_input;_Caenorhab...	None|Whole animal, young adult	None	met-1(xk4); morc-1(tm6048)|Whole animal, young adult	met-1(xk4); morc-1(tm6...	ChIP-Seq
SRX2350736	SRA494606	met-1_hrde-1_early_rep1_ChIPseq_input;_Caenorhabditis_elegans;_ChIP-Seq	met-1_hrde-1_early_rep1_ChIPseq_input;_Caenorha...	None|Whole animal, young adult	None	met-1(xk4); hrde(tm1200)|Whole animal, young adult	met-1(xk4); hrde(tm1200)	ChIP-Seq
SRX2350737	SRA494606	met-1_hrde-1_late_rep1_ChIPseq_input;_Caenorhabditis_elegans;_ChIP-Seq	met-1_hrde-1_late_rep1_ChIPseq_input;_Caenorhab...	None|Whole animal, young adult	None	met-1(xk4); hrde(tm1200)|Whole animal, young adult	met-1(xk4); hrde(tm1200)	ChIP-Seq
SRX2350738	SRA494606	WT_early_rep1_ChIPseq_H3K36me3;_Caenorhabditis_elegans;_ChIP-Seq	WT_early_rep1_ChIPseq_H3K36me3;_Caenorhabditis_...	Anti-Histone H3 (tri methyl K36)|Whole animal, young adult	Anti-Histone H3 (tri m...	N2|Whole animal, young adult	N2	ChIP-Seq
SRX2350739	SRA494606	WT_late_rep1_ChIPseq_H3K36me3;_Caenorhabditis_elegans;_ChIP-Seq	WT_late_rep1_ChIPseq_H3K36me3;_Caenorhabditis_e...	Anti-Histone H3 (tri methyl K36)|Whole animal, young adult	Anti-Histone H3 (tri m...	N2|Whole animal, young adult	N2	ChIP-Seq
SRX2350740	SRA494606	WT_late_rep2_ChIPseq_H3K36me3;_Caenorhabditis_elegans;_ChIP-Seq	WT_late_rep2_ChIPseq_H3K36me3;_Caenorhabditis_e...	Anti-Histone H3 (tri methyl K36)|Whole animal, young adult	Anti-Histone H3 (tri m...	N2|Whole animal, young adult	N2	ChIP-Seq
SRX2350741	SRA494606	WT_late_rep3_ChIPseq_H3K36me3;_Caenorhabditis_elegans;_ChIP-Seq	WT_late_rep3_ChIPseq_H3K36me3;_Caenorhabditis_e...	Anti-Histone H3 (tri methyl K36)|Whole animal, young adult	Anti-Histone H3 (tri m...	N2|Whole animal, young adult	N2	ChIP-Seq
SRX2350742	SRA494606	morc-1_early_rep1_ChIPseq_H3K36me3;_Caenorhabditis_elegans;_ChIP-Seq	morc-1_early_rep1_ChIPseq_H3K36me3;_Caenorhabdi...	Anti-Histone H3 (tri methyl K36)|Whole animal, young adult	Anti-Histone H3 (tri m...	morc-1(tm6048)|Whole animal, young adult	morc-1(tm6048)	ChIP-Seq
SRX2350743	SRA494606	morc-1_late_rep1_ChIPseq_H3K36me3;_Caenorhabditis_elegans;_ChIP-Seq	morc-1_late_rep1_ChIPseq_H3K36me3;_Caenorhabdit...	Anti-Histone H3 (tri methyl K36)|Whole animal, young adult	Anti-Histone H3 (tri m...	morc-1(tm6048)|Whole animal, young adult	morc-1(tm6048)	ChIP-Seq
SRX2350744	SRA494606	morc-1_late_rep2_ChIPseq_H3K36me3;_Caenorhabditis_elegans;_ChIP-Seq	morc-1_late_rep2_ChIPseq_H3K36me3;_Caenorhabdit...	Anti-Histone H3 (tri methyl K36)|Whole animal, young adult	Anti-Histone H3 (tri m...	morc-1(tm6048)|Whole animal, young adult	morc-1(tm6048)	ChIP-Seq
SRX2350745	SRA494606	hrde-1_early_rep1_ChIPseq_H3K36me3;_Caenorhabditis_elegans;_ChIP-Seq	hrde-1_early_rep1_ChIPseq_H3K36me3;_Caenorhabdi...	Anti-Histone H3 (tri methyl K36)|Whole animal, young adult	Anti-Histone H3 (tri m...	hrde-1(tm1200)|Whole animal, young adult	hrde-1(tm1200)	ChIP-Seq
SRX2350746	SRA494606	hrde-1_late_rep1_ChIPseq_H3K36me3;_Caenorhabditis_elegans;_ChIP-Seq	hrde-1_late_rep1_ChIPseq_H3K36me3;_Caenorhabdit...	Anti-Histone H3 (tri methyl K36)|Whole animal, young adult	Anti-Histone H3 (tri m...	hrde-1(tm1200)|Whole animal, young adult	hrde-1(tm1200)	ChIP-Seq
SRX2350747	SRA494606	hrde-1_late_rep2_ChIPseq_H3K36me3;_Caenorhabditis_elegans;_ChIP-Seq	hrde-1_late_rep2_ChIPseq_H3K36me3;_Caenorhabdit...	Anti-Histone H3 (tri methyl K36)|Whole animal, young adult	Anti-Histone H3 (tri m...	hrde-1(tm1200)|Whole animal, young adult	hrde-1(tm1200)	ChIP-Seq
SRX2350748	SRA494606	met-1_early_rep1_ChIPseq_H3K36me3;_Caenorhabditis_elegans;_ChIP-Seq	met-1_early_rep1_ChIPseq_H3K36me3;_Caenorhabdit...	Anti-Histone H3 (tri methyl K36)|Whole animal, young adult	Anti-Histone H3 (tri m...	met-1(xk4)|Whole animal, young adult	met-1(xk4)	ChIP-Seq
SRX2350749	SRA494606	met-1_late_rep1_ChIPseq_H3K36me3;_Caenorhabditis_elegans;_ChIP-Seq	met-1_late_rep1_ChIPseq_H3K36me3;_Caenorhabditi...	Anti-Histone H3 (tri methyl K36)|Whole animal, young adult	Anti-Histone H3 (tri m...	met-1(xk4)|Whole animal, young adult	met-1(xk4)	ChIP-Seq
SRX2350750	SRA494606	met-1_late_rep2_ChIPseq_H3K36me3;_Caenorhabditis_elegans;_ChIP-Seq	met-1_late_rep2_ChIPseq_H3K36me3;_Caenorhabditi...	Anti-Histone H3 (tri methyl K36)|Whole animal, young adult	Anti-Histone H3 (tri m...	met-1(xk4)|Whole animal, young adult	met-1(xk4)	ChIP-Seq
SRX2350751	SRA494606	met-1_morc-1_early_rep1_ChIPseq_H3K36me3;_Caenorhabditis_elegans;_ChIP-Seq	met-1_morc-1_early_rep1_ChIPseq_H3K36me3;_Caeno...	Anti-Histone H3 (tri methyl K36)|Whole animal, young adult	Anti-Histone H3 (tri m...	met-1(xk4); morc-1(tm6048)|Whole animal, young adult	met-1(xk4); morc-1(tm6...	ChIP-Seq
SRX2350752	SRA494606	met-1_morc-1_late_rep1_ChIPseq_H3K36me3;_Caenorhabditis_elegans;_ChIP-Seq	met-1_morc-1_late_rep1_ChIPseq_H3K36me3;_Caenor...	Anti-Histone H3 (tri methyl K36)|Whole animal, young adult	Anti-Histone H3 (tri m...	met-1(xk4); morc-1(tm6048)|Whole animal, young adult	met-1(xk4); morc-1(tm6...	ChIP-Seq
SRX2350753	SRA494606	met-1_morc-1_late_rep2_ChIPseq_H3K36me3;_Caenorhabditis_elegans;_ChIP-Seq	met-1_morc-1_late_rep2_ChIPseq_H3K36me3;_Caenor...	Anti-Histone H3 (tri methyl K36)|Whole animal, young adult	Anti-Histone H3 (tri m...	met-1(xk4); morc-1(tm6048)|Whole animal, young adult	met-1(xk4); morc-1(tm6...	ChIP-Seq
SRX2350754	SRA494606	met-1_hrde-1_early_rep1_ChIPseq_H3K36me3;_Caenorhabditis_elegans;_ChIP-Seq	met-1_hrde-1_early_rep1_ChIPseq_H3K36me3;_Caeno...	Anti-Histone H3 (tri methyl K36)|Whole animal, young adult	Anti-Histone H3 (tri m...	met-1(xk4); hrde(tm1200)|Whole animal, young adult	met-1(xk4); hrde(tm1200)	ChIP-Seq
SRX2350755	SRA494606	met-1_hrde-1_late_rep1_ChIPseq_H3K36me3;_Caenorhabditis_elegans;_ChIP-Seq	met-1_hrde-1_late_rep1_ChIPseq_H3K36me3;_Caenor...	Anti-Histone H3 (tri methyl K36)|Whole animal, young adult	Anti-Histone H3 (tri m...	met-1(xk4); hrde(tm1200)|Whole animal, young adult	met-1(xk4); hrde(tm1200)	ChIP-Seq
SRX2350756	SRA494606	met-1_hrde-1_late_rep2_ChIPseq_H3K36me3;_Caenorhabditis_elegans;_ChIP-Seq	met-1_hrde-1_late_rep2_ChIPseq_H3K36me3;_Caenor...	Anti-Histone H3 (tri methyl K36)|Whole animal, young adult	Anti-Histone H3 (tri m...	met-1(xk4); hrde(tm1200)|Whole animal, young adult	met-1(xk4); hrde(tm1200)	ChIP-Seq
SRX235166	SRA066598	Snyder_LIN-35_GFP_yA_rep1_Input_TGCT	Snyder_LIN-35_GFP_yA_rep1_Input_TGCT	Snyder_LIN-35_GFP_yA_rep1_Input_TGCT	Snyder_LIN-35_GFP_yA_r...	YL402(official name : YL402 genotype : unc-119(ed3) III; vrIs56pPIE-1::LIN-35::GFP FLAG: LIN-35 3'-UTR genotype : unc-119 (+) outcross : 0 mutagen : None tags : GFP::3xFlag description : The LIN-35::GFP fusion protein is driven by the pie-1 promoter. made_by : Michelle Kudron in Reinke lab )|Snyder_LIN-35_GFP_yA_rep1_Input_TGCT|Young adult	YL402(official name : ...	ChIP-Seq
SRX235167	SRA066598	Snyder_LIN-35_GFP_yA_rep2_Input_TGCT	Snyder_LIN-35_GFP_yA_rep2_Input_TGCT	Snyder_LIN-35_GFP_yA_rep2_Input_TGCT	Snyder_LIN-35_GFP_yA_r...	YL402(official name : YL402 genotype : unc-119(ed3) III; vrIs56pPIE-1::LIN-35::GFP FLAG: LIN-35 3'-UTR genotype : unc-119 (+) outcross : 0 mutagen : None tags : GFP::3xFlag description : The LIN-35::GFP fusion protein is driven by the pie-1 promoter. made_by : Michelle Kudron in Reinke lab )|Snyder_LIN-35_GFP_yA_rep2_Input_TGCT|Young adult	YL402(official name : ...	ChIP-Seq
SRX235168	SRA066598	Snyder_LIN-35_GFP_yA_rep1_GFP_TGCT	Snyder_LIN-35_GFP_yA_rep1_GFP_TGCT	Snyder_LIN-35_GFP_yA_rep1_GFP_TGCT	Snyder_LIN-35_GFP_yA_r...	YL402(official name : YL402 genotype : unc-119(ed3) III; vrIs56pPIE-1::LIN-35::GFP FLAG: LIN-35 3'-UTR genotype : unc-119 (+) outcross : 0 mutagen : None tags : GFP::3xFlag description : The LIN-35::GFP fusion protein is driven by the pie-1 promoter. made_by : Michelle Kudron in Reinke lab )|Snyder_LIN-35_GFP_yA_rep1_GFP_TGCT|Young adult	YL402(official name : ...	ChIP-Seq
SRX235169	SRA066598	Snyder_LIN-35_GFP_yA_rep2_GFP_TGCT	Snyder_LIN-35_GFP_yA_rep2_GFP_TGCT	Snyder_LIN-35_GFP_yA_rep2_GFP_TGCT	Snyder_LIN-35_GFP_yA_r...	YL402(official name : YL402 genotype : unc-119(ed3) III; vrIs56pPIE-1::LIN-35::GFP FLAG: LIN-35 3'-UTR genotype : unc-119 (+) outcross : 0 mutagen : None tags : GFP::3xFlag description : The LIN-35::GFP fusion protein is driven by the pie-1 promoter. made_by : Michelle Kudron in Reinke lab )|Snyder_LIN-35_GFP_yA_rep2_GFP_TGCT|Young adult	YL402(official name : ...	ChIP-Seq
SRX235170	SRA066599	Snyder_SPTF-1_GFP_L1_rep1_Input_GTAT	Snyder_SPTF-1_GFP_L1_rep1_Input_GTAT	Snyder_SPTF-1_GFP_L1_rep1_Input_GTAT	Snyder_SPTF-1_GFP_L1_r...	OP196(official name : OP196 genotype : unc119(ed3); wgIs196(sptf1::TY1 EGFP FLAG C; unc119) outcross : 3 transgene : sptf-1 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The SPTF-1::EGFP fusion protein is expressed in the correct sptf-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the SPTF-1 transcription factor. made_by : S Kim )|Snyder_SPTF-1_GFP_L1_rep1_Input_GTAT|fed L1	OP196(official name : ...	ChIP-Seq
SRX235171	SRA066599	Snyder_SPTF-1_GFP_L1_rep2_Input_CATT	Snyder_SPTF-1_GFP_L1_rep2_Input_CATT	Snyder_SPTF-1_GFP_L1_rep2_Input_CATT	Snyder_SPTF-1_GFP_L1_r...	OP196(official name : OP196 genotype : unc119(ed3); wgIs196(sptf1::TY1 EGFP FLAG C; unc119) outcross : 3 transgene : sptf-1 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The SPTF-1::EGFP fusion protein is expressed in the correct sptf-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the SPTF-1 transcription factor. made_by : S Kim )|Snyder_SPTF-1_GFP_L1_rep2_Input_CATT|fed L1	OP196(official name : ...	ChIP-Seq
SRX235172	SRA066599	Snyder_SPTF-1_GFP_L1_rep1_GFP_GTAT	Snyder_SPTF-1_GFP_L1_rep1_GFP_GTAT	Snyder_SPTF-1_GFP_L1_rep1_GFP_GTAT	Snyder_SPTF-1_GFP_L1_r...	OP196(official name : OP196 genotype : unc119(ed3); wgIs196(sptf1::TY1 EGFP FLAG C; unc119) outcross : 3 transgene : sptf-1 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The SPTF-1::EGFP fusion protein is expressed in the correct sptf-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the SPTF-1 transcription factor. made_by : S Kim )|Snyder_SPTF-1_GFP_L1_rep1_GFP_GTAT|fed L1	OP196(official name : ...	ChIP-Seq
SRX235173	SRA066599	Snyder_SPTF-1_GFP_L1_rep2_GFP_CATT	Snyder_SPTF-1_GFP_L1_rep2_GFP_CATT	Snyder_SPTF-1_GFP_L1_rep2_GFP_CATT	Snyder_SPTF-1_GFP_L1_r...	OP196(official name : OP196 genotype : unc119(ed3); wgIs196(sptf1::TY1 EGFP FLAG C; unc119) outcross : 3 transgene : sptf-1 tags : Bombard tag : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The SPTF-1::EGFP fusion protein is expressed in the correct sptf-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the SPTF-1 transcription factor. made_by : S Kim )|Snyder_SPTF-1_GFP_L1_rep2_GFP_CATT|fed L1	OP196(official name : ...	ChIP-Seq
SRX2370184	SRA497800	H3K4me3_ChIPSeq_-_C;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_ChIPSeq_-_C;_Caenorhabditis_elegans;_Ch...	H3K4me3 (Abcam, catalog# ab8580, lot# 20700500)|nematode whole body	H3K4me3 (Abcam, catalo...	nematode whole body	nematode whole body	ChIP-Seq
SRX2370185	SRA497800	H3K4me3_ChIPSeq_-_F11;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_ChIPSeq_-_F11;_Caenorhabditis_elegans;_...	H3K4me3 (Abcam, catalog# ab8580, lot# 20700500)|nematode whole body	H3K4me3 (Abcam, catalo...	nematode whole body	nematode whole body	ChIP-Seq
SRX2370186	SRA497800	H3K4me3_ChIPSeq_-_F14';_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_ChIPSeq_-_F14';_Caenorhabditis_elegans;...	H3K4me3 (Abcam, catalog# ab8580, lot# 20700500)|nematode whole body	H3K4me3 (Abcam, catalo...	nematode whole body	nematode whole body	ChIP-Seq
SRX245912	SRA067811	NHR-25_ChIP_repA;_Caenorhabditis_elegans;_ChIP-Seq	NHR-25_ChIP_repA;_Caenorhabditis_elegans;_ChIP-Seq	anti-GFP (polyclonal goat IgG; produced in Hyman lab)|embryonic stage	anti-GFP (polyclonal g...	N2|embryonic stage|Fed L1	N2	ChIP-Seq
SRX245913	SRA067811	NHR-25_ChIP_repB;_Caenorhabditis_elegans;_ChIP-Seq	NHR-25_ChIP_repB;_Caenorhabditis_elegans;_ChIP-Seq	anti-GFP (polyclonal goat IgG; produced in Hyman lab)|embryonic stage	anti-GFP (polyclonal g...	N2|embryonic stage|Fed L1	N2	ChIP-Seq
SRX245914	SRA067811	NHR-25_ChIP_input_repA;_Caenorhabditis_elegans;_ChIP-Seq	NHR-25_ChIP_input_repA;_Caenorhabditis_elegans;...	anti-GFP (polyclonal goat IgG; produced in Hyman lab)|embryonic stage	anti-GFP (polyclonal g...	N2|embryonic stage|Fed L1	N2	ChIP-Seq
SRX245915	SRA067811	NHR-25_ChIP_input_repB;_Caenorhabditis_elegans;_ChIP-Seq	NHR-25_ChIP_input_repB;_Caenorhabditis_elegans;...	anti-GFP (polyclonal goat IgG; produced in Hyman lab)|embryonic stage	anti-GFP (polyclonal g...	N2|embryonic stage|Fed L1	N2	ChIP-Seq
SRX245916	SRA067811	PHA-4_ChIP_repA;_Caenorhabditis_elegans;_ChIP-Seq	PHA-4_ChIP_repA;_Caenorhabditis_elegans;_ChIP-Seq	anti-GFP (polyclonal goat IgG; produced in Hyman lab)|embryonic stage	anti-GFP (polyclonal g...	N2|embryonic stage|Fed L1	N2	ChIP-Seq
SRX245917	SRA067811	PHA-4_ChIP_input_repA;_Caenorhabditis_elegans;_ChIP-Seq	PHA-4_ChIP_input_repA;_Caenorhabditis_elegans;_...	anti-GFP (polyclonal goat IgG; produced in Hyman lab)|embryonic stage	anti-GFP (polyclonal g...	N2|embryonic stage|Fed L1	N2	ChIP-Seq
SRX246024	SRA067900	WT_CenH3_10min_(20110706_8);_Caenorhabditis_elegans;_ChIP-Seq	WT_CenH3_10min_(20110706_8);_Caenorhabditis_ele...	cenH3|ChIPed chromatin	cenH3	ChIPed chromatin|embryo	ChIPed chromatin	ChIP-Seq
SRX246025	SRA067900	WT_CenH3_1min_(20110706_5);_Caenorhabditis_elegans;_ChIP-Seq	WT_CenH3_1min_(20110706_5);_Caenorhabditis_eleg...	cenH3|ChIPed chromatin	cenH3	ChIPed chromatin|embryo	ChIPed chromatin	ChIP-Seq
SRX246026	SRA067900	WT_CenH3_2min_rep1_(20110706_6);_Caenorhabditis_elegans;_ChIP-Seq	WT_CenH3_2min_rep1_(20110706_6);_Caenorhabditis...	cenH3|ChIPed chromatin	cenH3	ChIPed chromatin|embryo	ChIPed chromatin	ChIP-Seq
SRX246027	SRA067900	WT_CenH3_2min_rep2_(20111011_3);_Caenorhabditis_elegans;_ChIP-Seq	WT_CenH3_2min_rep2_(20111011_3);_Caenorhabditis...	cenH3|ChIPed chromatin	cenH3	ChIPed chromatin|embryo	ChIPed chromatin	ChIP-Seq
SRX246028	SRA067900	WT_CenH3_5min_(20110706_7);_Caenorhabditis_elegans;_ChIP-Seq	WT_CenH3_5min_(20110706_7);_Caenorhabditis_eleg...	cenH3|ChIPed chromatin	cenH3	ChIPed chromatin|embryo	ChIPed chromatin	ChIP-Seq
SRX246029	SRA067900	WT_HCP4_FCL_(20120817_3_4);_Caenorhabditis_elegans;_ChIP-Seq	WT_HCP4_FCL_(20120817_3_4);_Caenorhabditis_eleg...	CENP-C|crosslinked ChIPed chromatin	CENP-C	crosslinked ChIPed chromatin|embryo	crosslinked ChIPed chr...	ChIP-Seq
SRX246038	SRA067900	knl2_CenH3_(20120223_3);_Caenorhabditis_elegans;_ChIP-Seq	knl2_CenH3_(20120223_3);_Caenorhabditis_elegans...	cenH3|ChIPed chromatin	cenH3	ChIPed chromatin|embryo	ChIPed chromatin	ChIP-Seq
SRX2543050	SRA536213	H3K4me1_ChIP-Seq_N2;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me1_ChIP-Seq_N2;_Caenorhabditis_elegans;_Ch...	late C. elegans embryos N2	late C. elegans embryo...	late C. elegans embryos N2|whole embryo	late C. elegans embryo...	ChIP-Seq
SRX2543051	SRA536213	H3K4me2_ChIP-Seq_N2;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me2_ChIP-Seq_N2;_Caenorhabditis_elegans;_Ch...	late C. elegans embryos N2	late C. elegans embryo...	late C. elegans embryos N2|whole embryo	late C. elegans embryo...	ChIP-Seq
SRX2543052	SRA536213	H3K4me3_ChIP-Seq_N2;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_ChIP-Seq_N2;_Caenorhabditis_elegans;_Ch...	late C. elegans embryos N2	late C. elegans embryo...	late C. elegans embryos N2|whole embryo	late C. elegans embryo...	ChIP-Seq
SRX2543053	SRA536213	input_DNA_N2;_Caenorhabditis_elegans;_ChIP-Seq	input_DNA_N2;_Caenorhabditis_elegans;_ChIP-Seq	late C. elegans embryos N2	late C. elegans embryo...	late C. elegans embryos N2|whole embryo	late C. elegans embryo...	ChIP-Seq
SRX2543054	SRA536213	H3K4me1_ChIP-Seq_wdr-5(-);_Caenorhabditis_elegans;_ChIP-Seq	H3K4me1_ChIP-Seq_wdr-5(-);_Caenorhabditis_elega...	late C. elegans embryos wdr-5(-)	late C. elegans embryo...	late C. elegans embryos wdr-5(-)|whole embryo	late C. elegans embryo...	ChIP-Seq
SRX2543055	SRA536213	H3K4me2_ChIP-Seq_wdr-5(-);_Caenorhabditis_elegans;_ChIP-Seq	H3K4me2_ChIP-Seq_wdr-5(-);_Caenorhabditis_elega...	late C. elegans embryos wdr-5(-)	late C. elegans embryo...	late C. elegans embryos wdr-5(-)|whole embryo	late C. elegans embryo...	ChIP-Seq
SRX2543056	SRA536213	H3K4me3_ChIP-Seq_wdr-5(-);_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_ChIP-Seq_wdr-5(-);_Caenorhabditis_elega...	late C. elegans embryos wdr-5(-)	late C. elegans embryo...	late C. elegans embryos wdr-5(-)|whole embryo	late C. elegans embryo...	ChIP-Seq
SRX2543057	SRA536213	input_DNA_wdr-5(-);_Caenorhabditis_elegans;_ChIP-Seq	input_DNA_wdr-5(-);_Caenorhabditis_elegans;_ChI...	late C. elegans embryos wdr-5(-)	late C. elegans embryo...	late C. elegans embryos wdr-5(-)|whole embryo	late C. elegans embryo...	ChIP-Seq
SRX2543058	SRA536213	H3K4me1_ChIP-Seq_rbbp-5(-);_Caenorhabditis_elegans;_ChIP-Seq	H3K4me1_ChIP-Seq_rbbp-5(-);_Caenorhabditis_eleg...	late C. elegans embryos rbbp-5(-)	late C. elegans embryo...	late C. elegans embryos rbbp-5(-)|whole embryo	late C. elegans embryo...	ChIP-Seq
SRX2543059	SRA536213	H3K4me2_ChIP-Seq_rbbp-5(-);_Caenorhabditis_elegans;_ChIP-Seq	H3K4me2_ChIP-Seq_rbbp-5(-);_Caenorhabditis_eleg...	late C. elegans embryos rbbp-5(-)	late C. elegans embryo...	late C. elegans embryos rbbp-5(-)|whole embryo	late C. elegans embryo...	ChIP-Seq
SRX2543060	SRA536213	H3K4me3_ChIP-Seq_rbbp-5(-);_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_ChIP-Seq_rbbp-5(-);_Caenorhabditis_eleg...	late C. elegans embryos rbbp-5(-)	late C. elegans embryo...	late C. elegans embryos rbbp-5(-)|whole embryo	late C. elegans embryo...	ChIP-Seq
SRX2543061	SRA536213	input_DNA_rbbp-5(-);_Caenorhabditis_elegans;_ChIP-Seq	input_DNA_rbbp-5(-);_Caenorhabditis_elegans;_Ch...	late C. elegans embryos rbbp-5(-)	late C. elegans embryo...	late C. elegans embryos rbbp-5(-)|whole embryo	late C. elegans embryo...	ChIP-Seq
SRX257640	SRA072292	AMA1_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	AMA1_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP...	AMA1 Q2358 Rabbit polyclonal is against the antigen DLVLDVEKCKYGMEIPQNVVMGGGFYGSFAGSPSNREFSPAHSPWNSGVTPTYAGAAWSPTTGGMSPGAGFSPAGNTDGGASPFNEGGWSPASPGDPLGA May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	AMA1 Q2358 Rabbit poly...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257641	SRA072292	AMA1_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	AMA1_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP...	AMA1 Q2357 Rabbit polyclonal is against the antigen DLVLDVEKCKYGMEIPQNVVMGGGFYGSFAGSPSNREFSPAHSPWNSGVTPTYAGAAWSPTTGGMSPGAGFSPAGNTDGGASPFNEGGWSPASPGDPLGA May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	AMA1 Q2357 Rabbit poly...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257642	SRA072292	CAPG1_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	CAPG1_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChI...	CAPG-1 SDQ3967 Rabbit polyclonal is against the antigen MPPKKRIRGPKLPALREEKSTGTDVASDESFNESADFLNNEELNNDQNDAENTVLSEGVSTLRINENMTKEDRACISAALFIKKRVVESIRTVFQSRDDI May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	CAPG-1 SDQ3967 Rabbit ...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257643	SRA072292	CAPG1_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	CAPG1_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChI...	CAPG-1 SDQ3967 Rabbit polyclonal is against the antigen MPPKKRIRGPKLPALREEKSTGTDVASDESFNESADFLNNEELNNDQNDAENTVLSEGVSTLRINENMTKEDRACISAALFIKKRVVESIRTVFQSRDDI May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	CAPG-1 SDQ3967 Rabbit ...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257644	SRA072292	CAPG1_Rep3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	CAPG1_Rep3_ChIPSeq;_Caenorhabditis_elegans;_ChI...	CAPG-1 SDQ3990 Rabbit polyclonal is against the antigen MPPKKRIRGPKLPALREEKSTGTDVASDESFNESADFLNNEELNNDQNDAENTVLSEGVSTLRINENMTKEDRACISAALFIKKRVVESIRTVFQSRDDI May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	CAPG-1 SDQ3990 Rabbit ...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257645	SRA072292	CAPG2_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	CAPG2_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChI...	CAPG-2 SDQ4484 Rabbit polyclonal to 808-907 aa is against the antigen IPKWMNKQCDLMEDDEENIFKNHREIVESLRQFHKRVSETDYWDEDSAKRMMHHFMLFSIVSASSKNDDEAYDDPRDEDYKPPHFISLALIKFILKEKSL May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	CAPG-2 SDQ4484 Rabbit ...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257646	SRA072292	CAPG2_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	CAPG2_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChI...	CAPG-2 SDQ4484 Rabbit polyclonal to 808-907 aa is against the antigen IPKWMNKQCDLMEDDEENIFKNHREIVESLRQFHKRVSETDYWDEDSAKRMMHHFMLFSIVSASSKNDDEAYDDPRDEDYKPPHFISLALIKFILKEKSL May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	CAPG-2 SDQ4484 Rabbit ...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257647	SRA072292	CAPG2_Rep3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	CAPG2_Rep3_ChIPSeq;_Caenorhabditis_elegans;_ChI...	CAPG-2 SDQ4567 Rabbit polyclonal to 808-907 aa is against the antigen IPKWMNKQCDLMEDDEENIFKNHREIVESLRQFHKRVSETDYWDEDSAKRMMHHFMLFSIVSASSKNDDEAYDDPRDEDYKPPHFISLALIKFILKEKSL May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	CAPG-2 SDQ4567 Rabbit ...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257648	SRA072292	CAPG2_Rep4_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	CAPG2_Rep4_ChIPSeq;_Caenorhabditis_elegans;_ChI...	CAPG-2 SDQ4567 Rabbit polyclonal to 808-907 aa is against the antigen IPKWMNKQCDLMEDDEENIFKNHREIVESLRQFHKRVSETDYWDEDSAKRMMHHFMLFSIVSASSKNDDEAYDDPRDEDYKPPHFISLALIKFILKEKSL May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	CAPG-2 SDQ4567 Rabbit ...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257649	SRA072292	CAPG2_Rep5_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	CAPG2_Rep5_ChIPSeq;_Caenorhabditis_elegans;_ChI...	CAPG-2 SDQ4484 Rabbit polyclonal to 808-907 aa is against the antigen IPKWMNKQCDLMEDDEENIFKNHREIVESLRQFHKRVSETDYWDEDSAKRMMHHFMLFSIVSASSKNDDEAYDDPRDEDYKPPHFISLALIKFILKEKSL May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	CAPG-2 SDQ4484 Rabbit ...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257650	SRA072292	DPY26_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	DPY26_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChI...	DPY-26 JL00003 Rabbit polyclonal to 40-1262 aa. (PMID:19853451) is against the antigen 40-1262 aa|whole worms	DPY-26 JL00003 Rabbit ...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257651	SRA072292	DPY26_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	DPY26_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChI...	DPY-26 SDQ4496 Rabbit polyclonal is against the antigen RVDRLHHDVRQIDSALSSGTVMRDSNGEEIHLTLESRKAKKKMAVVDGMNGMLDFLNNMDDALTTTELDADNDKNWKEDEENIAGEPRIDFKANSKDVDA May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	DPY-26 SDQ4496 Rabbit ...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257652	SRA072292	DPY26_Rep3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	DPY26_Rep3_ChIPSeq;_Caenorhabditis_elegans;_ChI...	DPY-26 SDQ4496 Rabbit polyclonal is against the antigen RVDRLHHDVRQIDSALSSGTVMRDSNGEEIHLTLESRKAKKKMAVVDGMNGMLDFLNNMDDALTTTELDADNDKNWKEDEENIAGEPRIDFKANSKDVDA May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	DPY-26 SDQ4496 Rabbit ...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257653	SRA072292	DPY26_Rep4_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	DPY26_Rep4_ChIPSeq;_Caenorhabditis_elegans;_ChI...	DPY-26 SDQ4561 Rabbit polyclonal is against the antigen RVDRLHHDVRQIDSALSSGTVMRDSNGEEIHLTLESRKAKKKMAVVDGMNGMLDFLNNMDDALTTTELDADNDKNWKEDEENIAGEPRIDFKANSKDVDA May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	DPY-26 SDQ4561 Rabbit ...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257654	SRA072292	DPY26_Rep5_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	DPY26_Rep5_ChIPSeq;_Caenorhabditis_elegans;_ChI...	DPY-26 SDQ4561 Rabbit polyclonal is against the antigen RVDRLHHDVRQIDSALSSGTVMRDSNGEEIHLTLESRKAKKKMAVVDGMNGMLDFLNNMDDALTTTELDADNDKNWKEDEENIAGEPRIDFKANSKDVDA May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	DPY-26 SDQ4561 Rabbit ...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257655	SRA072292	DPY26_TY1072_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	DPY26_TY1072_Rep1_ChIPSeq;_Caenorhabditis_elega...	DPY-26 JL00003 Rabbit polyclonal to 40-1262 aa. (PMID:19853451) is against the antigen 40-1262 aa|whole worms	DPY-26 JL00003 Rabbit ...	TY1072|whole worms|embryo	TY1072	ChIP-Seq
SRX257656	SRA072292	DPY26_TY1072_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	DPY26_TY1072_Rep2_ChIPSeq;_Caenorhabditis_elega...	DPY-26 JL00003 Rabbit polyclonal to 40-1262 aa. (PMID:19853451) is against the antigen 40-1262 aa|whole worms	DPY-26 JL00003 Rabbit ...	TY1072|whole worms|embryo	TY1072	ChIP-Seq
SRX257657	SRA072292	DPY27_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	DPY27_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChI...	DPY-27 JL00001 Rabbit polyclonal to 1-409 aa. (Ercan et al. Nat Genet. 2007) is against the antigen 1-409 aa|whole worms	DPY-27 JL00001 Rabbit ...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257658	SRA072292	DPY27_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	DPY27_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChI...	DPY-27 JL00001 Rabbit polyclonal to 1-409 aa. (Ercan et al. Nat Genet. 2007) is against the antigen 1-409 aa|whole worms	DPY-27 JL00001 Rabbit ...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257659	SRA072292	DPY27_Rep3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	DPY27_Rep3_ChIPSeq;_Caenorhabditis_elegans;_ChI...	DPY-27 JL00001 Rabbit polyclonal to 1-409 aa. (Ercan et al. Nat Genet. 2007) is against the antigen 1-409 aa|whole worms	DPY-27 JL00001 Rabbit ...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257660	SRA072292	DPY27_Rep4_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	DPY27_Rep4_ChIPSeq;_Caenorhabditis_elegans;_ChI...	DPY-27 SDQ3995 Rabbit polyclonal is against the antigen LSNGLSNVVIAPKRKQRRLEMLKLSDFGLDDDSDLPEFNRFPPATRRELSVEDSDEDDEPVRRRPRRQVEEEDEEDELIEEATPSPPPIVVQRRVRRSRH May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	DPY-27 SDQ3995 Rabbit ...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257661	SRA072292	DPY28_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	DPY28_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChI...	DPY-28 SDQ4564 Rabbit polyclonal is against the antigen QQQPTRNNDGLSGFKSITEIIAEADNNIPSEQIDKDIDSFSSYSDISDWRGIPKFFPSLSSLSRRASTYENWENRFKVVDYLVSCSGALKDSVSDYVADY May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	DPY-28 SDQ4564 Rabbit ...	N2|whole worms|embryo	N2	ChIP-Seq
SRX2576620	SRA539027	DPL-1_ChIP-seq_in_wild-type_late_embryos,_rep_1b;_Caenorhabditis_elegans;_ChIP-Seq	DPL-1_ChIP-seq_in_wild-type_late_embryos,_rep_1...	SDIX/Novus Biologicals Q3599|DPL-1 ChIP-seq in wild-type late embryos	SDIX/Novus Biologicals...	DPL-1 ChIP-seq in wild-type late embryos|late embryo	DPL-1 ChIP-seq in wild...	ChIP-Seq
SRX2576621	SRA539027	DPL-1_ChIP-seq_in_wild-type_late_embryos,_rep_2a;_Caenorhabditis_elegans;_ChIP-Seq	DPL-1_ChIP-seq_in_wild-type_late_embryos,_rep_2...	SDIX/Novus Biologicals Q3599|DPL-1 ChIP-seq in wild-type late embryos	SDIX/Novus Biologicals...	DPL-1 ChIP-seq in wild-type late embryos|late embryo	DPL-1 ChIP-seq in wild...	ChIP-Seq
SRX2576622	SRA539027	DPL-1_ChIP-seq_in_wild-type_late_embryos,_rep_3;_Caenorhabditis_elegans;_ChIP-Seq	DPL-1_ChIP-seq_in_wild-type_late_embryos,_rep_3...	SDIX/Novus Biologicals Q3599|DPL-1 ChIP-seq in wild-type late embryos	SDIX/Novus Biologicals...	DPL-1 ChIP-seq in wild-type late embryos|late embryo	DPL-1 ChIP-seq in wild...	ChIP-Seq
SRX2576623	SRA539027	DPL-1_ChIP-seq_in_lin-35(n745)_late_embryos,_rep_1;_Caenorhabditis_elegans;_ChIP-Seq	DPL-1_ChIP-seq_in_lin-35(n745)_late_embryos,_re...	SDIX/Novus Biologicals Q3599|DPL-1 ChIP-seq in lin-35(n745) late embryos	SDIX/Novus Biologicals...	DPL-1 ChIP-seq in lin-35(n745) late embryos|late embryo	DPL-1 ChIP-seq in lin-...	ChIP-Seq
SRX2576624	SRA539027	DPL-1_ChIP-seq_in_lin-35(n745)_late_embryos,_rep_2;_Caenorhabditis_elegans;_ChIP-Seq	DPL-1_ChIP-seq_in_lin-35(n745)_late_embryos,_re...	SDIX/Novus Biologicals Q3599|DPL-1 ChIP-seq in lin-35(n745) late embryos	SDIX/Novus Biologicals...	DPL-1 ChIP-seq in lin-35(n745) late embryos|late embryo	DPL-1 ChIP-seq in lin-...	ChIP-Seq
SRX2576625	SRA539027	DPL-1_ChIP-seq_in_lin-35(n745)_late_embryos,_rep_3;_Caenorhabditis_elegans;_ChIP-Seq	DPL-1_ChIP-seq_in_lin-35(n745)_late_embryos,_re...	SDIX/Novus Biologicals Q3599|DPL-1 ChIP-seq in lin-35(n745) late embryos	SDIX/Novus Biologicals...	DPL-1 ChIP-seq in lin-35(n745) late embryos|late embryo	DPL-1 ChIP-seq in lin-...	ChIP-Seq
SRX2576626	SRA539027	EFL-1_ChIP-seq_in_wild-type_late_embryos,_rep_1b;_Caenorhabditis_elegans;_ChIP-Seq	EFL-1_ChIP-seq_in_wild-type_late_embryos,_rep_1...	SDIX/Novus Biologicals Q3590|EFL-1 ChIP-seq in wild-type late embryos	SDIX/Novus Biologicals...	EFL-1 ChIP-seq in wild-type late embryos|late embryo	EFL-1 ChIP-seq in wild...	ChIP-Seq
SRX2576627	SRA539027	EFL-1_ChIP-seq_in_wild-type_late_embryos,_rep_2b;_Caenorhabditis_elegans;_ChIP-Seq	EFL-1_ChIP-seq_in_wild-type_late_embryos,_rep_2...	SDIX/Novus Biologicals Q3590|EFL-1 ChIP-seq in wild-type late embryos	SDIX/Novus Biologicals...	EFL-1 ChIP-seq in wild-type late embryos|late embryo	EFL-1 ChIP-seq in wild...	ChIP-Seq
SRX2576628	SRA539027	EFL-1_ChIP-seq_in_wild-type_late_embryos,_rep_3;_Caenorhabditis_elegans;_ChIP-Seq	EFL-1_ChIP-seq_in_wild-type_late_embryos,_rep_3...	SDIX/Novus Biologicals Q3590|EFL-1 ChIP-seq in wild-type late embryos	SDIX/Novus Biologicals...	EFL-1 ChIP-seq in wild-type late embryos|late embryo	EFL-1 ChIP-seq in wild...	ChIP-Seq
SRX2576629	SRA539027	EFL-1_ChIP-seq_in_lin-35(n745)_late_embryos,_rep_1;_Caenorhabditis_elegans;_ChIP-Seq	EFL-1_ChIP-seq_in_lin-35(n745)_late_embryos,_re...	SDIX/Novus Biologicals Q3590|EFL-1 ChIP-seq in lin-35(n745) late embryos	SDIX/Novus Biologicals...	EFL-1 ChIP-seq in lin-35(n745) late embryos|late embryo	EFL-1 ChIP-seq in lin-...	ChIP-Seq
SRX257662	SRA072292	DPY28_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	DPY28_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChI...	DPY-28 SDQ4564 Rabbit polyclonal is against the antigen QQQPTRNNDGLSGFKSITEIIAEADNNIPSEQIDKDIDSFSSYSDISDWRGIPKFFPSLSSLSRRASTYENWENRFKVVDYLVSCSGALKDSVSDYVADY May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	DPY-28 SDQ4564 Rabbit ...	N2|whole worms|embryo	N2	ChIP-Seq
SRX2576630	SRA539027	EFL-1_ChIP-seq_in_lin-35(n745)_late_embryos,_rep_2;_Caenorhabditis_elegans;_ChIP-Seq	EFL-1_ChIP-seq_in_lin-35(n745)_late_embryos,_re...	SDIX/Novus Biologicals Q3590|EFL-1 ChIP-seq in lin-35(n745) late embryos	SDIX/Novus Biologicals...	EFL-1 ChIP-seq in lin-35(n745) late embryos|late embryo	EFL-1 ChIP-seq in lin-...	ChIP-Seq
SRX2576631	SRA539027	EFL-1_ChIP-seq_in_lin-35(n745)_late_embryos,_rep_3;_Caenorhabditis_elegans;_ChIP-Seq	EFL-1_ChIP-seq_in_lin-35(n745)_late_embryos,_re...	SDIX/Novus Biologicals Q3590|EFL-1 ChIP-seq in lin-35(n745) late embryos	SDIX/Novus Biologicals...	EFL-1 ChIP-seq in lin-35(n745) late embryos|late embryo	EFL-1 ChIP-seq in lin-...	ChIP-Seq
SRX2576632	SRA539027	LIN-35_ChIP-seq_in_wild-type_late_embryos,_rep_1a;_Caenorhabditis_elegans;_ChIP-Seq	LIN-35_ChIP-seq_in_wild-type_late_embryos,_rep_...	SDIX/Novus Biologicals Q2003|LIN-35 ChIP-seq in wild-type late embryos	SDIX/Novus Biologicals...	LIN-35 ChIP-seq in wild-type late embryos|late embryo	LIN-35 ChIP-seq in wil...	ChIP-Seq
SRX2576633	SRA539027	LIN-35_ChIP-seq_in_wild-type_late_embryos,_rep_2a;_Caenorhabditis_elegans;_ChIP-Seq	LIN-35_ChIP-seq_in_wild-type_late_embryos,_rep_...	SDIX/Novus Biologicals Q2003|LIN-35 ChIP-seq in wild-type late embryos	SDIX/Novus Biologicals...	LIN-35 ChIP-seq in wild-type late embryos|late embryo	LIN-35 ChIP-seq in wil...	ChIP-Seq
SRX2576634	SRA539027	LIN-35_ChIP-seq_in_lin-35(n745)_late_embryos,_rep_1;_Caenorhabditis_elegans;_ChIP-Seq	LIN-35_ChIP-seq_in_lin-35(n745)_late_embryos,_r...	SDIX/Novus Biologicals Q2003|LIN-35 ChIP-seq in lin-35(n745) late embryos	SDIX/Novus Biologicals...	LIN-35 ChIP-seq in lin-35(n745) late embryos|late embryo	LIN-35 ChIP-seq in lin...	ChIP-Seq
SRX2576635	SRA539027	LIN-35_ChIP-seq_in_lin-35(n745)_late_embryos,_rep_2;_Caenorhabditis_elegans;_ChIP-Seq	LIN-35_ChIP-seq_in_lin-35(n745)_late_embryos,_r...	SDIX/Novus Biologicals Q2003|LIN-35 ChIP-seq in lin-35(n745) late embryos	SDIX/Novus Biologicals...	LIN-35 ChIP-seq in lin-35(n745) late embryos|late embryo	LIN-35 ChIP-seq in lin...	ChIP-Seq
SRX2576636	SRA539027	LIN-9_ChIP-seq_in_wild-type_late_embryos,_rep_1a;_Caenorhabditis_elegans;_ChIP-Seq	LIN-9_ChIP-seq_in_wild-type_late_embryos,_rep_1...	Horvitz lab BH0005 (Harrison et al. 2006)|LIN-9 ChIP-seq in wild-type late embryos	Horvitz lab BH0005 (Ha...	LIN-9 ChIP-seq in wild-type late embryos|late embryo	LIN-9 ChIP-seq in wild...	ChIP-Seq
SRX2576637	SRA539027	LIN-9_ChIP-seq_in_wild-type_late_embryos,_rep_2a;_Caenorhabditis_elegans;_ChIP-Seq	LIN-9_ChIP-seq_in_wild-type_late_embryos,_rep_2...	Horvitz lab BH0005 (Harrison et al. 2006)|LIN-9 ChIP-seq in wild-type late embryos	Horvitz lab BH0005 (Ha...	LIN-9 ChIP-seq in wild-type late embryos|late embryo	LIN-9 ChIP-seq in wild...	ChIP-Seq
SRX2576638	SRA539027	LIN-9_ChIP-seq_in_wild-type_late_embryos,_rep_3;_Caenorhabditis_elegans;_ChIP-Seq	LIN-9_ChIP-seq_in_wild-type_late_embryos,_rep_3...	Horvitz lab BH0005 (Harrison et al. 2006)|LIN-9 ChIP-seq in wild-type late embryos	Horvitz lab BH0005 (Ha...	LIN-9 ChIP-seq in wild-type late embryos|late embryo	LIN-9 ChIP-seq in wild...	ChIP-Seq
SRX2576639	SRA539027	LIN-9_ChIP-seq_in_lin-35(n745)_late_embryos,_rep_1;_Caenorhabditis_elegans;_ChIP-Seq	LIN-9_ChIP-seq_in_lin-35(n745)_late_embryos,_re...	Horvitz lab BH0005 (Harrison et al. 2006)|LIN-9 ChIP-seq in lin-35(n745) late embryos	Horvitz lab BH0005 (Ha...	LIN-9 ChIP-seq in lin-35(n745) late embryos|late embryo	LIN-9 ChIP-seq in lin-...	ChIP-Seq
SRX257663	SRA072292	DPY28_Rep3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	DPY28_Rep3_ChIPSeq;_Caenorhabditis_elegans;_ChI...	DPY-28 SDQ4564 Rabbit polyclonal is against the antigen QQQPTRNNDGLSGFKSITEIIAEADNNIPSEQIDKDIDSFSSYSDISDWRGIPKFFPSLSSLSRRASTYENWENRFKVVDYLVSCSGALKDSVSDYVADY May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	DPY-28 SDQ4564 Rabbit ...	N2|whole worms|embryo	N2	ChIP-Seq
SRX2576640	SRA539027	LIN-9_ChIP-seq_in_lin-35(n745)_late_embryos,_rep_2;_Caenorhabditis_elegans;_ChIP-Seq	LIN-9_ChIP-seq_in_lin-35(n745)_late_embryos,_re...	Horvitz lab BH0005 (Harrison et al. 2006)|LIN-9 ChIP-seq in lin-35(n745) late embryos	Horvitz lab BH0005 (Ha...	LIN-9 ChIP-seq in lin-35(n745) late embryos|late embryo	LIN-9 ChIP-seq in lin-...	ChIP-Seq
SRX2576641	SRA539027	LIN-9_ChIP-seq_in_lin-35(n745)_late_embryos,_rep_3;_Caenorhabditis_elegans;_ChIP-Seq	LIN-9_ChIP-seq_in_lin-35(n745)_late_embryos,_re...	Horvitz lab BH0005 (Harrison et al. 2006)|LIN-9 ChIP-seq in lin-35(n745) late embryos	Horvitz lab BH0005 (Ha...	LIN-9 ChIP-seq in lin-35(n745) late embryos|late embryo	LIN-9 ChIP-seq in lin-...	ChIP-Seq
SRX2576642	SRA539027	LIN-37_ChIP-seq_in_wild-type_late_embryos,_rep_3;_Caenorhabditis_elegans;_ChIP-Seq	LIN-37_ChIP-seq_in_wild-type_late_embryos,_rep_...	SDIX/Novus Biologicals Q3166|LIN-37 ChIP-seq in wild-type late embryos	SDIX/Novus Biologicals...	LIN-37 ChIP-seq in wild-type late embryos|late embryo	LIN-37 ChIP-seq in wil...	ChIP-Seq
SRX2576643	SRA539027	LIN-37_ChIP-seq_in_lin-35(n745)_late_embryos,_rep_1;_Caenorhabditis_elegans;_ChIP-Seq	LIN-37_ChIP-seq_in_lin-35(n745)_late_embryos,_r...	SDIX/Novus Biologicals Q3166|LIN-37 ChIP-seq in lin-35(n745) late embryos	SDIX/Novus Biologicals...	LIN-37 ChIP-seq in lin-35(n745) late embryos|late embryo	LIN-37 ChIP-seq in lin...	ChIP-Seq
SRX2576644	SRA539027	LIN-37_ChIP-seq_in_lin-35(n745)_late_embryos,_rep_2;_Caenorhabditis_elegans;_ChIP-Seq	LIN-37_ChIP-seq_in_lin-35(n745)_late_embryos,_r...	SDIX/Novus Biologicals Q3166|LIN-37 ChIP-seq in lin-35(n745) late embryos	SDIX/Novus Biologicals...	LIN-37 ChIP-seq in lin-35(n745) late embryos|late embryo	LIN-37 ChIP-seq in lin...	ChIP-Seq
SRX2576645	SRA539027	LIN-37_ChIP-seq_in_lin-35(n745)_late_embryos,_rep_3;_Caenorhabditis_elegans;_ChIP-Seq	LIN-37_ChIP-seq_in_lin-35(n745)_late_embryos,_r...	SDIX/Novus Biologicals Q3166|LIN-37 ChIP-seq in lin-35(n745) late embryos	SDIX/Novus Biologicals...	LIN-37 ChIP-seq in lin-35(n745) late embryos|late embryo	LIN-37 ChIP-seq in lin...	ChIP-Seq
SRX2576646	SRA539027	LIN-52_ChIP-seq_in_wild-type_late_embryos,_rep_1b;_Caenorhabditis_elegans;_ChIP-Seq	LIN-52_ChIP-seq_in_wild-type_late_embryos,_rep_...	Horvitz lab BH0001 (Harrison et al. 2006)|LIN-52 ChIP-seq in wild-type late embryos	Horvitz lab BH0001 (Ha...	LIN-52 ChIP-seq in wild-type late embryos|late embryo	LIN-52 ChIP-seq in wil...	ChIP-Seq
SRX2576647	SRA539027	LIN-52_ChIP-seq_in_wild-type_late_embryos,_rep_2b;_Caenorhabditis_elegans;_ChIP-Seq	LIN-52_ChIP-seq_in_wild-type_late_embryos,_rep_...	Horvitz lab BH0001 (Harrison et al. 2006)|LIN-52 ChIP-seq in wild-type late embryos	Horvitz lab BH0001 (Ha...	LIN-52 ChIP-seq in wild-type late embryos|late embryo	LIN-52 ChIP-seq in wil...	ChIP-Seq
SRX2576648	SRA539027	LIN-52_ChIP-seq_in_wild-type_late_embryos,_rep_3;_Caenorhabditis_elegans;_ChIP-Seq	LIN-52_ChIP-seq_in_wild-type_late_embryos,_rep_...	Horvitz lab BH0001 (Harrison et al. 2006)|LIN-52 ChIP-seq in wild-type late embryos	Horvitz lab BH0001 (Ha...	LIN-52 ChIP-seq in wild-type late embryos|late embryo	LIN-52 ChIP-seq in wil...	ChIP-Seq
SRX2576649	SRA539027	LIN-52_ChIP-seq_in_lin-35(n745)_late_embryos,_rep_1;_Caenorhabditis_elegans;_ChIP-Seq	LIN-52_ChIP-seq_in_lin-35(n745)_late_embryos,_r...	Horvitz lab BH0001 (Harrison et al. 2006)|LIN-52 ChIP-seq in lin-35(n745) late embryos	Horvitz lab BH0001 (Ha...	LIN-52 ChIP-seq in lin-35(n745) late embryos|late embryo	LIN-52 ChIP-seq in lin...	ChIP-Seq
SRX257664	SRA072292	DPY28_Rep4_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	DPY28_Rep4_ChIPSeq;_Caenorhabditis_elegans;_ChI...	DPY-28 KH-DPY28 Rabbit Polyclonal to 1484-1499 aa sequence CKSAVADDDSDSDEFMLDD (PMID:19119011)|whole worms	DPY-28 KH-DPY28 Rabbit...	N2|whole worms|embryo	N2	ChIP-Seq
SRX2576650	SRA539027	LIN-52_ChIP-seq_in_lin-35(n745)_late_embryos,_rep_2;_Caenorhabditis_elegans;_ChIP-Seq	LIN-52_ChIP-seq_in_lin-35(n745)_late_embryos,_r...	Horvitz lab BH0001 (Harrison et al. 2006)|LIN-52 ChIP-seq in lin-35(n745) late embryos	Horvitz lab BH0001 (Ha...	LIN-52 ChIP-seq in lin-35(n745) late embryos|late embryo	LIN-52 ChIP-seq in lin...	ChIP-Seq
SRX2576651	SRA539027	LIN-52_ChIP-seq_in_lin-35(n745)_late_embryos,_rep_3;_Caenorhabditis_elegans;_ChIP-Seq	LIN-52_ChIP-seq_in_lin-35(n745)_late_embryos,_r...	Horvitz lab BH0001 (Harrison et al. 2006)|LIN-52 ChIP-seq in lin-35(n745) late embryos	Horvitz lab BH0001 (Ha...	LIN-52 ChIP-seq in lin-35(n745) late embryos|late embryo	LIN-52 ChIP-seq in lin...	ChIP-Seq
SRX2576652	SRA539027	LIN-54_ChIP-seq_in_wild-type_late_embryos,_rep_1a;_Caenorhabditis_elegans;_ChIP-Seq	LIN-54_ChIP-seq_in_wild-type_late_embryos,_rep_...	Horvitz lab BH0004 (Harrison et al. 2006)|LIN-54 ChIP-seq in wild-type late embryos	Horvitz lab BH0004 (Ha...	LIN-54 ChIP-seq in wild-type late embryos|late embryo	LIN-54 ChIP-seq in wil...	ChIP-Seq
SRX2576653	SRA539027	LIN-54_ChIP-seq_in_wild-type_late_embryos,_rep_2a;_Caenorhabditis_elegans;_ChIP-Seq	LIN-54_ChIP-seq_in_wild-type_late_embryos,_rep_...	Horvitz lab BH0004 (Harrison et al. 2006)|LIN-54 ChIP-seq in wild-type late embryos	Horvitz lab BH0004 (Ha...	LIN-54 ChIP-seq in wild-type late embryos|late embryo	LIN-54 ChIP-seq in wil...	ChIP-Seq
SRX2576654	SRA539027	LIN-54_ChIP-seq_in_wild-type_late_embryos,_rep_3;_Caenorhabditis_elegans;_ChIP-Seq	LIN-54_ChIP-seq_in_wild-type_late_embryos,_rep_...	Horvitz lab BH0004 (Harrison et al. 2006)|LIN-54 ChIP-seq in wild-type late embryos	Horvitz lab BH0004 (Ha...	LIN-54 ChIP-seq in wild-type late embryos|late embryo	LIN-54 ChIP-seq in wil...	ChIP-Seq
SRX2576655	SRA539027	LIN-54_ChIP-seq_in_lin-35(n745)_late_embryos,_rep_1;_Caenorhabditis_elegans;_ChIP-Seq	LIN-54_ChIP-seq_in_lin-35(n745)_late_embryos,_r...	Horvitz lab BH0004 (Harrison et al. 2006)|LIN-54 ChIP-seq in lin-35(n745) late embryos	Horvitz lab BH0004 (Ha...	LIN-54 ChIP-seq in lin-35(n745) late embryos|late embryo	LIN-54 ChIP-seq in lin...	ChIP-Seq
SRX2576656	SRA539027	LIN-54_ChIP-seq_in_lin-35(n745)_late_embryos,_rep_2;_Caenorhabditis_elegans;_ChIP-Seq	LIN-54_ChIP-seq_in_lin-35(n745)_late_embryos,_r...	Horvitz lab BH0004 (Harrison et al. 2006)|LIN-54 ChIP-seq in lin-35(n745) late embryos	Horvitz lab BH0004 (Ha...	LIN-54 ChIP-seq in lin-35(n745) late embryos|late embryo	LIN-54 ChIP-seq in lin...	ChIP-Seq
SRX2576657	SRA539027	LIN-54_ChIP-seq_in_lin-35(n745)_late_embryos,_rep_3;_Caenorhabditis_elegans;_ChIP-Seq	LIN-54_ChIP-seq_in_lin-35(n745)_late_embryos,_r...	Horvitz lab BH0004 (Harrison et al. 2006)|LIN-54 ChIP-seq in lin-35(n745) late embryos	Horvitz lab BH0004 (Ha...	LIN-54 ChIP-seq in lin-35(n745) late embryos|late embryo	LIN-54 ChIP-seq in lin...	ChIP-Seq
SRX2576658	SRA539027	Input_for_ChIP-seq,_wildtype_extract_rep_1a;_Caenorhabditis_elegans;_ChIP-Seq	Input_for_ChIP-seq,_wildtype_extract_rep_1a;_Ca...	Input for ChIP-seq, wildtype extract	Input for ChIP-seq, wi...	Input for ChIP-seq, wildtype extract|late embryo	Input for ChIP-seq, wi...	ChIP-Seq
SRX2576659	SRA539027	Input_for_ChIP-seq,_wildtype_extract_rep_1b;_Caenorhabditis_elegans;_ChIP-Seq	Input_for_ChIP-seq,_wildtype_extract_rep_1b;_Ca...	Input for ChIP-seq, wildtype extract	Input for ChIP-seq, wi...	Input for ChIP-seq, wildtype extract|late embryo	Input for ChIP-seq, wi...	ChIP-Seq
SRX257665	SRA072292	HCP6_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	HCP6_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP...	HCP-6 KH-HCP6 Rabbit Polyclonal to 1708-1722 aa sequence CKSAQAYHLHNIFEEDEES (PMID:19119011)|whole worms	HCP-6 KH-HCP6 Rabbit P...	N2|whole worms|embryo	N2	ChIP-Seq
SRX2576660	SRA539027	Input_for_ChIP-seq,_wildtype_extract_rep_2a;_Caenorhabditis_elegans;_ChIP-Seq	Input_for_ChIP-seq,_wildtype_extract_rep_2a;_Ca...	Input for ChIP-seq, wildtype extract	Input for ChIP-seq, wi...	Input for ChIP-seq, wildtype extract|late embryo	Input for ChIP-seq, wi...	ChIP-Seq
SRX2576661	SRA539027	Input_for_ChIP-seq,_wildtype_extract_rep_2b;_Caenorhabditis_elegans;_ChIP-Seq	Input_for_ChIP-seq,_wildtype_extract_rep_2b;_Ca...	Input for ChIP-seq, wildtype extract	Input for ChIP-seq, wi...	Input for ChIP-seq, wildtype extract|late embryo	Input for ChIP-seq, wi...	ChIP-Seq
SRX2576662	SRA539027	Input_for_ChIP-seq,_wildtype_extract_rep_3;_Caenorhabditis_elegans;_ChIP-Seq	Input_for_ChIP-seq,_wildtype_extract_rep_3;_Cae...	Input for ChIP-seq, wildtype extract	Input for ChIP-seq, wi...	Input for ChIP-seq, wildtype extract|late embryo	Input for ChIP-seq, wi...	ChIP-Seq
SRX2576663	SRA539027	Input_for_ChIP-seq,_lin-35(n745)_extract_rep_1;_Caenorhabditis_elegans;_ChIP-Seq	Input_for_ChIP-seq,_lin-35(n745)_extract_rep_1;...	Input for ChIP-seq, lin-35(n745) extract	Input for ChIP-seq, li...	Input for ChIP-seq, lin-35(n745) extract|late embryo	Input for ChIP-seq, li...	ChIP-Seq
SRX2576664	SRA539027	Input_for_ChIP-seq,_lin-35(n745)_extract_rep_2;_Caenorhabditis_elegans;_ChIP-Seq	Input_for_ChIP-seq,_lin-35(n745)_extract_rep_2;...	Input for ChIP-seq, lin-35(n745) extract	Input for ChIP-seq, li...	Input for ChIP-seq, lin-35(n745) extract|late embryo	Input for ChIP-seq, li...	ChIP-Seq
SRX2576665	SRA539027	Input_for_ChIP-seq,_lin-35(n745)_extract_rep_3;_Caenorhabditis_elegans;_ChIP-Seq	Input_for_ChIP-seq,_lin-35(n745)_extract_rep_3;...	Input for ChIP-seq, lin-35(n745) extract	Input for ChIP-seq, li...	Input for ChIP-seq, lin-35(n745) extract|late embryo	Input for ChIP-seq, li...	ChIP-Seq
SRX257666	SRA072292	HCP6_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	HCP6_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP...	HCP-6 KH-HCP6 Rabbit Polyclonal to 1708-1722 aa sequence CKSAQAYHLHNIFEEDEES (PMID:19119011)|whole worms	HCP-6 KH-HCP6 Rabbit P...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257667	SRA072292	HCP6_Rep3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	HCP6_Rep3_ChIPSeq;_Caenorhabditis_elegans;_ChIP...	HCP-6 KH-HCP6 Rabbit Polyclonal to 1708-1722 aa sequence CKSAQAYHLHNIFEEDEES (PMID:19119011)|whole worms	HCP-6 KH-HCP6 Rabbit P...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257668	SRA072292	HCP6_Rep4_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	HCP6_Rep4_ChIPSeq;_Caenorhabditis_elegans;_ChIP...	HCP-6 KH-HCP6 Rabbit Polyclonal to 1708-1722 aa sequence CKSAQAYHLHNIFEEDEES (PMID:19119011)|whole worms	HCP-6 KH-HCP6 Rabbit P...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257669	SRA072292	HCP6_TY1072_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	HCP6_TY1072_Rep1_ChIPSeq;_Caenorhabditis_elegan...	HCP-6 KH-HCP6 Rabbit Polyclonal to 1708-1722 aa sequence CKSAQAYHLHNIFEEDEES (PMID:19119011)|whole worms	HCP-6 KH-HCP6 Rabbit P...	TY1072|whole worms|embryo	TY1072	ChIP-Seq
SRX257670	SRA072292	HCP6_TY1072_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	HCP6_TY1072_Rep2_ChIPSeq;_Caenorhabditis_elegan...	HCP-6 KH-HCP6 Rabbit Polyclonal to 1708-1722 aa sequence CKSAQAYHLHNIFEEDEES (PMID:19119011)|whole worms	HCP-6 KH-HCP6 Rabbit P...	TY1072|whole worms|embryo	TY1072	ChIP-Seq
SRX257671	SRA072292	HTZ_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	HTZ_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	HTZ1 BK00001 mouse ascites polyclonal against HTZ-1 specific C-terminal peptide N-PGKPGAPGQGPQ-C (PMID:18787694)|whole worms	HTZ1 BK00001 mouse asc...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257672	SRA072292	HTZ_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	HTZ_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	HTZ1 BK00001 mouse ascites polyclonal against HTZ-1 specific C-terminal peptide N-PGKPGAPGQGPQ-C (PMID:18787694)|whole worms	HTZ1 BK00001 mouse asc...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257673	SRA072292	KLE2_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	KLE2_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP...	KLE-2 SDQ3898 Rabbit polyclonal is against the antigen MTRNAPPGQESTDLAWLVTPAKDLVENFSIDVLKALAGYLEVIRQESEDTDNQVDAATTYRLFDFQRACRIIQGSCAVYGRKVDHVYELTISVVDLVENK May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	KLE-2 SDQ3898 Rabbit p...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257674	SRA072292	KLE2_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	KLE2_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP...	KLE-2 SDQ3942 Rabbit polyclonal is against the antigen MTRNAPPGQESTDLAWLVTPAKDLVENFSIDVLKALAGYLEVIRQESEDTDNQVDAATTYRLFDFQRACRIIQGSCAVYGRKVDHVYELTISVVDLVENK May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	KLE-2 SDQ3942 Rabbit p...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257675	SRA072292	KLE2_Rep3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	KLE2_Rep3_ChIPSeq;_Caenorhabditis_elegans;_ChIP...	KLE-2 SDQ3942 Rabbit polyclonal is against the antigen MTRNAPPGQESTDLAWLVTPAKDLVENFSIDVLKALAGYLEVIRQESEDTDNQVDAATTYRLFDFQRACRIIQGSCAVYGRKVDHVYELTISVVDLVENK May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	KLE-2 SDQ3942 Rabbit p...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257676	SRA072292	MIX1_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	MIX1_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP...	MIX-1 JL0004 Rabbit polyclonal to 837-1244 aa. (PMID:19853451) is against the antigen 837-1244 aa|whole worms	MIX-1 JL0004 Rabbit po...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257677	SRA072292	MIX1_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	MIX1_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP...	MIX-1 SDQ4107 Rabbit polyclonal is against the antigen MHIKSIHLDGFKSYQKHTDILDFSPTFNAITGYNGSGKSNILDSICFIMGINKLDNIRAKSMHELISHGGTKAIVQVRFDNTDKRCSPFGMEHLDEIVVQ. May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	MIX-1 SDQ4107 Rabbit p...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257678	SRA072292	MIX1_Rep3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	MIX1_Rep3_ChIPSeq;_Caenorhabditis_elegans;_ChIP...	MIX-1 SDQ4107 Rabbit polyclonal is against the antigen MHIKSIHLDGFKSYQKHTDILDFSPTFNAITGYNGSGKSNILDSICFIMGINKLDNIRAKSMHELISHGGTKAIVQVRFDNTDKRCSPFGMEHLDEIVVQ. May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	MIX-1 SDQ4107 Rabbit p...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257679	SRA072292	MIX1_Rep4_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	MIX1_Rep4_ChIPSeq;_Caenorhabditis_elegans;_ChIP...	MIX-1 SDQ3892 Rabbit polyclonal is against the antigen MHIKSIHLDGFKSYQKHTDILDFSPTFNAITGYNGSGKSNILDSICFIMGINKLDNIRAKSMHELISHGGTKAIVQVRFDNTDKRCSPFGMEHLDEIVVQ May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	MIX-1 SDQ3892 Rabbit p...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257680	SRA072292	MIX1_Rep5_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	MIX1_Rep5_ChIPSeq;_Caenorhabditis_elegans;_ChIP...	MIX-1 SDQ3892 Rabbit polyclonal is against the antigen MHIKSIHLDGFKSYQKHTDILDFSPTFNAITGYNGSGKSNILDSICFIMGINKLDNIRAKSMHELISHGGTKAIVQVRFDNTDKRCSPFGMEHLDEIVVQ May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	MIX-1 SDQ3892 Rabbit p...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257681	SRA072292	PQN85_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	PQN85_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChI...	PQN-85 SDQ4481 Rabbit polyclonal is against the antigen QQQPVQQIQRQQPIAQPIPQHTIPPSTSNQFQQQIQSAASSIFDSSVISSHQKLYEEQCRQIEKERKEQEERKRKQELEEQRKRNEELKRLRIAEEKRLL May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	PQN-85 SDQ4481 Rabbit ...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257682	SRA072292	PQN85_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	PQN85_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChI...	PQN-85 SDQ4481 Rabbit polyclonal is against the antigen QQQPVQQIQRQQPIAQPIPQHTIPPSTSNQFQQQIQSAASSIFDSSVISSHQKLYEEQCRQIEKERKEQEERKRKQELEEQRKRNEELKRLRIAEEKRLL May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	PQN-85 SDQ4481 Rabbit ...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257683	SRA072292	PQN85_Rep3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	PQN85_Rep3_ChIPSeq;_Caenorhabditis_elegans;_ChI...	PQN-85 SDQ4481 Rabbit polyclonal is against the antigen QQQPVQQIQRQQPIAQPIPQHTIPPSTSNQFQQQIQSAASSIFDSSVISSHQKLYEEQCRQIEKERKEQEERKRKQELEEQRKRNEELKRLRIAEEKRLL May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	PQN-85 SDQ4481 Rabbit ...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257684	SRA072292	PQN85_TY1072_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	PQN85_TY1072_Rep1_ChIPSeq;_Caenorhabditis_elega...	PQN-85 SDQ4481 Rabbit polyclonal is against the antigen QQQPVQQIQRQQPIAQPIPQHTIPPSTSNQFQQQIQSAASSIFDSSVISSHQKLYEEQCRQIEKERKEQEERKRKQELEEQRKRNEELKRLRIAEEKRLL May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	PQN-85 SDQ4481 Rabbit ...	TY1072|whole worms|embryo	TY1072	ChIP-Seq
SRX257685	SRA072292	PQN85_TY1072_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	PQN85_TY1072_Rep2_ChIPSeq;_Caenorhabditis_elega...	PQN-85 SDQ4481 Rabbit polyclonal is against the antigen QQQPVQQIQRQQPIAQPIPQHTIPPSTSNQFQQQIQSAASSIFDSSVISSHQKLYEEQCRQIEKERKEQEERKRKQELEEQRKRNEELKRLRIAEEKRLL May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	PQN-85 SDQ4481 Rabbit ...	TY1072|whole worms|embryo	TY1072	ChIP-Seq
SRX257686	SRA072292	SMC4_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	SMC4_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP...	SMC-4 OD0039 Rabbit polyclonal from Arshad Desai Lab|whole worms	SMC-4 OD0039 Rabbit po...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257687	SRA072292	SMC4_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	SMC4_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP...	SMC-4 OD0039 Rabbit polyclonal from Arshad Desai Lab|whole worms	SMC-4 OD0039 Rabbit po...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257688	SRA072292	SMC4_Rep3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	SMC4_Rep3_ChIPSeq;_Caenorhabditis_elegans;_ChIP...	SMC-4 KH-SMC4 Rabbit Polyclonal to 1519-1549 aa sequence CGSTPKRSPMKPLTPSSKKKEKAIVDDDDDME (PMID:19119011)|whole worms	SMC-4 KH-SMC4 Rabbit P...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257689	SRA072292	IgG_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	IgG_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	Rabbit IgG, Abcam antibody catalog number ab46540|whole worms	Rabbit IgG, Abcam anti...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257690	SRA072292	IgG_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	IgG_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	Rabbit IgG, Abcam antibody catalog number ab46540|whole worms	Rabbit IgG, Abcam anti...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257691	SRA072292	IgG_Rep3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	IgG_Rep3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	Rabbit IgG, Abcam antibody catalog number ab46540|whole worms	Rabbit IgG, Abcam anti...	N2|whole worms|embryo	N2	ChIP-Seq
SRX257692	SRA072292	Input_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	Input_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChI...	whole worms	whole worms	N2|whole worms|embryo	N2	ChIP-Seq
SRX257693	SRA072292	Input_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	Input_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChI...	whole worms	whole worms	N2|whole worms|embryo	N2	ChIP-Seq
SRX257694	SRA072292	Input_Rep3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	Input_Rep3_ChIPSeq;_Caenorhabditis_elegans;_ChI...	whole worms	whole worms	N2|whole worms|embryo	N2	ChIP-Seq
SRX257695	SRA072292	Input_Rep4_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	Input_Rep4_ChIPSeq;_Caenorhabditis_elegans;_ChI...	whole worms	whole worms	N2|whole worms|embryo	N2	ChIP-Seq
SRX257696	SRA072292	Input_Rep5_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	Input_Rep5_ChIPSeq;_Caenorhabditis_elegans;_ChI...	whole worms	whole worms	N2|whole worms|embryo	N2	ChIP-Seq
SRX257697	SRA072292	Input_Rep6_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	Input_Rep6_ChIPSeq;_Caenorhabditis_elegans;_ChI...	whole worms	whole worms	N2|whole worms|embryo	N2	ChIP-Seq
SRX257698	SRA072292	Input_Rep7_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	Input_Rep7_ChIPSeq;_Caenorhabditis_elegans;_ChI...	whole worms	whole worms	N2|whole worms|embryo	N2	ChIP-Seq
SRX257699	SRA072292	Input_Rep8_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	Input_Rep8_ChIPSeq;_Caenorhabditis_elegans;_ChI...	whole worms	whole worms	N2|whole worms|embryo	N2	ChIP-Seq
SRX257700	SRA072292	Input_Rep9_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	Input_Rep9_ChIPSeq;_Caenorhabditis_elegans;_ChI...	whole worms	whole worms	N2|whole worms|embryo	N2	ChIP-Seq
SRX257701	SRA072292	Input_Rep10_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	Input_Rep10_ChIPSeq;_Caenorhabditis_elegans;_Ch...	whole worms	whole worms	N2|whole worms|embryo	N2	ChIP-Seq
SRX257702	SRA072292	Input_Rep11_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	Input_Rep11_ChIPSeq;_Caenorhabditis_elegans;_Ch...	whole worms	whole worms	N2|whole worms|embryo	N2	ChIP-Seq
SRX257703	SRA072292	Input_Rep12_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	Input_Rep12_ChIPSeq;_Caenorhabditis_elegans;_Ch...	whole worms	whole worms	N2|whole worms|embryo	N2	ChIP-Seq
SRX257704	SRA072292	Input_Rep13_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	Input_Rep13_ChIPSeq;_Caenorhabditis_elegans;_Ch...	whole worms	whole worms	N2|whole worms|embryo	N2	ChIP-Seq
SRX257705	SRA072292	Input_Rep14_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	Input_Rep14_ChIPSeq;_Caenorhabditis_elegans;_Ch...	whole worms	whole worms	N2|whole worms|embryo	N2	ChIP-Seq
SRX257706	SRA072292	Input_Rep15_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	Input_Rep15_ChIPSeq;_Caenorhabditis_elegans;_Ch...	whole worms	whole worms	N2|whole worms|embryo	N2	ChIP-Seq
SRX257707	SRA072292	Input_Rep16_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	Input_Rep16_ChIPSeq;_Caenorhabditis_elegans;_Ch...	whole worms	whole worms	N2|whole worms|embryo	N2	ChIP-Seq
SRX257708	SRA072292	Input_Rep17_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	Input_Rep17_ChIPSeq;_Caenorhabditis_elegans;_Ch...	whole worms	whole worms	N2|whole worms|embryo	N2	ChIP-Seq
SRX257709	SRA072292	Input_Rep18_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	Input_Rep18_ChIPSeq;_Caenorhabditis_elegans;_Ch...	whole worms	whole worms	TY1072|whole worms|embryo	TY1072	ChIP-Seq
SRX2582951	SRA539835	SX2966_chip_rep1;_Caenorhabditis_elegans;_ChIP-Seq	SX2966_chip_rep1;_Caenorhabditis_elegans;_ChIP-Seq	Abcam ab290|whole animal,mixed population	Abcam ab290	SX2966|whole animal,mixed population	SX2966	ChIP-Seq
SRX2582952	SRA539835	SX2966_input_rep1;_Caenorhabditis_elegans;_ChIP-Seq	SX2966_input_rep1;_Caenorhabditis_elegans;_ChIP...	none|whole animal,mixed population	none	SX2966|whole animal,mixed population	SX2966	ChIP-Seq
SRX2582953	SRA539835	SX2966_chip_rep2;_Caenorhabditis_elegans;_ChIP-Seq	SX2966_chip_rep2;_Caenorhabditis_elegans;_ChIP-Seq	Abcam ab290|whole animal,mixed population	Abcam ab290	SX2966|whole animal,mixed population	SX2966	ChIP-Seq
SRX2582954	SRA539835	SX2966_input_rep2;_Caenorhabditis_elegans;_ChIP-Seq	SX2966_input_rep2;_Caenorhabditis_elegans;_ChIP...	none|whole animal,mixed population	none	SX2966|whole animal,mixed population	SX2966	ChIP-Seq
SRX2599461	SRA481141	H3K9me3_YA_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_YA_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3 (Abcam, ab8898)|young adults	H3K9me3 (Abcam, ab8898)	young adults|whole body	young adults	ChIP-Seq
SRX2599462	SRA481141	H3K9me3_YA_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_YA_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3 (Abcam, ab8898)|young adults	H3K9me3 (Abcam, ab8898)	young adults|whole body	young adults	ChIP-Seq
SRX2710279	SRA551754	N2_Embryo_Dnase-seq_Biological_Replicate_A;_Caenorhabditis_elegans;_DNase-Hypersensitivity	N2_Embryo_Dnase-seq_Biological_Replicate_A;_Cae...	DNase-seq	DNase-seq	N2|N2 Embryo|Mid-Embryogenesis (roughly 40 cell stage)	N2	DNase-Hypersensitivity
SRX2710280	SRA551754	N2_Embryo_Dnase-seq_Biological_Replicate_B;_Caenorhabditis_elegans;_DNase-Hypersensitivity	N2_Embryo_Dnase-seq_Biological_Replicate_B;_Cae...	DNase-seq	DNase-seq	N2|N2 Embryo|Mid-Embryogenesis (roughly 40 cell stage)	N2	DNase-Hypersensitivity
SRX2710281	SRA551754	N2_Embryo_Dnase-seq_Biological_Replicate_C;_Caenorhabditis_elegans;_DNase-Hypersensitivity	N2_Embryo_Dnase-seq_Biological_Replicate_C;_Cae...	DNase-seq	DNase-seq	N2|N2 Embryo|Mid-Embryogenesis (roughly 40 cell stage)	N2	DNase-Hypersensitivity
SRX2710282	SRA551754	N2_Embryo_Dnase-seq_Biological_Replicate_D;_Caenorhabditis_elegans;_DNase-Hypersensitivity	N2_Embryo_Dnase-seq_Biological_Replicate_D;_Cae...	DNase-seq	DNase-seq	N2|N2 Embryo|Mid-Embryogenesis (roughly 40 cell stage)	N2	DNase-Hypersensitivity
SRX2710283	SRA551754	N2_L1_Arrest_Dnase-seq_Biological_Replicate_Z;_Caenorhabditis_elegans;_DNase-Hypersensitivity	N2_L1_Arrest_Dnase-seq_Biological_Replicate_Z;_...	DNase-seq	DNase-seq	N2|N2 L1 Arrest|L1 Arrest	N2	DNase-Hypersensitivity
SRX2710284	SRA551754	N2_L1_Arrest_Dnase-seq_Biological_Replicate_Y;_Caenorhabditis_elegans;_DNase-Hypersensitivity	N2_L1_Arrest_Dnase-seq_Biological_Replicate_Y;_...	DNase-seq	DNase-seq	N2|N2 L1 Arrest|L1 Arrest	N2	DNase-Hypersensitivity
SRX2710285	SRA551754	N2_L1_Arrest_Dnase-seq_Biological_Replicate_X;_Caenorhabditis_elegans;_DNase-Hypersensitivity	N2_L1_Arrest_Dnase-seq_Biological_Replicate_X;_...	DNase-seq	DNase-seq	N2|N2 L1 Arrest|L1 Arrest	N2	DNase-Hypersensitivity
SRX2710286	SRA551754	N2_L1_Arrest_Dnase-seq_Biological_Replicate_W;_Caenorhabditis_elegans;_DNase-Hypersensitivity	N2_L1_Arrest_Dnase-seq_Biological_Replicate_W;_...	DNase-seq	DNase-seq	N2|N2 L1 Arrest|L1 Arrest	N2	DNase-Hypersensitivity
SRX2710287	SRA551754	N2_L1_Arrest_Dnase-seq_Biological_Replicate_V;_Caenorhabditis_elegans;_DNase-Hypersensitivity	N2_L1_Arrest_Dnase-seq_Biological_Replicate_V;_...	DNase-seq	DNase-seq	N2|N2 L1 Arrest|L1 Arrest	N2	DNase-Hypersensitivity
SRX2737086	SRA554153	PolII_ChIP_mock(RNAi)_input_rep1;_Caenorhabditis_elegans;_ChIP-Seq	PolII_ChIP_mock(RNAi)_input_rep1;_Caenorhabditi...	whole body	whole body	N2 (wild-type)|whole body|L4	N2 (wild-type)	ChIP-Seq
SRX2737087	SRA554153	PolII_ChIP_mock(RNAi)_input_rep2;_Caenorhabditis_elegans;_ChIP-Seq	PolII_ChIP_mock(RNAi)_input_rep2;_Caenorhabditi...	whole body	whole body	N2 (wild-type)|whole body|L4	N2 (wild-type)	ChIP-Seq
SRX2737088	SRA554153	PolII_ChIP_xrn-2(RNAi)_input_rep1;_Caenorhabditis_elegans;_ChIP-Seq	PolII_ChIP_xrn-2(RNAi)_input_rep1;_Caenorhabdit...	whole body	whole body	N2 (wild-type)|whole body|L4	N2 (wild-type)	ChIP-Seq
SRX2737089	SRA554153	PolII_ChIP_xrn-2(RNAi)_input_rep2;_Caenorhabditis_elegans;_ChIP-Seq	PolII_ChIP_xrn-2(RNAi)_input_rep2;_Caenorhabdit...	whole body	whole body	N2 (wild-type)|whole body|L4	N2 (wild-type)	ChIP-Seq
SRX2737090	SRA554153	PolII_ChIP_mock(RNAi)_IP_rep1;_Caenorhabditis_elegans;_ChIP-Seq	PolII_ChIP_mock(RNAi)_IP_rep1;_Caenorhabditis_e...	whole body	whole body	N2 (wild-type)|whole body|L4	N2 (wild-type)	ChIP-Seq
SRX2737091	SRA554153	PolII_ChIP_mock(RNAi)_IP_rep2;_Caenorhabditis_elegans;_ChIP-Seq	PolII_ChIP_mock(RNAi)_IP_rep2;_Caenorhabditis_e...	whole body	whole body	N2 (wild-type)|whole body|L4	N2 (wild-type)	ChIP-Seq
SRX2737092	SRA554153	PolII_ChIP_xrn-2(RNAi)_IP_rep1;_Caenorhabditis_elegans;_ChIP-Seq	PolII_ChIP_xrn-2(RNAi)_IP_rep1;_Caenorhabditis_...	whole body	whole body	N2 (wild-type)|whole body|L4	N2 (wild-type)	ChIP-Seq
SRX2737093	SRA554153	PolII_ChIP_xrn-2(RNAi)_IP_rep2;_Caenorhabditis_elegans;_ChIP-Seq	PolII_ChIP_xrn-2(RNAi)_IP_rep2;_Caenorhabditis_...	whole body	whole body	N2 (wild-type)|whole body|L4	N2 (wild-type)	ChIP-Seq
SRX2761380	SRA494606	WT_F5_ChIPseq_H3K9me3;_Caenorhabditis_elegans;_ChIP-Seq	WT_F5_ChIPseq_H3K9me3;_Caenorhabditis_elegans;_...	Anti-Histone H3 (tri methyl K9)|Whole animal, young adult	Anti-Histone H3 (tri m...	N2|Whole animal, young adult	N2	ChIP-Seq
SRX2761381	SRA494606	met-1_F5_rep1_ChIPseq_H3K9me3;_Caenorhabditis_elegans;_ChIP-Seq	met-1_F5_rep1_ChIPseq_H3K9me3;_Caenorhabditis_e...	Anti-Histone H3 (tri methyl K9)|Whole animal, young adult	Anti-Histone H3 (tri m...	met-1(xk4)|Whole animal, young adult	met-1(xk4)	ChIP-Seq
SRX2761382	SRA494606	met-1_F5_rep2_ChIPseq_H3K9me3;_Caenorhabditis_elegans;_ChIP-Seq	met-1_F5_rep2_ChIPseq_H3K9me3;_Caenorhabditis_e...	Anti-Histone H3 (tri methyl K9)|Whole animal, young adult	Anti-Histone H3 (tri m...	met-1(xk4)|Whole animal, young adult	met-1(xk4)	ChIP-Seq
SRX2761383	SRA494606	morc-1_F5_ChIPseq_H3K9me3;_Caenorhabditis_elegans;_ChIP-Seq	morc-1_F5_ChIPseq_H3K9me3;_Caenorhabditis_elega...	Anti-Histone H3 (tri methyl K9)|Whole animal, young adult	Anti-Histone H3 (tri m...	morc-1(tm6048)|Whole animal, young adult	morc-1(tm6048)	ChIP-Seq
SRX2761384	SRA494606	met-1morc-1_F5_rep1_ChIPseq_H3K9me3;_Caenorhabditis_elegans;_ChIP-Seq	met-1morc-1_F5_rep1_ChIPseq_H3K9me3;_Caenorhabd...	Anti-Histone H3 (tri methyl K9)|Whole animal, young adult	Anti-Histone H3 (tri m...	met-1(xk4); morc-1(tm6048)|Whole animal, young adult	met-1(xk4); morc-1(tm6...	ChIP-Seq
SRX2761385	SRA494606	met-1morc-1_F5_rep2_ChIPseq_H3K9me3;_Caenorhabditis_elegans;_ChIP-Seq	met-1morc-1_F5_rep2_ChIPseq_H3K9me3;_Caenorhabd...	Anti-Histone H3 (tri methyl K9)|Whole animal, young adult	Anti-Histone H3 (tri m...	met-1(xk4); morc-1(tm6048)|Whole animal, young adult	met-1(xk4); morc-1(tm6...	ChIP-Seq
SRX2761386	SRA494606	WT_F5_ChIPseq_H3K9me3_Input;_Caenorhabditis_elegans;_ChIP-Seq	WT_F5_ChIPseq_H3K9me3_Input;_Caenorhabditis_ele...	None|Whole animal, young adult	None	N2|Whole animal, young adult	N2	ChIP-Seq
SRX2761387	SRA494606	met-1_F5_rep1_ChIPseq_H3K9me3_Input;_Caenorhabditis_elegans;_ChIP-Seq	met-1_F5_rep1_ChIPseq_H3K9me3_Input;_Caenorhabd...	None|Whole animal, young adult	None	met-1(xk4)|Whole animal, young adult	met-1(xk4)	ChIP-Seq
SRX2761388	SRA494606	met-1_F5_rep2_ChIPseq_H3K9me3_Input;_Caenorhabditis_elegans;_ChIP-Seq	met-1_F5_rep2_ChIPseq_H3K9me3_Input;_Caenorhabd...	None|Whole animal, young adult	None	met-1(xk4)|Whole animal, young adult	met-1(xk4)	ChIP-Seq
SRX2761389	SRA494606	morc-1_F5_ChIPseq_H3K9me3_Input;_Caenorhabditis_elegans;_ChIP-Seq	morc-1_F5_ChIPseq_H3K9me3_Input;_Caenorhabditis...	None|Whole animal, young adult	None	morc-1(tm6048)|Whole animal, young adult	morc-1(tm6048)	ChIP-Seq
SRX2761390	SRA494606	met-1morc-1_F5_rep1_ChIPseq_H3K9me3_Input;_Caenorhabditis_elegans;_ChIP-Seq	met-1morc-1_F5_rep1_ChIPseq_H3K9me3_Input;_Caen...	None|Whole animal, young adult	None	met-1(xk4); morc-1(tm6048)|Whole animal, young adult	met-1(xk4); morc-1(tm6...	ChIP-Seq
SRX2761391	SRA494606	met-1morc-1_F5_rep2_ChIPseq_H3K9me3_Input;_Caenorhabditis_elegans;_ChIP-Seq	met-1morc-1_F5_rep2_ChIPseq_H3K9me3_Input;_Caen...	None|Whole animal, young adult	None	met-1(xk4); morc-1(tm6048)|Whole animal, young adult	met-1(xk4); morc-1(tm6...	ChIP-Seq
SRX276905	SRA075744	JUN-1_GFP_L4_C.elJUN-1_GFP_L4_C.elegans_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	JUN-1_GFP_L4_C.elJUN-1_GFP_L4_C.elegans_Input_R...	JUN-1 L4 InputRep1	JUN-1 L4 InputRep1	OP234(official name : OP234 genotype : unc119(ed3); wgIs234(T24H10.7:TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The JUN-1::EGFP fusion protein is expressed in the correct jun-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the JUN-1 transcription factor. made_by : Unknown )|JUN-1 L4 InputRep1|L4	OP234(official name : ...	ChIP-Seq
SRX276906	SRA075744	JUN-1_GFP_L4_C.elJUN-1_GFP_L4_C.elegans_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	JUN-1_GFP_L4_C.elJUN-1_GFP_L4_C.elegans_Input_R...	JUN-1 L4 InputRep2	JUN-1 L4 InputRep2	OP234(official name : OP234 genotype : unc119(ed3); wgIs234(T24H10.7:TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The JUN-1::EGFP fusion protein is expressed in the correct jun-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the JUN-1 transcription factor. made_by : Unknown )|JUN-1 L4 InputRep2|L4	OP234(official name : ...	ChIP-Seq
SRX276907	SRA075744	JUN-1_GFP_L4_C.elJUN-1_GFP_L4_C.elegans_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	JUN-1_GFP_L4_C.elJUN-1_GFP_L4_C.elegans_ChIP_Re...	JUN-1 L4 ChIPRep1	JUN-1 L4 ChIPRep1	OP234(official name : OP234 genotype : unc119(ed3); wgIs234(T24H10.7:TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The JUN-1::EGFP fusion protein is expressed in the correct jun-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the JUN-1 transcription factor. made_by : Unknown )|JUN-1 L4 ChIPRep1|L4	OP234(official name : ...	ChIP-Seq
SRX276908	SRA075744	JUN-1_GFP_L4_C.elJUN-1_GFP_L4_C.elegans_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	JUN-1_GFP_L4_C.elJUN-1_GFP_L4_C.elegans_ChIP_Re...	JUN-1 L4 ChIPRep2	JUN-1 L4 ChIPRep2	OP234(official name : OP234 genotype : unc119(ed3); wgIs234(T24H10.7:TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The JUN-1::EGFP fusion protein is expressed in the correct jun-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the JUN-1 transcription factor. made_by : Unknown )|JUN-1 L4 ChIPRep2|L4	OP234(official name : ...	ChIP-Seq
SRX276909	SRA075745	ZTF-11_GFP_L3_C.elegans_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	ZTF-11_GFP_L3_C.elegans_Input_Rep1;_Caenorhabdi...	ZTF-11 L3 InputRep1	ZTF-11 L3 InputRep1	OP236(official name : OP236 genotype : unc119(ed3); wgIs236(elk-2::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ZTF-11::EGFP fusion protein is expressed in the correct ztf-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZTF-11 transcription factor. made_by : Unknown )|ZTF-11 L3 InputRep1|L3	OP236(official name : ...	ChIP-Seq
SRX276910	SRA075745	ZTF-11_GFP_L3_C.elegans_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	ZTF-11_GFP_L3_C.elegans_Input_Rep2;_Caenorhabdi...	ZTF-11 L3 InputRep2	ZTF-11 L3 InputRep2	OP236(official name : OP236 genotype : unc119(ed3); wgIs236(elk-2::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ZTF-11::EGFP fusion protein is expressed in the correct ztf-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZTF-11 transcription factor. made_by : Unknown )|ZTF-11 L3 InputRep2|L3	OP236(official name : ...	ChIP-Seq
SRX276911	SRA075745	ZTF-11_GFP_L3_C.elegans_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	ZTF-11_GFP_L3_C.elegans_ChIP_Rep1;_Caenorhabdit...	ZTF-11 L3 ChIPRep1	ZTF-11 L3 ChIPRep1	OP236(official name : OP236 genotype : unc119(ed3); wgIs236(elk-2::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ZTF-11::EGFP fusion protein is expressed in the correct ztf-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZTF-11 transcription factor. made_by : Unknown )|ZTF-11 L3 ChIPRep1|L3	OP236(official name : ...	ChIP-Seq
SRX276912	SRA075745	ZTF-11_GFP_L3_C.elegans_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	ZTF-11_GFP_L3_C.elegans_ChIP_Rep2;_Caenorhabdit...	ZTF-11 L3 ChIPRep2	ZTF-11 L3 ChIPRep2	OP236(official name : OP236 genotype : unc119(ed3); wgIs236(elk-2::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ZTF-11::EGFP fusion protein is expressed in the correct ztf-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZTF-11 transcription factor. made_by : Unknown )|ZTF-11 L3 ChIPRep2|L3	OP236(official name : ...	ChIP-Seq
SRX276913	SRA075746	ZTF-11_GFP_L4_C.elegans_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	ZTF-11_GFP_L4_C.elegans_Input_Rep1;_Caenorhabdi...	ZTF-11 L4 InputRep1	ZTF-11 L4 InputRep1	OP236(official name : OP236 genotype : unc119(ed3); wgIs236(elk-2::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ZTF-11::EGFP fusion protein is expressed in the correct ztf-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZTF-11 transcription factor. made_by : Unknown )|ZTF-11 L4 InputRep1|L4	OP236(official name : ...	ChIP-Seq
SRX276914	SRA075746	ZTF-11_GFP_L4_C.elegans_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	ZTF-11_GFP_L4_C.elegans_Input_Rep2;_Caenorhabdi...	ZTF-11 L4 InputRep2	ZTF-11 L4 InputRep2	OP236(official name : OP236 genotype : unc119(ed3); wgIs236(elk-2::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ZTF-11::EGFP fusion protein is expressed in the correct ztf-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZTF-11 transcription factor. made_by : Unknown )|ZTF-11 L4 InputRep2|L4	OP236(official name : ...	ChIP-Seq
SRX276915	SRA075746	ZTF-11_GFP_L4_C.elegans_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	ZTF-11_GFP_L4_C.elegans_ChIP_Rep1;_Caenorhabdit...	ZTF-11 L4 ChIPRep1	ZTF-11 L4 ChIPRep1	OP236(official name : OP236 genotype : unc119(ed3); wgIs236(elk-2::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ZTF-11::EGFP fusion protein is expressed in the correct ztf-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZTF-11 transcription factor. made_by : Unknown )|ZTF-11 L4 ChIPRep1|L4	OP236(official name : ...	ChIP-Seq
SRX276916	SRA075746	ZTF-11_GFP_L4_C.elegans_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	ZTF-11_GFP_L4_C.elegans_ChIP_Rep2;_Caenorhabdit...	ZTF-11 L4 ChIPRep2	ZTF-11 L4 ChIPRep2	OP236(official name : OP236 genotype : unc119(ed3); wgIs236(elk-2::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ZTF-11::EGFP fusion protein is expressed in the correct ztf-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZTF-11 transcription factor. made_by : Unknown )|ZTF-11 L4 ChIPRep2|L4	OP236(official name : ...	ChIP-Seq
SRX276917	SRA075747	NHR-76_GFP_L4_C.elegans_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	NHR-76_GFP_L4_C.elegans_Input_Rep1;_Caenorhabdi...	NHR-76 L4 InputRep1	NHR-76 L4 InputRep1	OP203(official name : OP203 genotype : unc-119(ed3); wgIs203(nhr-76::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-76::EGFP fusion protein is expressed in the correct nhr-76 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-76 transcription factor. made_by : R. Waterston )|NHR-76 L4 InputRep1|L4	OP203(official name : ...	ChIP-Seq
SRX276918	SRA075747	NHR-76_GFP_L4_C.elegans_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	NHR-76_GFP_L4_C.elegans_Input_Rep2;_Caenorhabdi...	NHR-76 L4 InputRep2	NHR-76 L4 InputRep2	OP203(official name : OP203 genotype : unc-119(ed3); wgIs203(nhr-76::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-76::EGFP fusion protein is expressed in the correct nhr-76 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-76 transcription factor. made_by : R. Waterston )|NHR-76 L4 InputRep2|L4	OP203(official name : ...	ChIP-Seq
SRX276919	SRA075747	NHR-76_GFP_L4_C.elegans_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	NHR-76_GFP_L4_C.elegans_ChIP_Rep1;_Caenorhabdit...	NHR-76 L4 ChIPRep1	NHR-76 L4 ChIPRep1	OP203(official name : OP203 genotype : unc-119(ed3); wgIs203(nhr-76::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-76::EGFP fusion protein is expressed in the correct nhr-76 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-76 transcription factor. made_by : R. Waterston )|NHR-76 L4 ChIPRep1|L4	OP203(official name : ...	ChIP-Seq
SRX276920	SRA075747	NHR-76_GFP_L4_C.elegans_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	NHR-76_GFP_L4_C.elegans_ChIP_Rep2;_Caenorhabdit...	NHR-76 L4 ChIPRep2	NHR-76 L4 ChIPRep2	OP203(official name : OP203 genotype : unc-119(ed3); wgIs203(nhr-76::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-76::EGFP fusion protein is expressed in the correct nhr-76 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-76 transcription factor. made_by : R. Waterston )|NHR-76 L4 ChIPRep2|L4	OP203(official name : ...	ChIP-Seq
SRX277020	SRA075862	JUN-1_GFP_L1_C.elegans_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	JUN-1_GFP_L1_C.elegans_Input_Rep1;_Caenorhabdit...	JUN-1 L1 InputRep1	JUN-1 L1 InputRep1	OP234(official name : OP234 genotype : unc119(ed3); wgIs234(T24H10.7:TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The JUN-1::EGFP fusion protein is expressed in the correct jun-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the JUN-1 transcription factor. made_by : Unknown )|JUN-1 L1 InputRep1|L1 26dC	OP234(official name : ...	ChIP-Seq
SRX277021	SRA075862	JUN-1_GFP_L1_C.elegans_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	JUN-1_GFP_L1_C.elegans_Input_Rep2;_Caenorhabdit...	JUN-1 L1 InputRep2	JUN-1 L1 InputRep2	OP234(official name : OP234 genotype : unc119(ed3); wgIs234(T24H10.7:TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The JUN-1::EGFP fusion protein is expressed in the correct jun-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the JUN-1 transcription factor. made_by : Unknown )|JUN-1 L1 InputRep2|L1 26dC	OP234(official name : ...	ChIP-Seq
SRX277022	SRA075862	JUN-1_GFP_L1_C.elegans_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	JUN-1_GFP_L1_C.elegans_ChIP_Rep1;_Caenorhabditi...	JUN-1 L1 ChIPRep1	JUN-1 L1 ChIPRep1	OP234(official name : OP234 genotype : unc119(ed3); wgIs234(T24H10.7:TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The JUN-1::EGFP fusion protein is expressed in the correct jun-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the JUN-1 transcription factor. made_by : Unknown )|JUN-1 L1 ChIPRep1|L1 26dC	OP234(official name : ...	ChIP-Seq
SRX277023	SRA075862	JUN-1_GFP_L1_C.elegans_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	JUN-1_GFP_L1_C.elegans_ChIP_Rep2;_Caenorhabditi...	JUN-1 L1 ChIPRep2	JUN-1 L1 ChIPRep2	OP234(official name : OP234 genotype : unc119(ed3); wgIs234(T24H10.7:TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The JUN-1::EGFP fusion protein is expressed in the correct jun-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the JUN-1 transcription factor. made_by : Unknown )|JUN-1 L1 ChIPRep2|L1 26dC	OP234(official name : ...	ChIP-Seq
SRX277024	SRA075863	JUN-1_GFP_L3_C.elegans_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	JUN-1_GFP_L3_C.elegans_Input_Rep1;_Caenorhabdit...	JUN-1 L3 InputRep1	JUN-1 L3 InputRep1	OP234(official name : OP234 genotype : unc119(ed3); wgIs234(T24H10.7:TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The JUN-1::EGFP fusion protein is expressed in the correct jun-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the JUN-1 transcription factor. made_by : Unknown )|JUN-1 L3 InputRep1|L3	OP234(official name : ...	ChIP-Seq
SRX277025	SRA075863	JUN-1_GFP_L3_C.elegans_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	JUN-1_GFP_L3_C.elegans_Input_Rep2;_Caenorhabdit...	JUN-1 L3 InputRep2	JUN-1 L3 InputRep2	OP234(official name : OP234 genotype : unc119(ed3); wgIs234(T24H10.7:TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The JUN-1::EGFP fusion protein is expressed in the correct jun-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the JUN-1 transcription factor. made_by : Unknown )|JUN-1 L3 InputRep2|L3	OP234(official name : ...	ChIP-Seq
SRX277026	SRA075863	JUN-1_GFP_L3_C.elegans_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	JUN-1_GFP_L3_C.elegans_ChIP_Rep1;_Caenorhabditi...	JUN-1 L3 ChIPRep1	JUN-1 L3 ChIPRep1	OP234(official name : OP234 genotype : unc119(ed3); wgIs234(T24H10.7:TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The JUN-1::EGFP fusion protein is expressed in the correct jun-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the JUN-1 transcription factor. made_by : Unknown )|JUN-1 L3 ChIPRep1|L3	OP234(official name : ...	ChIP-Seq
SRX277027	SRA075863	JUN-1_GFP_L3_C.elegans_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	JUN-1_GFP_L3_C.elegans_ChIP_Rep2;_Caenorhabditi...	JUN-1 L3 ChIPRep2	JUN-1 L3 ChIPRep2	OP234(official name : OP234 genotype : unc119(ed3); wgIs234(T24H10.7:TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The JUN-1::EGFP fusion protein is expressed in the correct jun-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the JUN-1 transcription factor. made_by : Unknown )|JUN-1 L3 ChIPRep2|L3	OP234(official name : ...	ChIP-Seq
SRX277028	SRA075864	SKN-1_GFP_L4_C.elegans_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	SKN-1_GFP_L4_C.elegans_Input_Rep1;_Caenorhabdit...	SKN-1 L4 InputRep1	SKN-1 L4 InputRep1	OP342(official name : OP342 genotype : unc119(ed3); wgIs341(skn-1::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. made_by : Bob Waterston's lab from UW )|SKN-1 L4 InputRep1|L4	OP342(official name : ...	ChIP-Seq
SRX277029	SRA075864	SKN-1_GFP_L4_C.elegans_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	SKN-1_GFP_L4_C.elegans_Input_Rep2;_Caenorhabdit...	SKN-1 L4 InputRep2	SKN-1 L4 InputRep2	OP342(official name : OP342 genotype : unc119(ed3); wgIs341(skn-1::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. made_by : Bob Waterston's lab from UW )|SKN-1 L4 InputRep2|L4	OP342(official name : ...	ChIP-Seq
SRX277030	SRA075864	SKN-1_GFP_L4_C.elegans_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	SKN-1_GFP_L4_C.elegans_ChIP_Rep1;_Caenorhabditi...	SKN-1 L4 ChIPRep1	SKN-1 L4 ChIPRep1	OP342(official name : OP342 genotype : unc119(ed3); wgIs341(skn-1::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. made_by : Bob Waterston's lab from UW )|SKN-1 L4 ChIPRep1|L4	OP342(official name : ...	ChIP-Seq
SRX277031	SRA075864	SKN-1_GFP_L4_C.elegans_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	SKN-1_GFP_L4_C.elegans_ChIP_Rep2;_Caenorhabditi...	SKN-1 L4 ChIPRep2	SKN-1 L4 ChIPRep2	OP342(official name : OP342 genotype : unc119(ed3); wgIs341(skn-1::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. made_by : Bob Waterston's lab from UW )|SKN-1 L4 ChIPRep2|L4	OP342(official name : ...	ChIP-Seq
SRX277033	SRA075867	ELT-1_GFP_L2_C.elegans_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	ELT-1_GFP_L2_C.elegans_Input_Rep1;_Caenorhabdit...	ELT-1 L2 InputRep1	ELT-1 L2 InputRep1	OP354(official name : OP354 genotype : unc119(ed3); wgIs354(elt-1::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. made_by : Bob Waterston's lab from UW )|ELT-1 L2 InputRep1|L2	OP354(official name : ...	ChIP-Seq
SRX277034	SRA075867	ELT-1_GFP_L2_C.elegans_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	ELT-1_GFP_L2_C.elegans_Input_Rep2;_Caenorhabdit...	ELT-1 L2 InputRep2	ELT-1 L2 InputRep2	OP354(official name : OP354 genotype : unc119(ed3); wgIs354(elt-1::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. made_by : Bob Waterston's lab from UW )|ELT-1 L2 InputRep2|L2	OP354(official name : ...	ChIP-Seq
SRX277035	SRA075867	ELT-1_GFP_L2_C.elegans_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	ELT-1_GFP_L2_C.elegans_ChIP_Rep1;_Caenorhabditi...	ELT-1 L2 ChIPRep1	ELT-1 L2 ChIPRep1	OP354(official name : OP354 genotype : unc119(ed3); wgIs354(elt-1::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. made_by : Bob Waterston's lab from UW )|ELT-1 L2 ChIPRep1|L2	OP354(official name : ...	ChIP-Seq
SRX277036	SRA075867	ELT-1_GFP_L2_C.elegans_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	ELT-1_GFP_L2_C.elegans_ChIP_Rep2;_Caenorhabditi...	ELT-1 L2 ChIPRep2	ELT-1 L2 ChIPRep2	OP354(official name : OP354 genotype : unc119(ed3); wgIs354(elt-1::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. made_by : Bob Waterston's lab from UW )|ELT-1 L2 ChIPRep2|L2	OP354(official name : ...	ChIP-Seq
SRX277037	SRA075868	nhr-23_GFP_L2_C.elegans_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	nhr-23_GFP_L2_C.elegans_Input_Rep1;_Caenorhabdi...	nhr-23 L2 InputRep1	nhr-23 L2 InputRep1	OP43(official name : OP43 genotype : unc-119(ed3); wgIs43(nhr-23::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The NHR-23::EGFP fusion protein is expressed in the correct nhr-23 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-223 transcription factor. made_by : Bob Waterston's lab from UW )|nhr-23 L2 InputRep1|L2	OP43(official name : O...	ChIP-Seq
SRX277038	SRA075868	nhr-23_GFP_L2_C.elegans_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	nhr-23_GFP_L2_C.elegans_Input_Rep2;_Caenorhabdi...	nhr-23 L2 InputRep2	nhr-23 L2 InputRep2	OP43(official name : OP43 genotype : unc-119(ed3); wgIs43(nhr-23::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The NHR-23::EGFP fusion protein is expressed in the correct nhr-23 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-223 transcription factor. made_by : Bob Waterston's lab from UW )|nhr-23 L2 InputRep2|L2	OP43(official name : O...	ChIP-Seq
SRX277039	SRA075868	nhr-23_GFP_L2_C.elegans_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	nhr-23_GFP_L2_C.elegans_ChIP_Rep1;_Caenorhabdit...	nhr-23 L2 ChIPRep1	nhr-23 L2 ChIPRep1	OP43(official name : OP43 genotype : unc-119(ed3); wgIs43(nhr-23::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The NHR-23::EGFP fusion protein is expressed in the correct nhr-23 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-223 transcription factor. made_by : Bob Waterston's lab from UW )|nhr-23 L2 ChIPRep1|L2	OP43(official name : O...	ChIP-Seq
SRX277040	SRA075868	nhr-23_GFP_L2_C.elegans_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	nhr-23_GFP_L2_C.elegans_ChIP_Rep2;_Caenorhabdit...	nhr-23 L2 ChIPRep2	nhr-23 L2 ChIPRep2	OP43(official name : OP43 genotype : unc-119(ed3); wgIs43(nhr-23::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The NHR-23::EGFP fusion protein is expressed in the correct nhr-23 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-223 transcription factor. made_by : Bob Waterston's lab from UW )|nhr-23 L2 ChIPRep2|L2	OP43(official name : O...	ChIP-Seq
SRX277041	SRA075869	UNC-39_GFP_EMB_C.elegans_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	UNC-39_GFP_EMB_C.elegans_Input_Rep1;_Caenorhabd...	UNC-39 EMB InputRep1	UNC-39 EMB InputRep1	OP186(official name : OP186 genotype : unc119(ed3); wgIs186(unc39::TY1 EGFP FLAG C; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-39::EGFP fusion protein is expressed in the correct unc-39 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-39 transcription factor. made_by : Unknown )|UNC-39 EMB InputRep1|embryo	OP186(official name : ...	ChIP-Seq
SRX277042	SRA075869	UNC-39_GFP_EMB_C.elegans_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	UNC-39_GFP_EMB_C.elegans_Input_Rep2;_Caenorhabd...	UNC-39 EMB InputRep2	UNC-39 EMB InputRep2	OP186(official name : OP186 genotype : unc119(ed3); wgIs186(unc39::TY1 EGFP FLAG C; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-39::EGFP fusion protein is expressed in the correct unc-39 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-39 transcription factor. made_by : Unknown )|UNC-39 EMB InputRep2|embryo	OP186(official name : ...	ChIP-Seq
SRX277043	SRA075869	UNC-39_GFP_EMB_C.elegans_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	UNC-39_GFP_EMB_C.elegans_ChIP_Rep1;_Caenorhabdi...	UNC-39 EMB ChIPRep1	UNC-39 EMB ChIPRep1	OP186(official name : OP186 genotype : unc119(ed3); wgIs186(unc39::TY1 EGFP FLAG C; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-39::EGFP fusion protein is expressed in the correct unc-39 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-39 transcription factor. made_by : Unknown )|UNC-39 EMB ChIPRep1|embryo	OP186(official name : ...	ChIP-Seq
SRX277044	SRA075869	UNC-39_GFP_EMB_C.elegans_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	UNC-39_GFP_EMB_C.elegans_ChIP_Rep2;_Caenorhabdi...	UNC-39 EMB ChIPRep2	UNC-39 EMB ChIPRep2	OP186(official name : OP186 genotype : unc119(ed3); wgIs186(unc39::TY1 EGFP FLAG C; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-39::EGFP fusion protein is expressed in the correct unc-39 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-39 transcription factor. made_by : Unknown )|UNC-39 EMB ChIPRep2|embryo	OP186(official name : ...	ChIP-Seq
SRX277045	SRA075870	UNC-39_GFP_L2_C.elegans_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	UNC-39_GFP_L2_C.elegans_Input_Rep1;_Caenorhabdi...	UNC-39 L2 InputRep1	UNC-39 L2 InputRep1	OP186(official name : OP186 genotype : unc119(ed3); wgIs186(unc39::TY1 EGFP FLAG C; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-39::EGFP fusion protein is expressed in the correct unc-39 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-39 transcription factor. made_by : Unknown )|UNC-39 L2 InputRep1|L2	OP186(official name : ...	ChIP-Seq
SRX277046	SRA075870	UNC-39_GFP_L2_C.elegans_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	UNC-39_GFP_L2_C.elegans_Input_Rep2;_Caenorhabdi...	UNC-39 L2 InputRep2	UNC-39 L2 InputRep2	OP186(official name : OP186 genotype : unc119(ed3); wgIs186(unc39::TY1 EGFP FLAG C; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-39::EGFP fusion protein is expressed in the correct unc-39 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-39 transcription factor. made_by : Unknown )|UNC-39 L2 InputRep2|L2	OP186(official name : ...	ChIP-Seq
SRX277047	SRA075870	UNC-39_GFP_L2_C.elegans_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	UNC-39_GFP_L2_C.elegans_ChIP_Rep1;_Caenorhabdit...	UNC-39 L2 ChIPRep1	UNC-39 L2 ChIPRep1	OP186(official name : OP186 genotype : unc119(ed3); wgIs186(unc39::TY1 EGFP FLAG C; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-39::EGFP fusion protein is expressed in the correct unc-39 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-39 transcription factor. made_by : Unknown )|UNC-39 L2 ChIPRep1|L2	OP186(official name : ...	ChIP-Seq
SRX277048	SRA075870	UNC-39_GFP_L2_C.elegans_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	UNC-39_GFP_L2_C.elegans_ChIP_Rep2;_Caenorhabdit...	UNC-39 L2 ChIPRep2	UNC-39 L2 ChIPRep2	OP186(official name : OP186 genotype : unc119(ed3); wgIs186(unc39::TY1 EGFP FLAG C; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-39::EGFP fusion protein is expressed in the correct unc-39 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-39 transcription factor. made_by : Unknown )|UNC-39 L2 ChIPRep2|L2	OP186(official name : ...	ChIP-Seq
SRX277049	SRA075871	ELT-3_GFP_EMB_C.elegans_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	ELT-3_GFP_EMB_C.elegans_Input_Rep1;_Caenorhabdi...	ELT-3 EMB InputRep1	ELT-3 EMB InputRep1	OP75(official name : OP75 genotype : unc-119 (ed3) III; wgIs75 elt-3::TY1::EGFP::FLAG; unc-119 (+) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ELT-3::EGFP fusion protein is expressed in the correct elt-3 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ELT-3 transcription factor. made_by : R Waterston )|ELT-3 EMB InputRep1|embryo	OP75(official name : O...	ChIP-Seq
SRX277050	SRA075871	ELT-3_GFP_EMB_C.elegans_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	ELT-3_GFP_EMB_C.elegans_Input_Rep2;_Caenorhabdi...	ELT-3 EMB InputRep2	ELT-3 EMB InputRep2	OP75(official name : OP75 genotype : unc-119 (ed3) III; wgIs75 elt-3::TY1::EGFP::FLAG; unc-119 (+) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ELT-3::EGFP fusion protein is expressed in the correct elt-3 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ELT-3 transcription factor. made_by : R Waterston )|ELT-3 EMB InputRep2|embryo	OP75(official name : O...	ChIP-Seq
SRX277051	SRA075871	ELT-3_GFP_EMB_C.elegans_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	ELT-3_GFP_EMB_C.elegans_ChIP_Rep1;_Caenorhabdit...	ELT-3 EMB ChIPRep1	ELT-3 EMB ChIPRep1	OP75(official name : OP75 genotype : unc-119 (ed3) III; wgIs75 elt-3::TY1::EGFP::FLAG; unc-119 (+) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ELT-3::EGFP fusion protein is expressed in the correct elt-3 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ELT-3 transcription factor. made_by : R Waterston )|ELT-3 EMB ChIPRep1|embryo	OP75(official name : O...	ChIP-Seq
SRX277052	SRA075871	ELT-3_GFP_EMB_C.elegans_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	ELT-3_GFP_EMB_C.elegans_ChIP_Rep2;_Caenorhabdit...	ELT-3 EMB ChIPRep2	ELT-3 EMB ChIPRep2	OP75(official name : OP75 genotype : unc-119 (ed3) III; wgIs75 elt-3::TY1::EGFP::FLAG; unc-119 (+) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ELT-3::EGFP fusion protein is expressed in the correct elt-3 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ELT-3 transcription factor. made_by : R Waterston )|ELT-3 EMB ChIPRep2|embryo	OP75(official name : O...	ChIP-Seq
SRX277053	SRA075872	NHR-12_GFP_L3_C.elegans_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	NHR-12_GFP_L3_C.elegans_Input_Rep1;_Caenorhabdi...	NHR-12 L3 InputRep1	NHR-12 L3 InputRep1	OP318(official name : OP318 genotype : unc-119(ed3); wgIs318(nhr-12::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of NHR-12::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-12 transcription factor. made_by : Bob Waterston's lab from UW )|NHR-12 L3 InputRep1|L3	OP318(official name : ...	ChIP-Seq
SRX277054	SRA075872	NHR-12_GFP_L3_C.elegans_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	NHR-12_GFP_L3_C.elegans_Input_Rep2;_Caenorhabdi...	NHR-12 L3 InputRep2	NHR-12 L3 InputRep2	OP318(official name : OP318 genotype : unc-119(ed3); wgIs318(nhr-12::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of NHR-12::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-12 transcription factor. made_by : Bob Waterston's lab from UW )|NHR-12 L3 InputRep2|L3	OP318(official name : ...	ChIP-Seq
SRX277055	SRA075872	NHR-12_GFP_L3_C.elegans_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	NHR-12_GFP_L3_C.elegans_ChIP_Rep1;_Caenorhabdit...	NHR-12 L3 ChIPRep1	NHR-12 L3 ChIPRep1	OP318(official name : OP318 genotype : unc-119(ed3); wgIs318(nhr-12::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of NHR-12::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-12 transcription factor. made_by : Bob Waterston's lab from UW )|NHR-12 L3 ChIPRep1|L3	OP318(official name : ...	ChIP-Seq
SRX277056	SRA075872	NHR-12_GFP_L3_C.elegans_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	NHR-12_GFP_L3_C.elegans_ChIP_Rep2;_Caenorhabdit...	NHR-12 L3 ChIPRep2	NHR-12 L3 ChIPRep2	OP318(official name : OP318 genotype : unc-119(ed3); wgIs318(nhr-12::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of NHR-12::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-12 transcription factor. made_by : Bob Waterston's lab from UW )|NHR-12 L3 ChIPRep2|L3	OP318(official name : ...	ChIP-Seq
SRX277057	SRA075873	ZTF-4_GFP_L1_C.elegans_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	ZTF-4_GFP_L1_C.elegans_Input_Rep1;_Caenorhabdit...	ZTF-4 L1 InputRep1	ZTF-4 L1 InputRep1	OP322(official name : OP322 genotype : unc-119(ed3); wgIs322(ztf-4::TY1 EGFP FLAG; unc119(+)) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of ZTF-4::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZTF-4 transcription factor. made_by : Bob Waterston's lab from UW )|ZTF-4 L1 InputRep1|L1 26dC	OP322(official name : ...	ChIP-Seq
SRX277058	SRA075873	ZTF-4_GFP_L1_C.elegans_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	ZTF-4_GFP_L1_C.elegans_Input_Rep2;_Caenorhabdit...	ZTF-4 L1 InputRep2	ZTF-4 L1 InputRep2	OP322(official name : OP322 genotype : unc-119(ed3); wgIs322(ztf-4::TY1 EGFP FLAG; unc119(+)) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of ZTF-4::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZTF-4 transcription factor. made_by : Bob Waterston's lab from UW )|ZTF-4 L1 InputRep2|L1 26dC	OP322(official name : ...	ChIP-Seq
SRX277059	SRA075873	ZTF-4_GFP_L1_C.elegans_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	ZTF-4_GFP_L1_C.elegans_ChIP_Rep1;_Caenorhabditi...	ZTF-4 L1 ChIPRep1	ZTF-4 L1 ChIPRep1	OP322(official name : OP322 genotype : unc-119(ed3); wgIs322(ztf-4::TY1 EGFP FLAG; unc119(+)) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of ZTF-4::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZTF-4 transcription factor. made_by : Bob Waterston's lab from UW )|ZTF-4 L1 ChIPRep1|L1 26dC	OP322(official name : ...	ChIP-Seq
SRX277060	SRA075873	ZTF-4_GFP_L1_C.elegans_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	ZTF-4_GFP_L1_C.elegans_ChIP_Rep2;_Caenorhabditi...	ZTF-4 L1 ChIPRep2	ZTF-4 L1 ChIPRep2	OP322(official name : OP322 genotype : unc-119(ed3); wgIs322(ztf-4::TY1 EGFP FLAG; unc119(+)) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of ZTF-4::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZTF-4 transcription factor. made_by : Bob Waterston's lab from UW )|ZTF-4 L1 ChIPRep2|L1 26dC	OP322(official name : ...	ChIP-Seq
SRX277061	SRA075874	NHR-10_GFP_L4_C.elegans_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	NHR-10_GFP_L4_C.elegans_Input_Rep1;_Caenorhabdi...	NHR-10 L4 InputRep1	NHR-10 L4 InputRep1	OP239(official name : OP239 genotype : unc119(ed3); wgIs239(nhr-10::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-10::EGFP fusion protein is expressed in the correct nhr-10 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-10 transcription factor. made_by : Unknown )|NHR-10 L4 InputRep1|L4	OP239(official name : ...	ChIP-Seq
SRX277062	SRA075874	NHR-10_GFP_L4_C.elegans_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	NHR-10_GFP_L4_C.elegans_Input_Rep2;_Caenorhabdi...	NHR-10 L4 InputRep2	NHR-10 L4 InputRep2	OP239(official name : OP239 genotype : unc119(ed3); wgIs239(nhr-10::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-10::EGFP fusion protein is expressed in the correct nhr-10 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-10 transcription factor. made_by : Unknown )|NHR-10 L4 InputRep2|L4	OP239(official name : ...	ChIP-Seq
SRX277063	SRA075874	NHR-10_GFP_L4_C.elegans_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	NHR-10_GFP_L4_C.elegans_ChIP_Rep1;_Caenorhabdit...	NHR-10 L4 ChIPRep1	NHR-10 L4 ChIPRep1	OP239(official name : OP239 genotype : unc119(ed3); wgIs239(nhr-10::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-10::EGFP fusion protein is expressed in the correct nhr-10 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-10 transcription factor. made_by : Unknown )|NHR-10 L4 ChIPRep1|L4	OP239(official name : ...	ChIP-Seq
SRX277064	SRA075874	NHR-10_GFP_L4_C.elegans_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	NHR-10_GFP_L4_C.elegans_ChIP_Rep2;_Caenorhabdit...	NHR-10 L4 ChIPRep2	NHR-10 L4 ChIPRep2	OP239(official name : OP239 genotype : unc119(ed3); wgIs239(nhr-10::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-10::EGFP fusion protein is expressed in the correct nhr-10 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-10 transcription factor. made_by : Unknown )|NHR-10 L4 ChIPRep2|L4	OP239(official name : ...	ChIP-Seq
SRX277065	SRA075875	CEH-28_GFP_L4_C.elegans_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	CEH-28_GFP_L4_C.elegans_Input_Rep1;_Caenorhabdi...	CEH-28 L4 InputRep1	CEH-28 L4 InputRep1	OP241(official name : OP241 genotype : unc119(ed3); wgIs241(ceh-38::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CEH-38::EGFP fusion protein is expressed in the correct ceh-38 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CEH-38 transcription factor. made_by : Unknwon )|CEH-28 L4 InputRep1|L4	OP241(official name : ...	ChIP-Seq
SRX277066	SRA075875	CEH-28_GFP_L4_C.elegans_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	CEH-28_GFP_L4_C.elegans_Input_Rep2;_Caenorhabdi...	CEH-28 L4 InputRep2	CEH-28 L4 InputRep2	OP241(official name : OP241 genotype : unc119(ed3); wgIs241(ceh-38::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CEH-38::EGFP fusion protein is expressed in the correct ceh-38 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CEH-38 transcription factor. made_by : Unknwon )|CEH-28 L4 InputRep2|L4	OP241(official name : ...	ChIP-Seq
SRX277067	SRA075875	CEH-28_GFP_L4_C.elegans_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	CEH-28_GFP_L4_C.elegans_ChIP_Rep1;_Caenorhabdit...	CEH-28 L4 ChIPRep1	CEH-28 L4 ChIPRep1	OP241(official name : OP241 genotype : unc119(ed3); wgIs241(ceh-38::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CEH-38::EGFP fusion protein is expressed in the correct ceh-38 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CEH-38 transcription factor. made_by : Unknwon )|CEH-28 L4 ChIPRep1|L4	OP241(official name : ...	ChIP-Seq
SRX277068	SRA075875	CEH-28_GFP_L4_C.elegans_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	CEH-28_GFP_L4_C.elegans_ChIP_Rep2;_Caenorhabdit...	CEH-28 L4 ChIPRep2	CEH-28 L4 ChIPRep2	OP241(official name : OP241 genotype : unc119(ed3); wgIs241(ceh-38::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CEH-38::EGFP fusion protein is expressed in the correct ceh-38 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CEH-38 transcription factor. made_by : Unknwon )|CEH-28 L4 ChIPRep2|L4	OP241(official name : ...	ChIP-Seq
SRX277069	SRA075876	CEH-28_GFP_L3_C.elegans_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	CEH-28_GFP_L3_C.elegans_Input_Rep1;_Caenorhabdi...	CEH-28 L3 InputRep1	CEH-28 L3 InputRep1	OP241(official name : OP241 genotype : unc119(ed3); wgIs241(ceh-38::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CEH-38::EGFP fusion protein is expressed in the correct ceh-38 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CEH-38 transcription factor. made_by : Unknwon )|CEH-28 L3 InputRep1|L3	OP241(official name : ...	ChIP-Seq
SRX277070	SRA075876	CEH-28_GFP_L3_C.elegans_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	CEH-28_GFP_L3_C.elegans_Input_Rep2;_Caenorhabdi...	CEH-28 L3 InputRep2	CEH-28 L3 InputRep2	OP241(official name : OP241 genotype : unc119(ed3); wgIs241(ceh-38::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CEH-38::EGFP fusion protein is expressed in the correct ceh-38 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CEH-38 transcription factor. made_by : Unknwon )|CEH-28 L3 InputRep2|L3	OP241(official name : ...	ChIP-Seq
SRX277071	SRA075876	CEH-28_GFP_L3_C.elegans_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	CEH-28_GFP_L3_C.elegans_ChIP_Rep1;_Caenorhabdit...	CEH-28 L3 ChIPRep1	CEH-28 L3 ChIPRep1	OP241(official name : OP241 genotype : unc119(ed3); wgIs241(ceh-38::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CEH-38::EGFP fusion protein is expressed in the correct ceh-38 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CEH-38 transcription factor. made_by : Unknwon )|CEH-28 L3 ChIPRep1|L3	OP241(official name : ...	ChIP-Seq
SRX277072	SRA075876	CEH-28_GFP_L3_C.elegans_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	CEH-28_GFP_L3_C.elegans_ChIP_Rep2;_Caenorhabdit...	CEH-28 L3 ChIPRep2	CEH-28 L3 ChIPRep2	OP241(official name : OP241 genotype : unc119(ed3); wgIs241(ceh-38::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CEH-38::EGFP fusion protein is expressed in the correct ceh-38 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CEH-38 transcription factor. made_by : Unknwon )|CEH-28 L3 ChIPRep2|L3	OP241(official name : ...	ChIP-Seq
SRX277073	SRA075877	LSY-2_GFP_L2_v2_C.elegans_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	LSY-2_GFP_L2_v2_C.elegans_Input_Rep1;_Caenorhab...	LSY-2 L2 v2 InputRep1	LSY-2 L2 v2 InputRep1	OP240(official name : OP240 genotype : unc119(ed3); wgIs240(lsy-2::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LSY-2::EGFP fusion protein is expressed in the correct lsy-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LSY-2 transcription factor. made_by : Unknown )|LSY-2 L2 v2 InputRep1|L2	OP240(official name : ...	ChIP-Seq
SRX277074	SRA075877	LSY-2_GFP_L2_v2_C.elegans_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	LSY-2_GFP_L2_v2_C.elegans_Input_Rep2;_Caenorhab...	LSY-2 L2 v2 InputRep2	LSY-2 L2 v2 InputRep2	OP240(official name : OP240 genotype : unc119(ed3); wgIs240(lsy-2::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LSY-2::EGFP fusion protein is expressed in the correct lsy-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LSY-2 transcription factor. made_by : Unknown )|LSY-2 L2 v2 InputRep2|L2	OP240(official name : ...	ChIP-Seq
SRX277075	SRA075877	LSY-2_GFP_L2_v2_C.elegans_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	LSY-2_GFP_L2_v2_C.elegans_ChIP_Rep1;_Caenorhabd...	LSY-2 L2 v2 ChIPRep1	LSY-2 L2 v2 ChIPRep1	OP240(official name : OP240 genotype : unc119(ed3); wgIs240(lsy-2::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LSY-2::EGFP fusion protein is expressed in the correct lsy-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LSY-2 transcription factor. made_by : Unknown )|LSY-2 L2 v2 ChIPRep1|L2	OP240(official name : ...	ChIP-Seq
SRX277076	SRA075877	LSY-2_GFP_L2_v2_C.elegans_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	LSY-2_GFP_L2_v2_C.elegans_ChIP_Rep2;_Caenorhabd...	LSY-2 L2 v2 ChIPRep2	LSY-2 L2 v2 ChIPRep2	OP240(official name : OP240 genotype : unc119(ed3); wgIs240(lsy-2::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LSY-2::EGFP fusion protein is expressed in the correct lsy-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LSY-2 transcription factor. made_by : Unknown )|LSY-2 L2 v2 ChIPRep2|L2	OP240(official name : ...	ChIP-Seq
SRX277077	SRA075878	LSY-2_GFP_L4_v2_C.elegans_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	LSY-2_GFP_L4_v2_C.elegans_Input_Rep1;_Caenorhab...	LSY-2 L4 v2 InputRep1	LSY-2 L4 v2 InputRep1	OP240(official name : OP240 genotype : unc119(ed3); wgIs240(lsy-2::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LSY-2::EGFP fusion protein is expressed in the correct lsy-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LSY-2 transcription factor. made_by : Unknown )|LSY-2 L4 v2 InputRep1|L4	OP240(official name : ...	ChIP-Seq
SRX277078	SRA075878	LSY-2_GFP_L4_v2_C.elegans_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	LSY-2_GFP_L4_v2_C.elegans_Input_Rep2;_Caenorhab...	LSY-2 L4 v2 InputRep2	LSY-2 L4 v2 InputRep2	OP240(official name : OP240 genotype : unc119(ed3); wgIs240(lsy-2::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LSY-2::EGFP fusion protein is expressed in the correct lsy-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LSY-2 transcription factor. made_by : Unknown )|LSY-2 L4 v2 InputRep2|L4	OP240(official name : ...	ChIP-Seq
SRX277079	SRA075878	LSY-2_GFP_L4_v2_C.elegans_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	LSY-2_GFP_L4_v2_C.elegans_ChIP_Rep1;_Caenorhabd...	LSY-2 L4 v2 ChIPRep1	LSY-2 L4 v2 ChIPRep1	OP240(official name : OP240 genotype : unc119(ed3); wgIs240(lsy-2::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LSY-2::EGFP fusion protein is expressed in the correct lsy-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LSY-2 transcription factor. made_by : Unknown )|LSY-2 L4 v2 ChIPRep1|L4	OP240(official name : ...	ChIP-Seq
SRX277080	SRA075878	LSY-2_GFP_L4_v2_C.elegans_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	LSY-2_GFP_L4_v2_C.elegans_ChIP_Rep2;_Caenorhabd...	LSY-2 L4 v2 ChIPRep2	LSY-2 L4 v2 ChIPRep2	OP240(official name : OP240 genotype : unc119(ed3); wgIs240(lsy-2::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LSY-2::EGFP fusion protein is expressed in the correct lsy-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LSY-2 transcription factor. made_by : Unknown )|LSY-2 L4 v2 ChIPRep2|L4	OP240(official name : ...	ChIP-Seq
SRX277082	SRA075880	NHR-12_GFP_EMB_C.elegans_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	NHR-12_GFP_EMB_C.elegans_Input_Rep1;_Caenorhabd...	NHR-12 EMB InputRep1	NHR-12 EMB InputRep1	OP318(official name : OP318 genotype : unc-119(ed3); wgIs318(nhr-12::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of NHR-12::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-12 transcription factor. made_by : Bob Waterston's lab from UW )|NHR-12 EMB InputRep1|embryo	OP318(official name : ...	ChIP-Seq
SRX277083	SRA075880	NHR-12_GFP_EMB_C.elegans_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	NHR-12_GFP_EMB_C.elegans_Input_Rep2;_Caenorhabd...	NHR-12 EMB InputRep2	NHR-12 EMB InputRep2	OP318(official name : OP318 genotype : unc-119(ed3); wgIs318(nhr-12::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of NHR-12::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-12 transcription factor. made_by : Bob Waterston's lab from UW )|NHR-12 EMB InputRep2|embryo	OP318(official name : ...	ChIP-Seq
SRX277084	SRA075880	NHR-12_GFP_EMB_C.elegans_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	NHR-12_GFP_EMB_C.elegans_ChIP_Rep1;_Caenorhabdi...	NHR-12 EMB ChIPRep1	NHR-12 EMB ChIPRep1	OP318(official name : OP318 genotype : unc-119(ed3); wgIs318(nhr-12::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of NHR-12::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-12 transcription factor. made_by : Bob Waterston's lab from UW )|NHR-12 EMB ChIPRep1|embryo	OP318(official name : ...	ChIP-Seq
SRX277085	SRA075880	NHR-12_GFP_EMB_C.elegans_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	NHR-12_GFP_EMB_C.elegans_ChIP_Rep2;_Caenorhabdi...	NHR-12 EMB ChIPRep2	NHR-12 EMB ChIPRep2	OP318(official name : OP318 genotype : unc-119(ed3); wgIs318(nhr-12::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of NHR-12::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-12 transcription factor. made_by : Bob Waterston's lab from UW )|NHR-12 EMB ChIPRep2|embryo	OP318(official name : ...	ChIP-Seq
SRX277086	SRA075881	LIN-13_GFP_L1_C.elegans_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	LIN-13_GFP_L1_C.elegans_Input_Rep1;_Caenorhabdi...	LIN-13 L1 InputRep1	LIN-13 L1 InputRep1	OP49(official name : OP49 genotype : unc119(ed3); wgIs49(lin-13::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-13::EGFP fusion protein is expressed in the correct lin-13 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-13 transcription factor. made_by : Unknown )|LIN-13 L1 InputRep1|L1 26dC	OP49(official name : O...	ChIP-Seq
SRX277087	SRA075881	LIN-13_GFP_L1_C.elegans_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	LIN-13_GFP_L1_C.elegans_Input_Rep2;_Caenorhabdi...	LIN-13 L1 InputRep2	LIN-13 L1 InputRep2	OP49(official name : OP49 genotype : unc119(ed3); wgIs49(lin-13::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-13::EGFP fusion protein is expressed in the correct lin-13 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-13 transcription factor. made_by : Unknown )|LIN-13 L1 InputRep2|L1 26dC	OP49(official name : O...	ChIP-Seq
SRX277088	SRA075881	LIN-13_GFP_L1_C.elegans_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	LIN-13_GFP_L1_C.elegans_ChIP_Rep1;_Caenorhabdit...	LIN-13 L1 ChIPRep1	LIN-13 L1 ChIPRep1	OP49(official name : OP49 genotype : unc119(ed3); wgIs49(lin-13::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-13::EGFP fusion protein is expressed in the correct lin-13 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-13 transcription factor. made_by : Unknown )|LIN-13 L1 ChIPRep1|L1 26dC	OP49(official name : O...	ChIP-Seq
SRX277089	SRA075881	LIN-13_GFP_L1_C.elegans_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	LIN-13_GFP_L1_C.elegans_ChIP_Rep2;_Caenorhabdit...	LIN-13 L1 ChIPRep2	LIN-13 L1 ChIPRep2	OP49(official name : OP49 genotype : unc119(ed3); wgIs49(lin-13::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-13::EGFP fusion protein is expressed in the correct lin-13 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-13 transcription factor. made_by : Unknown )|LIN-13 L1 ChIPRep2|L1 26dC	OP49(official name : O...	ChIP-Seq
SRX277090	SRA075882	LIN-13_GFP_L2_C.elegans_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	LIN-13_GFP_L2_C.elegans_Input_Rep1;_Caenorhabdi...	LIN-13 L2 InputRep1	LIN-13 L2 InputRep1	OP49(official name : OP49 genotype : unc119(ed3); wgIs49(lin-13::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-13::EGFP fusion protein is expressed in the correct lin-13 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-13 transcription factor. made_by : Unknown )|LIN-13 L2 InputRep1|L2	OP49(official name : O...	ChIP-Seq
SRX277091	SRA075882	LIN-13_GFP_L2_C.elegans_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	LIN-13_GFP_L2_C.elegans_Input_Rep2;_Caenorhabdi...	LIN-13 L2 InputRep2	LIN-13 L2 InputRep2	OP49(official name : OP49 genotype : unc119(ed3); wgIs49(lin-13::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-13::EGFP fusion protein is expressed in the correct lin-13 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-13 transcription factor. made_by : Unknown )|LIN-13 L2 InputRep2|L2	OP49(official name : O...	ChIP-Seq
SRX277092	SRA075882	LIN-13_GFP_L2_C.elegans_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	LIN-13_GFP_L2_C.elegans_ChIP_Rep1;_Caenorhabdit...	LIN-13 L2 ChIPRep1	LIN-13 L2 ChIPRep1	OP49(official name : OP49 genotype : unc119(ed3); wgIs49(lin-13::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-13::EGFP fusion protein is expressed in the correct lin-13 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-13 transcription factor. made_by : Unknown )|LIN-13 L2 ChIPRep1|L2	OP49(official name : O...	ChIP-Seq
SRX277093	SRA075882	LIN-13_GFP_L2_C.elegans_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	LIN-13_GFP_L2_C.elegans_ChIP_Rep2;_Caenorhabdit...	LIN-13 L2 ChIPRep2	LIN-13 L2 ChIPRep2	OP49(official name : OP49 genotype : unc119(ed3); wgIs49(lin-13::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-13::EGFP fusion protein is expressed in the correct lin-13 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-13 transcription factor. made_by : Unknown )|LIN-13 L2 ChIPRep2|L2	OP49(official name : O...	ChIP-Seq
SRX277094	SRA075883	LIN-13_GFP_L4_C.elegans_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	LIN-13_GFP_L4_C.elegans_Input_Rep1;_Caenorhabdi...	LIN-13 L4 InputRep1	LIN-13 L4 InputRep1	OP49(official name : OP49 genotype : unc119(ed3); wgIs49(lin-13::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-13::EGFP fusion protein is expressed in the correct lin-13 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-13 transcription factor. made_by : Unknown )|LIN-13 L4 InputRep1|L4	OP49(official name : O...	ChIP-Seq
SRX277095	SRA075883	LIN-13_GFP_L4_C.elegans_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	LIN-13_GFP_L4_C.elegans_Input_Rep2;_Caenorhabdi...	LIN-13 L4 InputRep2	LIN-13 L4 InputRep2	OP49(official name : OP49 genotype : unc119(ed3); wgIs49(lin-13::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-13::EGFP fusion protein is expressed in the correct lin-13 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-13 transcription factor. made_by : Unknown )|LIN-13 L4 InputRep2|L4	OP49(official name : O...	ChIP-Seq
SRX277096	SRA075883	LIN-13_GFP_L4_C.elegans_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	LIN-13_GFP_L4_C.elegans_ChIP_Rep1;_Caenorhabdit...	LIN-13 L4 ChIPRep1	LIN-13 L4 ChIPRep1	OP49(official name : OP49 genotype : unc119(ed3); wgIs49(lin-13::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-13::EGFP fusion protein is expressed in the correct lin-13 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-13 transcription factor. made_by : Unknown )|LIN-13 L4 ChIPRep1|L4	OP49(official name : O...	ChIP-Seq
SRX277097	SRA075883	LIN-13_GFP_L4_C.elegans_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	LIN-13_GFP_L4_C.elegans_ChIP_Rep2;_Caenorhabdit...	LIN-13 L4 ChIPRep2	LIN-13 L4 ChIPRep2	OP49(official name : OP49 genotype : unc119(ed3); wgIs49(lin-13::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-13::EGFP fusion protein is expressed in the correct lin-13 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-13 transcription factor. made_by : Unknown )|LIN-13 L4 ChIPRep2|L4	OP49(official name : O...	ChIP-Seq
SRX277098	SRA075884	ZTF-4_GFP_L2_C.elegans_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	ZTF-4_GFP_L2_C.elegans_Input_Rep1;_Caenorhabdit...	ZTF-4 L2 InputRep1	ZTF-4 L2 InputRep1	OP322(official name : OP322 genotype : unc-119(ed3); wgIs322(ztf-4::TY1 EGFP FLAG; unc119(+)) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of ZTF-4::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZTF-4 transcription factor. made_by : Bob Waterston's lab from UW )|ZTF-4 L2 InputRep1|L2	OP322(official name : ...	ChIP-Seq
SRX277099	SRA075884	ZTF-4_GFP_L2_C.elegans_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	ZTF-4_GFP_L2_C.elegans_Input_Rep2;_Caenorhabdit...	ZTF-4 L2 InputRep2	ZTF-4 L2 InputRep2	OP322(official name : OP322 genotype : unc-119(ed3); wgIs322(ztf-4::TY1 EGFP FLAG; unc119(+)) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of ZTF-4::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZTF-4 transcription factor. made_by : Bob Waterston's lab from UW )|ZTF-4 L2 InputRep2|L2	OP322(official name : ...	ChIP-Seq
SRX277100	SRA075884	ZTF-4_GFP_L2_C.elegans_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	ZTF-4_GFP_L2_C.elegans_ChIP_Rep1;_Caenorhabditi...	ZTF-4 L2 ChIPRep1	ZTF-4 L2 ChIPRep1	OP322(official name : OP322 genotype : unc-119(ed3); wgIs322(ztf-4::TY1 EGFP FLAG; unc119(+)) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of ZTF-4::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZTF-4 transcription factor. made_by : Bob Waterston's lab from UW )|ZTF-4 L2 ChIPRep1|L2	OP322(official name : ...	ChIP-Seq
SRX277101	SRA075884	ZTF-4_GFP_L2_C.elegans_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	ZTF-4_GFP_L2_C.elegans_ChIP_Rep2;_Caenorhabditi...	ZTF-4 L2 ChIPRep2	ZTF-4 L2 ChIPRep2	OP322(official name : OP322 genotype : unc-119(ed3); wgIs322(ztf-4::TY1 EGFP FLAG; unc119(+)) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of ZTF-4::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZTF-4 transcription factor. made_by : Bob Waterston's lab from UW )|ZTF-4 L2 ChIPRep2|L2	OP322(official name : ...	ChIP-Seq
SRX277102	SRA075885	NHR-21_GFP_L2_C.elegans_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	NHR-21_GFP_L2_C.elegans_Input_Rep1;_Caenorhabdi...	NHR-21 L2 InputRep1	NHR-21 L2 InputRep1	OP361(official name : OP361 genotype : unc119(ed3); wgIs361(nhr-21::TY1-GFP-3xFLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-21::EGFP fusion protein is expressed in the correct nhr-21 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-21 transcription factor. made_by : Unknown )|NHR-21 L2 InputRep1|L2	OP361(official name : ...	ChIP-Seq
SRX277103	SRA075885	NHR-21_GFP_L2_C.elegans_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	NHR-21_GFP_L2_C.elegans_Input_Rep2;_Caenorhabdi...	NHR-21 L2 InputRep2	NHR-21 L2 InputRep2	OP361(official name : OP361 genotype : unc119(ed3); wgIs361(nhr-21::TY1-GFP-3xFLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-21::EGFP fusion protein is expressed in the correct nhr-21 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-21 transcription factor. made_by : Unknown )|NHR-21 L2 InputRep2|L2	OP361(official name : ...	ChIP-Seq
SRX277104	SRA075885	NHR-21_GFP_L2_C.elegans_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	NHR-21_GFP_L2_C.elegans_ChIP_Rep1;_Caenorhabdit...	NHR-21 L2 ChIPRep1	NHR-21 L2 ChIPRep1	OP361(official name : OP361 genotype : unc119(ed3); wgIs361(nhr-21::TY1-GFP-3xFLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-21::EGFP fusion protein is expressed in the correct nhr-21 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-21 transcription factor. made_by : Unknown )|NHR-21 L2 ChIPRep1|L2	OP361(official name : ...	ChIP-Seq
SRX277105	SRA075885	NHR-21_GFP_L2_C.elegans_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	NHR-21_GFP_L2_C.elegans_ChIP_Rep2;_Caenorhabdit...	NHR-21 L2 ChIPRep2	NHR-21 L2 ChIPRep2	OP361(official name : OP361 genotype : unc119(ed3); wgIs361(nhr-21::TY1-GFP-3xFLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-21::EGFP fusion protein is expressed in the correct nhr-21 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-21 transcription factor. made_by : Unknown )|NHR-21 L2 ChIPRep2|L2	OP361(official name : ...	ChIP-Seq
SRX278065	SRA076537	Illumina_chromatin_immunoprecipitates_sequencing_of_genomic_DNA_library_'Solexa-8941'_containing_sample_Post-dauer_H3	Illumina_chromatin_immunoprecipitates_sequencin...	NoAb	ND	missing	missing	ChIP-Seq
SRX278066	SRA076537	Illumina_chromatin_immunoprecipitates_sequencing_of_genomic_DNA_library_'Solexa-8940'_containing_sample_Control_H3	Illumina_chromatin_immunoprecipitates_sequencin...	NoAb	ND	missing	missing	ChIP-Seq
SRX278067	SRA076537	Illumina_chromatin_immunoprecipitates_sequencing_of_genomic_DNA_library_'Solexa-1529'_containing_sample_BROAD:SEQUENCING_SAMPLE:16576.0	Illumina_chromatin_immunoprecipitates_sequencin...	NoAb	ND	N2	N2	ChIP-Seq
SRX278068	SRA076537	Illumina_chromatin_immunoprecipitates_sequencing_of_genomic_DNA_library_'Solexa-8939'_containing_sample_Control_Input	Illumina_chromatin_immunoprecipitates_sequencin...	NoAb	ND	missing	missing	ChIP-Seq
SRX278069	SRA076537	Illumina_chromatin_immunoprecipitates_sequencing_of_genomic_DNA_library_'Solexa-1527'_containing_sample_BROAD:SEQUENCING_SAMPLE:16476.0	Illumina_chromatin_immunoprecipitates_sequencin...	NoAb	ND	N2	N2	ChIP-Seq
SRX278070	SRA076537	Illumina_chromatin_immunoprecipitates_sequencing_of_genomic_DNA_library_'Solexa-1512'_containing_sample_BROAD:SEQUENCING_SAMPLE:16471.0	Illumina_chromatin_immunoprecipitates_sequencin...	NoAb	ND	N2	N2	ChIP-Seq
SRX278071	SRA076537	Illumina_chromatin_immunoprecipitates_sequencing_of_genomic_DNA_library_'Solexa-1527'_containing_sample_BROAD:SEQUENCING_SAMPLE:16476.0	Illumina_chromatin_immunoprecipitates_sequencin...	NoAb	ND	N2	N2	ChIP-Seq
SRX278072	SRA076537	Illumina_chromatin_immunoprecipitates_sequencing_of_genomic_DNA_library_'Solexa-1512'_containing_sample_BROAD:SEQUENCING_SAMPLE:16471.0	Illumina_chromatin_immunoprecipitates_sequencin...	NoAb	ND	N2	N2	ChIP-Seq
SRX2958247	SRA442118	N2_(ChIP);_Caenorhabditis_elegans;_ChIP-Seq	N2_(ChIP);_Caenorhabditis_elegans;_ChIP-Seq	mixed stage embryos	mixed stage embryos	N2|mixed stage embryos	N2	ChIP-Seq
SRX2958248	SRA442118	dpy-21(y607)_(ChIP);_Caenorhabditis_elegans;_ChIP-Seq	dpy-21(y607)_(ChIP);_Caenorhabditis_elegans;_Ch...	mixed stage embryos	mixed stage embryos	dpy-21(y607)|mixed stage embryos	dpy-21(y607)	ChIP-Seq
SRX2958249	SRA442118	dpy-21(e428)_(ChIP);_Caenorhabditis_elegans;_ChIP-Seq	dpy-21(e428)_(ChIP);_Caenorhabditis_elegans;_Ch...	mixed stage embryos	mixed stage embryos	dpy-21(e428)|mixed stage embryos	dpy-21(e428)	ChIP-Seq
SRX2965733	SRA582291	SET-9GFP_rep1_ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	SET-9GFP_rep1_ChIPseq;_Caenorhabditis_elegans;_...	anti-GFP (abcam, ab290, lot:GR278073-1)|set-9::gfp_whole_worm	anti-GFP (abcam, ab290...	set-9::gfp_whole_worm|L4	set-9::gfp_whole_worm	ChIP-Seq
SRX2965734	SRA582291	SET-9GFP_rep2_ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	SET-9GFP_rep2_ChIPseq;_Caenorhabditis_elegans;_...	anti-GFP (abcam, ab290, lot:GR278073-1)|set-9::gfp_whole_worm	anti-GFP (abcam, ab290...	set-9::gfp_whole_worm|L4	set-9::gfp_whole_worm	ChIP-Seq
SRX2965735	SRA582291	SET-26GFP_rep1_ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	SET-26GFP_rep1_ChIPseq;_Caenorhabditis_elegans;...	anti-GFP (abcam, ab290, lot:GR278073-1)|set-26::gfp_whole_worm	anti-GFP (abcam, ab290...	set-26::gfp_whole_worm|L4	set-26::gfp_whole_worm	ChIP-Seq
SRX2965736	SRA582291	SET-26GFP_rep2_ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	SET-26GFP_rep2_ChIPseq;_Caenorhabditis_elegans;...	anti-GFP (abcam, ab290, lot:GR278073-1)|set-26::gfp_whole_worm	anti-GFP (abcam, ab290...	set-26::gfp_whole_worm|L4	set-26::gfp_whole_worm	ChIP-Seq
SRX2965737	SRA582291	SET-9/26GFP_rep1_ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	SET-9/26GFP_rep1_ChIPseq;_Caenorhabditis_elegan...	anti-GFP (abcam, ab290, lot:GR278073-1)|set-9::gfpset-26::gfp_whole_worm	anti-GFP (abcam, ab290...	set-9::gfpset-26::gfp_whole_worm|L4	set-9::gfpset-26::gfp_...	ChIP-Seq
SRX2965738	SRA582291	SET-9/26GFP_rep2_ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	SET-9/26GFP_rep2_ChIPseq;_Caenorhabditis_elegan...	anti-GFP (abcam, ab290, lot:GR278073-1)|set-9::gfpset-26::gfp_whole_worm	anti-GFP (abcam, ab290...	set-9::gfpset-26::gfp_whole_worm|L4	set-9::gfpset-26::gfp_...	ChIP-Seq
SRX2965739	SRA582291	input_rep1_ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	input_rep1_ChIPseq;_Caenorhabditis_elegans;_ChI...	anti-GFP (abcam, ab290, lot:GR278073-1)|mix_of_set-9::gfp/set-26::gfp_whole_worm	anti-GFP (abcam, ab290...	mix_of_set-9::gfp/set-26::gfp_whole_worm|L4	mix_of_set-9::gfp/set-...	ChIP-Seq
SRX2965740	SRA582291	input_rep2_ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	input_rep2_ChIPseq;_Caenorhabditis_elegans;_ChI...	anti-GFP (abcam, ab290, lot:GR278073-1)|mix_of_set-9::gfp/set-26::gfp_whole_worm	anti-GFP (abcam, ab290...	mix_of_set-9::gfp/set-26::gfp_whole_worm|L4	mix_of_set-9::gfp/set-...	ChIP-Seq
SRX2965741	SRA582291	wt_rep1_H3K4me3ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	wt_rep1_H3K4me3ChIPseq;_Caenorhabditis_elegans;...	H3K4me3 (Millipore, 17-614, lot:2756917)|N2_whole_worm	H3K4me3 (Millipore, 17...	N2_whole_worm|L4	N2_whole_worm	ChIP-Seq
SRX2965742	SRA582291	wt_rep2_H3K4me3ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	wt_rep2_H3K4me3ChIPseq;_Caenorhabditis_elegans;...	H3K4me3 (Millipore, 17-614, lot:2756917)|N2_whole_worm	H3K4me3 (Millipore, 17...	N2_whole_worm|L4	N2_whole_worm	ChIP-Seq
SRX2965743	SRA582291	set9set26_rep1_H3K4me3ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	set9set26_rep1_H3K4me3ChIPseq;_Caenorhabditis_e...	H3K4me3 (Millipore, 17-614, lot:2756917)|set-9set-26_whole_worm	H3K4me3 (Millipore, 17...	set-9set-26_whole_worm|L4	set-9set-26_whole_worm	ChIP-Seq
SRX2965744	SRA582291	set9set26_rep2_H3K4me3ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	set9set26_rep2_H3K4me3ChIPseq;_Caenorhabditis_e...	H3K4me3 (Millipore, 17-614, lot:2756917)|set-9set-26_whole_worm	H3K4me3 (Millipore, 17...	set-9set-26_whole_worm|L4	set-9set-26_whole_worm	ChIP-Seq
SRX2965745	SRA582291	wt_rep1_H3ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	wt_rep1_H3ChIPseq;_Caenorhabditis_elegans;_ChIP...	anti-H3 (abcam, ab1791, lot:GR135488-1)|N2_whole_worm	anti-H3 (abcam, ab1791...	N2_whole_worm|L4	N2_whole_worm	ChIP-Seq
SRX2965746	SRA582291	wt_rep2_H3ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	wt_rep2_H3ChIPseq;_Caenorhabditis_elegans;_ChIP...	anti-H3 (abcam, ab1791, lot:GR135488-1)|N2_whole_worm	anti-H3 (abcam, ab1791...	N2_whole_worm|L4	N2_whole_worm	ChIP-Seq
SRX2965747	SRA582291	set9set26_rep1_H3ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	set9set26_rep1_H3ChIPseq;_Caenorhabditis_elegan...	anti-H3 (abcam, ab1791, lot:GR135488-1)|set-9set-26_whole_worm	anti-H3 (abcam, ab1791...	set-9set-26_whole_worm|L4	set-9set-26_whole_worm	ChIP-Seq
SRX2965748	SRA582291	set9set26_rep2_H3ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	set9set26_rep2_H3ChIPseq;_Caenorhabditis_elegan...	anti-H3 (abcam, ab1791, lot:GR135488-1)|set-9set-26_whole_worm	anti-H3 (abcam, ab1791...	set-9set-26_whole_worm|L4	set-9set-26_whole_worm	ChIP-Seq
SRX2969570	SRA582407	Wild-type_ATAC-seq;_Caenorhabditis_elegans;_ATAC-seq	Wild-type_ATAC-seq;_Caenorhabditis_elegans;_ATA...	ATAC-seq	ATAC-seq	Sorted L1 PGCs|Starved L1	Sorted L1 PGCs	ATAC-seq
SRX2969571	SRA582407	Wild-type_ATAC-seq_(Replicate);_Caenorhabditis_elegans;_ATAC-seq	Wild-type_ATAC-seq_(Replicate);_Caenorhabditis_...	ATAC-seq	ATAC-seq	Sorted L1 PGCs|Starved L1	Sorted L1 PGCs	ATAC-seq
SRX2969572	SRA582407	nos-1(gv5)_nos-2(RNAi)_ATAC-seq;_Caenorhabditis_elegans;_ATAC-seq	nos-1(gv5)_nos-2(RNAi)_ATAC-seq;_Caenorhabditis...	ATAC-seq	ATAC-seq	Sorted L1 PGCs|Starved L1	Sorted L1 PGCs	ATAC-seq
SRX2969573	SRA582407	nos-1(gv5)_nos-2(RNAi)_ATAC-seq_(Replicate);_Caenorhabditis_elegans;_ATAC-seq	nos-1(gv5)_nos-2(RNAi)_ATAC-seq_(Replicate);_Ca...	ATAC-seq	ATAC-seq	Sorted L1 PGCs|Starved L1	Sorted L1 PGCs	ATAC-seq
SRX2973381	SRA582587	inputrep1ChIPseq	inputrep1ChIPseq	NoAb	ND	pooled_inputDNA|whole_worm|L4	pooled_inputDNA	ChIP-Seq
SRX2973382	SRA582587	inputrep2ChIPseq	inputrep2ChIPseq	NoAb	ND	pooled_inputDNA|whole_worm|L4	pooled_inputDNA	ChIP-Seq
SRX2973383	SRA582587	wtrep1H3K4me3ChIPseq	wtrep1H3K4me3ChIPseq	NoAb	ND	N2|whole_worm|L4	N2	ChIP-Seq
SRX2973384	SRA582587	wtrep2H3K4me3ChIPseq	wtrep2H3K4me3ChIPseq	NoAb	ND	N2|whole_worm|L4	N2	ChIP-Seq
SRX2973385	SRA582587	SET-26GFPrep1ChIPseq	SET-26GFPrep1ChIPseq	NoAb	ND	SET-26::GFP|whole_worm|L4	SET-26::GFP	ChIP-Seq
SRX2973386	SRA582587	SET-26GFPrep2ChIPseq	SET-26GFPrep2ChIPseq	NoAb	ND	SET-26::GFP|whole_worm|L4	SET-26::GFP	ChIP-Seq
SRX2973387	SRA582587	SET-9/26GFPrep1ChIPseq	SET-9/26GFPrep1ChIPseq	NoAb	ND	SET-9::GFP SET-26::GFP|whole_worm|L4	SET-9::GFP SET-26::GFP	ChIP-Seq
SRX2973388	SRA582587	SET-9/26GFPrep2ChIPseq	SET-9/26GFPrep2ChIPseq	NoAb	ND	SET-9::GFP SET-26::GFP|whole_worm|L4	SET-9::GFP SET-26::GFP	ChIP-Seq
SRX2973389	SRA582587	set9set26rep1H3K4me3ChIPseq	set9set26rep1H3K4me3ChIPseq	NoAb	ND	set-9set-26|whole_worm|L4	set-9set-26	ChIP-Seq
SRX2973390	SRA582587	set9set26rep2H3K4me3ChIPseq	set9set26rep2H3K4me3ChIPseq	NoAb	ND	set-9set-26|whole_worm|L4	set-9set-26	ChIP-Seq
SRX2973394	SRA582587	wtrep2H3ChIPseq	wtrep2H3ChIPseq	NoAb	ND	N2|whole_worm|L4	N2	ChIP-Seq
SRX2973395	SRA582587	wtrep1H3ChIPseq	wtrep1H3ChIPseq	NoAb	ND	N2|whole_worm|L4	N2	ChIP-Seq
SRX2973396	SRA582587	set9set26rep2H3ChIPseq	set9set26rep2H3ChIPseq	NoAb	ND	set-9set-26|whole_worm|L4	set-9set-26	ChIP-Seq
SRX2973397	SRA582587	set9set26rep1H3ChIPseq	set9set26rep1H3ChIPseq	NoAb	ND	set-9set-26|whole_worm|L4	set-9set-26	ChIP-Seq
SRX2973398	SRA582587	SET-9GFPrep1ChIPseq	SET-9GFPrep1ChIPseq	NoAb	ND	SET-9::GFP|whole_worm|L4	SET-9::GFP	ChIP-Seq
SRX2973399	SRA582587	SET-9GFPrep2ChIPseq	SET-9GFPrep2ChIPseq	NoAb	ND	SET-9::GFP|whole_worm|L4	SET-9::GFP	ChIP-Seq
SRX2978695	SRA583213	ChIP_H3K9me3_met-2_eemb_20C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP_H3K9me3_met-2_eemb_20C_rep1;_Caenorhabditi...	early embryo	early embryo	met-2(n4256) III|early embryo|early embryo	met-2(n4256) III	ChIP-Seq
SRX2978696	SRA583213	ChIP_H3K9me3_met-2_eemb_20C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP_H3K9me3_met-2_eemb_20C_rep2;_Caenorhabditi...	early embryo	early embryo	met-2(n4256) III|early embryo|early embryo	met-2(n4256) III	ChIP-Seq
SRX2978697	SRA583213	ChIP_H3K9me2_met-2_eemb_20C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP_H3K9me2_met-2_eemb_20C_rep1;_Caenorhabditi...	early embryo	early embryo	met-2(n4256) III|early embryo|early embryo	met-2(n4256) III	ChIP-Seq
SRX2978698	SRA583213	ChIP_H3K9me2_met-2_eemb_20C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP_H3K9me2_met-2_eemb_20C_rep2;_Caenorhabditi...	early embryo	early embryo	met-2(n4256) III|early embryo|early embryo	met-2(n4256) III	ChIP-Seq
SRX2978699	SRA583213	ChIP_H3K9me3_set-25_eemb_20C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP_H3K9me3_set-25_eemb_20C_rep1;_Caenorhabdit...	early embryo	early embryo	set-25(n5021) III|early embryo|early embryo	set-25(n5021) III	ChIP-Seq
SRX2978700	SRA583213	ChIP_H3K9me3_set-25_eemb_20C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP_H3K9me3_set-25_eemb_20C_rep2;_Caenorhabdit...	early embryo	early embryo	set-25(n5021) III|early embryo|early embryo	set-25(n5021) III	ChIP-Seq
SRX2978701	SRA583213	ChIP_H3K9me2_set-25_eemb_20C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP_H3K9me2_set-25_eemb_20C_rep1;_Caenorhabdit...	early embryo	early embryo	set-25(n5021) III|early embryo|early embryo	set-25(n5021) III	ChIP-Seq
SRX2978702	SRA583213	ChIP_H3K9me2_set-25_eemb_20C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP_H3K9me2_set-25_eemb_20C_rep2;_Caenorhabdit...	early embryo	early embryo	set-25(n5021) III|early embryo|early embryo	set-25(n5021) III	ChIP-Seq
SRX2978703	SRA583213	input_H3K9me3_met-2_eemb_20C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	input_H3K9me3_met-2_eemb_20C_rep1;_Caenorhabdit...	early embryo	early embryo	met-2(n4256) III|early embryo|early embryo	met-2(n4256) III	ChIP-Seq
SRX2978704	SRA583213	input_H3K9me3_met-2_eemb_20C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	input_H3K9me3_met-2_eemb_20C_rep2;_Caenorhabdit...	early embryo	early embryo	met-2(n4256) III|early embryo|early embryo	met-2(n4256) III	ChIP-Seq
SRX2978705	SRA583213	input_H3K9me2_met-2_eemb_20C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	input_H3K9me2_met-2_eemb_20C_rep1;_Caenorhabdit...	early embryo	early embryo	met-2(n4256) III|early embryo|early embryo	met-2(n4256) III	ChIP-Seq
SRX2978706	SRA583213	input_H3K9me2_met-2_eemb_20C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	input_H3K9me2_met-2_eemb_20C_rep2;_Caenorhabdit...	early embryo	early embryo	met-2(n4256) III|early embryo|early embryo	met-2(n4256) III	ChIP-Seq
SRX2978707	SRA583213	input_H3K9me3_set-25_eemb_20C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	input_H3K9me3_set-25_eemb_20C_rep1;_Caenorhabdi...	early embryo	early embryo	set-25(n5021) III|early embryo|early embryo	set-25(n5021) III	ChIP-Seq
SRX2978708	SRA583213	input_H3K9me3_set-25_eemb_20C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	input_H3K9me3_set-25_eemb_20C_rep2;_Caenorhabdi...	early embryo	early embryo	set-25(n5021) III|early embryo|early embryo	set-25(n5021) III	ChIP-Seq
SRX2978709	SRA583213	input_H3K9me2_set-25_eemb_20C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	input_H3K9me2_set-25_eemb_20C_rep1;_Caenorhabdi...	early embryo	early embryo	set-25(n5021) III|early embryo|early embryo	set-25(n5021) III	ChIP-Seq
SRX2978710	SRA583213	input_H3K9me2_set-25_eemb_20C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	input_H3K9me2_set-25_eemb_20C_rep2;_Caenorhabdi...	early embryo	early embryo	set-25(n5021) III|early embryo|early embryo	set-25(n5021) III	ChIP-Seq
SRX2985927	SRA584240	N2_Hpl2-1_ChIP;_Caenorhabditis_elegans;_ChIP-Seq	N2_Hpl2-1_ChIP;_Caenorhabditis_elegans;_ChIP-Seq	HPL-2 antibody, Research antibody provided by the Palladino lab|whole worm	HPL-2 antibody, Resear...	N2 (Bristol)|whole worm|young adult	N2 (Bristol)	ChIP-Seq
SRX2985928	SRA584240	N2_Hpl2-2_ChIP;_Caenorhabditis_elegans;_ChIP-Seq	N2_Hpl2-2_ChIP;_Caenorhabditis_elegans;_ChIP-Seq	HPL-2 antibody, Research antibody provided by the Palladino lab|whole worm	HPL-2 antibody, Resear...	N2 (Bristol)|whole worm|young adult	N2 (Bristol)	ChIP-Seq
SRX2985929	SRA584240	Tdp_1_Hpl2-1_ChIP;_Caenorhabditis_elegans;_ChIP-Seq	Tdp_1_Hpl2-1_ChIP;_Caenorhabditis_elegans;_ChIP...	HPL-2 antibody, Research antibody provided by the Palladino lab|whole worm	HPL-2 antibody, Resear...	tdp-1(ok803)|whole worm|young adult	tdp-1(ok803)	ChIP-Seq
SRX2985930	SRA584240	Tdp_1_Hpl2-2_ChIP;_Caenorhabditis_elegans;_ChIP-Seq	Tdp_1_Hpl2-2_ChIP;_Caenorhabditis_elegans;_ChIP...	HPL-2 antibody, Research antibody provided by the Palladino lab|whole worm	HPL-2 antibody, Resear...	tdp-1(ok803)|whole worm|young adult	tdp-1(ok803)	ChIP-Seq
SRX2985937	SRA584240	N2_genomic_control;_Caenorhabditis_elegans;_ChIP-Seq	N2_genomic_control;_Caenorhabditis_elegans;_ChI...	none|whole worm	none	N2 (Bristol)|whole worm|young adult	N2 (Bristol)	ChIP-Seq
SRX2985938	SRA584240	tdp-1(ok803)_genomic_control;_Caenorhabditis_elegans;_ChIP-Seq	tdp-1(ok803)_genomic_control;_Caenorhabditis_el...	none|whole worm	none	tdp-1(ok803)|whole worm|young adult	tdp-1(ok803)	ChIP-Seq
SRX3008761	SRA587378	INPUT_WT;_Caenorhabditis_elegans;_ChIP-Seq	INPUT_WT;_Caenorhabditis_elegans;_ChIP-Seq	none|frozen whole worms	none	frozen whole worms|whole worms	frozen whole worms	ChIP-Seq
SRX3008762	SRA587378	INPUT_nfki-1(cer1);_Caenorhabditis_elegans;_ChIP-Seq	INPUT_nfki-1(cer1);_Caenorhabditis_elegans;_ChI...	none|frozen whole worms	none	frozen whole worms|whole worms	frozen whole worms	ChIP-Seq
SRX3008763	SRA587378	INPUT_ikb-1(nr2070);_Caenorhabditis_elegans;_ChIP-Seq	INPUT_ikb-1(nr2070);_Caenorhabditis_elegans;_Ch...	none|frozen whole worms	none	frozen whole worms|whole worms	frozen whole worms	ChIP-Seq
SRX3008764	SRA587378	INPUT_DKO_nfki-1(cer1);_ikb-1(nr2070);_Caenorhabditis_elegans;_ChIP-Seq	INPUT_DKO_nfki-1(cer1);_ikb-1(nr2070);_Caenorha...	none|frozen whole worms	none	frozen whole worms|whole worms	frozen whole worms	ChIP-Seq
SRX3008765	SRA587378	H3K27me3_WT;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me3_WT;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me3 (Millipore #07-449)|frozen whole worms	H3K27me3 (Millipore #0...	frozen whole worms|whole worms	frozen whole worms	ChIP-Seq
SRX3008766	SRA587378	H3K27me3_nfki-1(cer1);_Caenorhabditis_elegans;_ChIP-Seq	H3K27me3_nfki-1(cer1);_Caenorhabditis_elegans;_...	H3K27me3 (Millipore #07-449)|frozen whole worms	H3K27me3 (Millipore #0...	frozen whole worms|whole worms	frozen whole worms	ChIP-Seq
SRX3008767	SRA587378	H3K27me3_ikb-1(nr2070);_Caenorhabditis_elegans;_ChIP-Seq	H3K27me3_ikb-1(nr2070);_Caenorhabditis_elegans;...	H3K27me3 (Millipore #07-449)|frozen whole worms	H3K27me3 (Millipore #0...	frozen whole worms|whole worms	frozen whole worms	ChIP-Seq
SRX3008768	SRA587378	H3K27me3_DKO_nfki-1(cer1);_ikb-1(nr2070);_Caenorhabditis_elegans;_ChIP-Seq	H3K27me3_DKO_nfki-1(cer1);_ikb-1(nr2070);_Caeno...	H3K27me3 (Millipore #07-449)|frozen whole worms	H3K27me3 (Millipore #0...	frozen whole worms|whole worms	frozen whole worms	ChIP-Seq
SRX3008769	SRA587378	H3K36me3_WT;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_WT;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3 (Abcam, ab9050)|frozen whole worms	H3K36me3 (Abcam, ab9050)	frozen whole worms|whole worms	frozen whole worms	ChIP-Seq
SRX3008770	SRA587378	H3K36me3_nfki-1(cer1);_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_nfki-1(cer1);_Caenorhabditis_elegans;_...	H3K36me3 (Abcam, ab9050)|frozen whole worms	H3K36me3 (Abcam, ab9050)	frozen whole worms|whole worms	frozen whole worms	ChIP-Seq
SRX3008771	SRA587378	H3K36me3_ikb-1(nr2070);_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_ikb-1(nr2070);_Caenorhabditis_elegans;...	H3K36me3 (Abcam, ab9050)|frozen whole worms	H3K36me3 (Abcam, ab9050)	frozen whole worms|whole worms	frozen whole worms	ChIP-Seq
SRX3008772	SRA587378	H3K36me3_DKO_nfki-1(cer1);_ikb-1(nr2070);_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_DKO_nfki-1(cer1);_ikb-1(nr2070);_Caeno...	H3K36me3 (Abcam, ab9050)|frozen whole worms	H3K36me3 (Abcam, ab9050)	frozen whole worms|whole worms	frozen whole worms	ChIP-Seq
SRX3029121	SRA560919	rluc_hmg3_rep1;_Caenorhabditis_elegans;_ATAC-seq	rluc_hmg3_rep1;_Caenorhabditis_elegans;_ATAC-seq	ATAC-seq	ATAC-seq	whole worms|whole body|L4	whole worms	ATAC-seq
SRX3029122	SRA560919	rluc_hmg3_rep2;_Caenorhabditis_elegans;_ATAC-seq	rluc_hmg3_rep2;_Caenorhabditis_elegans;_ATAC-seq	ATAC-seq	ATAC-seq	whole worms|whole body|L4	whole worms	ATAC-seq
SRX3029123	SRA560919	rluc_hmg3_rep3;_Caenorhabditis_elegans;_ATAC-seq	rluc_hmg3_rep3;_Caenorhabditis_elegans;_ATAC-seq	ATAC-seq	ATAC-seq	whole worms|whole body|L4	whole worms	ATAC-seq
SRX3029124	SRA560919	Rluc_rep1;_Caenorhabditis_elegans;_ATAC-seq	Rluc_rep1;_Caenorhabditis_elegans;_ATAC-seq	ATAC-seq	ATAC-seq	whole worms|whole body|L4	whole worms	ATAC-seq
SRX3029125	SRA560919	Rluc_rep2;_Caenorhabditis_elegans;_ATAC-seq	Rluc_rep2;_Caenorhabditis_elegans;_ATAC-seq	ATAC-seq	ATAC-seq	whole worms|whole body|L4	whole worms	ATAC-seq
SRX3029126	SRA560919	Rluc_rep3;_Caenorhabditis_elegans;_ATAC-seq	Rluc_rep3;_Caenorhabditis_elegans;_ATAC-seq	ATAC-seq	ATAC-seq	whole worms|whole body|L4	whole worms	ATAC-seq
SRX3029127	SRA560919	hmg-3_rep1;_Caenorhabditis_elegans;_ATAC-seq	hmg-3_rep1;_Caenorhabditis_elegans;_ATAC-seq	ATAC-seq	ATAC-seq	whole worms|whole body|L4	whole worms	ATAC-seq
SRX3029128	SRA560919	hmg-3_rep2;_Caenorhabditis_elegans;_ATAC-seq	hmg-3_rep2;_Caenorhabditis_elegans;_ATAC-seq	ATAC-seq	ATAC-seq	whole worms|whole body|L4	whole worms	ATAC-seq
SRX3029129	SRA560919	hmg-3_rep3;_Caenorhabditis_elegans;_ATAC-seq	hmg-3_rep3;_Caenorhabditis_elegans;_ATAC-seq	ATAC-seq	ATAC-seq	whole worms|whole body|L4	whole worms	ATAC-seq
SRX3029130	SRA560919	spt-16_rep1;_Caenorhabditis_elegans;_ATAC-seq	spt-16_rep1;_Caenorhabditis_elegans;_ATAC-seq	ATAC-seq	ATAC-seq	whole worms|whole body|L4	whole worms	ATAC-seq
SRX3029131	SRA560919	spt-16_rep2;_Caenorhabditis_elegans;_ATAC-seq	spt-16_rep2;_Caenorhabditis_elegans;_ATAC-seq	ATAC-seq	ATAC-seq	whole worms|whole body|L4	whole worms	ATAC-seq
SRX3029132	SRA560919	spt-16_rep3;_Caenorhabditis_elegans;_ATAC-seq	spt-16_rep3;_Caenorhabditis_elegans;_ATAC-seq	ATAC-seq	ATAC-seq	whole worms|whole body|L4	whole worms	ATAC-seq
SRX3029134	SRA560919	hmg-4_rep2;_Caenorhabditis_elegans;_ATAC-seq	hmg-4_rep2;_Caenorhabditis_elegans;_ATAC-seq	ATAC-seq	ATAC-seq	whole worms|whole body|L4	whole worms	ATAC-seq
SRX3029135	SRA560919	hmg-4_rep3;_Caenorhabditis_elegans;_ATAC-seq	hmg-4_rep3;_Caenorhabditis_elegans;_ATAC-seq	ATAC-seq	ATAC-seq	whole worms|whole body|L4	whole worms	ATAC-seq
SRX3043399	SRA592933	H3K4me3_D2_rep3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_D2_rep3_ChIPSeq;_Caenorhabditis_elegans...	H3K4me3|H3K4me3 (ab9050, Abcam)|whole animal	H3K4me3	glp-1(e2141)|whole animal|whole animal	glp-1(e2141)	ChIP-Seq
SRX3043400	SRA592933	H3K4me3_D2_rep4_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_D2_rep4_ChIPSeq;_Caenorhabditis_elegans...	H3K4me3|H3K4me3 (ab9050, Abcam)|whole animal	H3K4me3	glp-1(e2141)|whole animal|whole animal	glp-1(e2141)	ChIP-Seq
SRX3043401	SRA592933	H3K4me3_D2_rep5_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_D2_rep5_ChIPSeq;_Caenorhabditis_elegans...	H3K4me3|H3K4me3 (17-614),millipore)|whole animal	H3K4me3	glp-1(e2141)|whole animal|whole animal	glp-1(e2141)	ChIP-Seq
SRX3043402	SRA592933	H3K4me3_D12_rep3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_D12_rep3_ChIPSeq;_Caenorhabditis_elegan...	H3K4me3|H3K4me3 (ab9050, Abcam)|whole animal	H3K4me3	glp-1(e2141)|whole animal|whole animal	glp-1(e2141)	ChIP-Seq
SRX3043403	SRA592933	H3K4me3_D12_rep4_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_D12_rep4_ChIPSeq;_Caenorhabditis_elegan...	H3K4me3|H3K4me3 (ab9050, Abcam)|whole animal	H3K4me3	glp-1(e2141)|whole animal|whole animal	glp-1(e2141)	ChIP-Seq
SRX3043404	SRA592933	H3K4me3_D12_rep5_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_D12_rep5_ChIPSeq;_Caenorhabditis_elegan...	H3K4me3|H3K4me3 (17-614,millipore)|whole animal	H3K4me3	glp-1(e2141)|whole animal|whole animal	glp-1(e2141)	ChIP-Seq
SRX3043405	SRA592933	H3_D2_rep3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3_D2_rep3_ChIPSeq;_Caenorhabditis_elegans;_ChI...	H3|H3 (ab1791, Abcam)|whole animal	H3	glp-1(e2141)|whole animal|whole animal	glp-1(e2141)	ChIP-Seq
SRX3043406	SRA592933	H3_D2_rep4_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3_D2_rep4_ChIPSeq;_Caenorhabditis_elegans;_ChI...	H3|H3 (ab1791, Abcam)|whole animal	H3	glp-1(e2141)|whole animal|whole animal	glp-1(e2141)	ChIP-Seq
SRX3043407	SRA592933	H3_D2_rep5_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3_D2_rep5_ChIPSeq;_Caenorhabditis_elegans;_ChI...	H3|H3 (ab1791, Abcam)|whole animal	H3	glp-1(e2141)|whole animal|whole animal	glp-1(e2141)	ChIP-Seq
SRX3043408	SRA592933	H3_D12_rep3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3_D12_rep3_ChIPSeq;_Caenorhabditis_elegans;_Ch...	H3|H3 (ab1791, Abcam)|whole animal	H3	glp-1(e2141)|whole animal|whole animal	glp-1(e2141)	ChIP-Seq
SRX3043409	SRA592933	H3_D12_rep4_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3_D12_rep4_ChIPSeq;_Caenorhabditis_elegans;_Ch...	H3|H3 (ab1791, Abcam)|whole animal	H3	glp-1(e2141)|whole animal|whole animal	glp-1(e2141)	ChIP-Seq
SRX3043410	SRA592933	H3_D12_rep5_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3_D12_rep5_ChIPSeq;_Caenorhabditis_elegans;_Ch...	H3|H3 (ab1791, Abcam)|whole animal	H3	glp-1(e2141)|whole animal|whole animal	glp-1(e2141)	ChIP-Seq
SRX3043411	SRA592933	input_D2_rep3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	input_D2_rep3_ChIPSeq;_Caenorhabditis_elegans;_...	whole animal	whole animal	glp-1(e2141)|whole animal|whole animal	glp-1(e2141)	ChIP-Seq
SRX3043412	SRA592933	input_D2_rep4_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	input_D2_rep4_ChIPSeq;_Caenorhabditis_elegans;_...	whole animal	whole animal	glp-1(e2141)|whole animal|whole animal	glp-1(e2141)	ChIP-Seq
SRX3043413	SRA592933	input_D2_rep5_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	input_D2_rep5_ChIPSeq;_Caenorhabditis_elegans;_...	whole animal	whole animal	glp-1(e2141)|whole animal|whole animal	glp-1(e2141)	ChIP-Seq
SRX3043414	SRA592933	input_D12_rep3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	input_D12_rep3_ChIPSeq;_Caenorhabditis_elegans;...	whole animal	whole animal	glp-1(e2141)|whole animal|whole animal	glp-1(e2141)	ChIP-Seq
SRX3043415	SRA592933	input_D12_rep4_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	input_D12_rep4_ChIPSeq;_Caenorhabditis_elegans;...	whole animal	whole animal	glp-1(e2141)|whole animal|whole animal	glp-1(e2141)	ChIP-Seq
SRX3043416	SRA592933	input_D12_rep5_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	input_D12_rep5_ChIPSeq;_Caenorhabditis_elegans;...	whole animal	whole animal	glp-1(e2141)|whole animal|whole animal	glp-1(e2141)	ChIP-Seq
SRX3043417	SRA592933	H3K4me3_L3_rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_L3_rep1_ChIPSeq;_Caenorhabditis_elegans...	H3K4me3|H3K4me3 (ab9050, Abcam)|whole animal	H3K4me3	glp-1(e2141)|whole animal|whole animal	glp-1(e2141)	ChIP-Seq
SRX3043418	SRA592933	H3K4me3_L3_rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_L3_rep2_ChIPSeq;_Caenorhabditis_elegans...	H3K4me3|H3K4me3 (17-614,millipore)|whole animal	H3K4me3	glp-1(e2141)|whole animal|whole animal	glp-1(e2141)	ChIP-Seq
SRX3043419	SRA592933	H3_L3_rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3_L3_rep1_ChIPSeq;_Caenorhabditis_elegans;_ChI...	H3|H3 (ab1791, Abcam)|whole animal	H3	glp-1(e2141)|whole animal|whole animal	glp-1(e2141)	ChIP-Seq
SRX3043420	SRA592933	H3_L3_rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3_L3_rep2_ChIPSeq;_Caenorhabditis_elegans;_ChI...	H3|H3 (ab1791, Abcam)|whole animal	H3	glp-1(e2141)|whole animal|whole animal	glp-1(e2141)	ChIP-Seq
SRX3043421	SRA592933	input_L3_rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	input_L3_rep1_ChIPSeq;_Caenorhabditis_elegans;_...	whole animal	whole animal	glp-1(e2141)|whole animal|whole animal	glp-1(e2141)	ChIP-Seq
SRX3043422	SRA592933	input_L3_rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	input_L3_rep2_ChIPSeq;_Caenorhabditis_elegans;_...	whole animal	whole animal	glp-1(e2141)|whole animal|whole animal	glp-1(e2141)	ChIP-Seq
SRX3058057	SRA596133	UNC-30_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	UNC-30_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	GFP beads(ChromoTek, Gat-20)|whole worms	GFP beads(ChromoTek, G...	GSH100|whole worms|whole worms|L2	GSH100	ChIP-Seq
SRX3058058	SRA596133	UNC-55_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	UNC-55_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	GFP beads(ChromoTek, Gat-20)|whole worms	GFP beads(ChromoTek, G...	GSH100|whole worms|whole worms|L2	GSH100	ChIP-Seq
SRX3058059	SRA596133	UNC-30_Input;_Caenorhabditis_elegans;_ChIP-Seq	UNC-30_Input;_Caenorhabditis_elegans;_ChIP-Seq	none|whole worms	none	GSH100|whole worms|whole worms|L2	GSH100	ChIP-Seq
SRX3058060	SRA596133	UNC-55_Input;_Caenorhabditis_elegans;_ChIP-Seq	UNC-55_Input;_Caenorhabditis_elegans;_ChIP-Seq	none|whole worms	none	GSH100|whole worms|whole worms|L2	GSH100	ChIP-Seq
SRX3104605	SRA554153	XRN2_ChIP_rep1;_Caenorhabditis_elegans;_ChIP-Seq	XRN2_ChIP_rep1;_Caenorhabditis_elegans;_ChIP-Seq	Whole worms	Whole worms	Whole worms|L4	Whole worms	ChIP-Seq
SRX3104606	SRA554153	XRN2_ChIP_rep2;_Caenorhabditis_elegans;_ChIP-Seq	XRN2_ChIP_rep2;_Caenorhabditis_elegans;_ChIP-Seq	Whole worms	Whole worms	Whole worms|L4	Whole worms	ChIP-Seq
SRX3104607	SRA554153	Control_ChIP_rep1;_Caenorhabditis_elegans;_ChIP-Seq	Control_ChIP_rep1;_Caenorhabditis_elegans;_ChIP...	Whole worms	Whole worms	Whole worms|L4	Whole worms	ChIP-Seq
SRX3104608	SRA554153	Control_ChIP_rep2;_Caenorhabditis_elegans;_ChIP-Seq	Control_ChIP_rep2;_Caenorhabditis_elegans;_ChIP...	Whole worms	Whole worms	Whole worms|L4	Whole worms	ChIP-Seq
SRX3104609	SRA554153	XRN2_input_rep1;_Caenorhabditis_elegans;_ChIP-Seq	XRN2_input_rep1;_Caenorhabditis_elegans;_ChIP-Seq	Whole worms	Whole worms	Whole worms|L4	Whole worms	ChIP-Seq
SRX3104610	SRA554153	XRN2_input_rep2;_Caenorhabditis_elegans;_ChIP-Seq	XRN2_input_rep2;_Caenorhabditis_elegans;_ChIP-Seq	Whole worms	Whole worms	Whole worms|L4	Whole worms	ChIP-Seq
SRX3104611	SRA554153	Control_input_rep1;_Caenorhabditis_elegans;_ChIP-Seq	Control_input_rep1;_Caenorhabditis_elegans;_ChI...	Whole worms	Whole worms	Whole worms|L4	Whole worms	ChIP-Seq
SRX3104612	SRA554153	Control_input_rep2;_Caenorhabditis_elegans;_ChIP-Seq	Control_input_rep2;_Caenorhabditis_elegans;_ChI...	Whole worms	Whole worms	Whole worms|L4	Whole worms	ChIP-Seq
SRX312079	SRA072292	KLE2_TY1072_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	KLE2_TY1072_Rep1_ChIPSeq;_Caenorhabditis_elegan...	KLE-2 SDQ3942 Rabbit polyclonal is against the antigen MTRNAPPGQESTDLAWLVTPAKDLVENFSIDVLKALAGYLEVIRQESEDTDNQVDAATTYRLFDFQRACRIIQGSCAVYGRKVDHVYELTISVVDLVENK May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	KLE-2 SDQ3942 Rabbit p...	TY1072|whole worms|embryo	TY1072	ChIP-Seq
SRX312080	SRA072292	KLE2_TY1072_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	KLE2_TY1072_Rep2_ChIPSeq;_Caenorhabditis_elegan...	KLE-2 SDQ3942 Rabbit polyclonal is against the antigen MTRNAPPGQESTDLAWLVTPAKDLVENFSIDVLKALAGYLEVIRQESEDTDNQVDAATTYRLFDFQRACRIIQGSCAVYGRKVDHVYELTISVVDLVENK May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	KLE-2 SDQ3942 Rabbit p...	TY1072|whole worms|embryo	TY1072	ChIP-Seq
SRX312081	SRA072292	PQN85_TY1072_Rep3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	PQN85_TY1072_Rep3_ChIPSeq;_Caenorhabditis_elega...	PQN-85 SDQ4481 Rabbit polyclonal is against the antigen QQQPVQQIQRQQPIAQPIPQHTIPPSTSNQFQQQIQSAASSIFDSSVISSHQKLYEEQCRQIEKERKEQEERKRKQELEEQRKRNEELKRLRIAEEKRLL May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	PQN-85 SDQ4481 Rabbit ...	TY1072|whole worms|embryo	TY1072	ChIP-Seq
SRX312082	SRA072292	Input_Rep19_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	Input_Rep19_ChIPSeq;_Caenorhabditis_elegans;_Ch...	whole worms	whole worms	TY1072|whole worms|embryo	TY1072	ChIP-Seq
SRX312083	SRA072292	Input_Rep20_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	Input_Rep20_ChIPSeq;_Caenorhabditis_elegans;_Ch...	whole worms	whole worms	TY1072|whole worms|embryo	TY1072	ChIP-Seq
SRX3141082	SRA603258	whole_L3_worm_ATAC-seq_rep1;_Caenorhabditis_elegans;_ATAC-seq	whole_L3_worm_ATAC-seq_rep1;_Caenorhabditis_ele...	ATAC-seq	ATAC-seq	stage L3|whole worms	stage L3	ATAC-seq
SRX3141083	SRA603258	whole_L3_worm_ATAC-seq_rep2;_Caenorhabditis_elegans;_ATAC-seq	whole_L3_worm_ATAC-seq_rep2;_Caenorhabditis_ele...	ATAC-seq	ATAC-seq	stage L3|whole worms	stage L3	ATAC-seq
SRX323676	SRA093583	DZ056_input_tra1het;_Caenorhabditis_elegans;_ChIP-Seq	DZ056_input_tra1het;_Caenorhabditis_elegans;_Ch...	NA|tra-1(e1834) heterozygote L3 stage	NA	N2|tra-1(e1834) heterozygote L3 stage	N2	ChIP-Seq
SRX323677	SRA093583	DZ038_TRA1_N2L2;_Caenorhabditis_elegans;_ChIP-Seq	DZ038_TRA1_N2L2;_Caenorhabditis_elegans;_ChIP-Seq	anti-TRA-1 antibody UMN163|N2 strain, L2 stage	anti-TRA-1 antibody UM...	N2|N2 strain, L2 stage	N2	ChIP-Seq
SRX323678	SRA093583	DZ039_TRA1_N2L2;_Caenorhabditis_elegans;_ChIP-Seq	DZ039_TRA1_N2L2;_Caenorhabditis_elegans;_ChIP-Seq	anti-TRA-1 antibody UMN163|N2 strain, L2 stage	anti-TRA-1 antibody UM...	N2|N2 strain, L2 stage	N2	ChIP-Seq
SRX323679	SRA093583	DZ044_input_N2L2;_Caenorhabditis_elegans;_ChIP-Seq	DZ044_input_N2L2;_Caenorhabditis_elegans;_ChIP-Seq	NA|N2 strain, L2 stage	NA	N2|N2 strain, L2 stage	N2	ChIP-Seq
SRX323680	SRA093583	DZ012_TRA1_N2L3;_Caenorhabditis_elegans;_ChIP-Seq	DZ012_TRA1_N2L3;_Caenorhabditis_elegans;_ChIP-Seq	anti-TRA-1 antibody UMN163|N2 strain, L3 stage	anti-TRA-1 antibody UM...	N2|N2 strain, L3 stage	N2	ChIP-Seq
SRX323681	SRA093583	DZ014_input_N2L3;_Caenorhabditis_elegans;_ChIP-Seq	DZ014_input_N2L3;_Caenorhabditis_elegans;_ChIP-Seq	NA|N2 strain, L3 stage	NA	N2|N2 strain, L3 stage	N2	ChIP-Seq
SRX323682	SRA093583	DZ015_TRA1_N2L3;_Caenorhabditis_elegans;_ChIP-Seq	DZ015_TRA1_N2L3;_Caenorhabditis_elegans;_ChIP-Seq	anti-TRA-1 antibody UMN163|N2 strain, L3 stage	anti-TRA-1 antibody UM...	N2|N2 strain, L3 stage	N2	ChIP-Seq
SRX323683	SRA093583	DZ042_TRA1_glp4YA;_Caenorhabditis_elegans;_ChIP-Seq	DZ042_TRA1_glp4YA;_Caenorhabditis_elegans;_ChIP...	anti-TRA-1 antibody UMN163|glp-4 (bn2) yound adult	anti-TRA-1 antibody UM...	N2|glp-4 (bn2) yound adult	N2	ChIP-Seq
SRX323684	SRA093583	DZ043_TRA1_glp4YA;_Caenorhabditis_elegans;_ChIP-Seq	DZ043_TRA1_glp4YA;_Caenorhabditis_elegans;_ChIP...	anti-TRA-1 antibody UMN163|glp-4 (bn2) yound adult	anti-TRA-1 antibody UM...	N2|glp-4 (bn2) yound adult	N2	ChIP-Seq
SRX323685	SRA093583	DZ048_input_glp4YA;_Caenorhabditis_elegans;_ChIP-Seq	DZ048_input_glp4YA;_Caenorhabditis_elegans;_ChI...	NA|glp-4 (bn2) yound adult	NA	N2|glp-4 (bn2) yound adult	N2	ChIP-Seq
SRX323686	SRA093583	DZ023_TRA1_spe11YA;_Caenorhabditis_elegans;_ChIP-Seq	DZ023_TRA1_spe11YA;_Caenorhabditis_elegans;_ChI...	anti-TRA-1 antibody UMN163|spe-11(hc77) yound adult	anti-TRA-1 antibody UM...	N2|spe-11(hc77) yound adult	N2	ChIP-Seq
SRX323687	SRA093583	DZ025_input_spe11YA;_Caenorhabditis_elegans;_ChIP-Seq	DZ025_input_spe11YA;_Caenorhabditis_elegans;_Ch...	NA|spe-11(hc77) yound adult	NA	N2|spe-11(hc77) yound adult	N2	ChIP-Seq
SRX323688	SRA093583	DZ050_TRA1_spe11YA;_Caenorhabditis_elegans;_ChIP-Seq	DZ050_TRA1_spe11YA;_Caenorhabditis_elegans;_ChI...	anti-TRA-1 antibody UMN163|spe-11(hc77) yound adult	anti-TRA-1 antibody UM...	N2|spe-11(hc77) yound adult	N2	ChIP-Seq
SRX323689	SRA093583	DZ055_TRA1_tra1het;_Caenorhabditis_elegans;_ChIP-Seq	DZ055_TRA1_tra1het;_Caenorhabditis_elegans;_ChI...	anti-TRA-1 antibody UMN163|tra-1(e1834) heterozygote L3 stage	anti-TRA-1 antibody UM...	N2|tra-1(e1834) heterozygote L3 stage	N2	ChIP-Seq
SRX323690	SRA093583	DZ052_TRA1_tra1homo;_Caenorhabditis_elegans;_ChIP-Seq	DZ052_TRA1_tra1homo;_Caenorhabditis_elegans;_Ch...	anti-TRA-1 antibody UMN163|tra-1(e1834) homozygote L3 stage	anti-TRA-1 antibody UM...	N2|tra-1(e1834) homozygote L3 stage	N2	ChIP-Seq
SRX323691	SRA093583	DZ054_input_tra1homo;_Caenorhabditis_elegans;_ChIP-Seq	DZ054_input_tra1homo;_Caenorhabditis_elegans;_C...	NA|tra-1(e1834) homozygote L3 stage	NA	N2|tra-1(e1834) homozygote L3 stage	N2	ChIP-Seq
SRX330983	SRA072292	KLE2_N2_L3_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	KLE2_N2_L3_Rep1_ChIPSeq;_Caenorhabditis_elegans...	KLE-2 SDQ3942 Rabbit polyclonal is against the antigen MTRNAPPGQESTDLAWLVTPAKDLVENFSIDVLKALAGYLEVIRQESEDTDNQVDAATTYRLFDFQRACRIIQGSCAVYGRKVDHVYELTISVVDLVENK May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	KLE-2 SDQ3942 Rabbit p...	N2|whole worms|L3	N2	ChIP-Seq
SRX330984	SRA072292	KLE2_N2_L3_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	KLE2_N2_L3_Rep2_ChIPSeq;_Caenorhabditis_elegans...	KLE-2 SDQ3942 Rabbit polyclonal is against the antigen MTRNAPPGQESTDLAWLVTPAKDLVENFSIDVLKALAGYLEVIRQESEDTDNQVDAATTYRLFDFQRACRIIQGSCAVYGRKVDHVYELTISVVDLVENK May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	KLE-2 SDQ3942 Rabbit p...	N2|whole worms|L3	N2	ChIP-Seq
SRX330985	SRA072292	KLE2_N2_L3_Rep3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	KLE2_N2_L3_Rep3_ChIPSeq;_Caenorhabditis_elegans...	KLE-2 SDQ3898 Rabbit polyclonal is against the antigen MTRNAPPGQESTDLAWLVTPAKDLVENFSIDVLKALAGYLEVIRQESEDTDNQVDAATTYRLFDFQRACRIIQGSCAVYGRKVDHVYELTISVVDLVENK May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	KLE-2 SDQ3898 Rabbit p...	N2|whole worms|L3	N2	ChIP-Seq
SRX330986	SRA072292	KLE2_N2_L3_Rep4_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	KLE2_N2_L3_Rep4_ChIPSeq;_Caenorhabditis_elegans...	KLE-2 SDQ3898 Rabbit polyclonal is against the antigen MTRNAPPGQESTDLAWLVTPAKDLVENFSIDVLKALAGYLEVIRQESEDTDNQVDAATTYRLFDFQRACRIIQGSCAVYGRKVDHVYELTISVVDLVENK May be available as part of modENCODE antibodies from Novus Biologicals http://www.novusbio.com/|whole worms	KLE-2 SDQ3898 Rabbit p...	N2|whole worms|L3	N2	ChIP-Seq
SRX330987	SRA072292	Input_N2_L3_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	Input_N2_L3_Rep1_ChIPSeq;_Caenorhabditis_elegan...	None (input)|whole worms	None (input)	N2|whole worms|L3	N2	ChIP-Seq
SRX330988	SRA072292	Input_N2_L3_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	Input_N2_L3_Rep2_ChIPSeq;_Caenorhabditis_elegan...	None (input)|whole worms	None (input)	N2|whole worms|L3	N2	ChIP-Seq
SRX331041	SRA096574	Snyder_AHA-1_GFP_L1_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_AHA-1_GFP_L1_Input_Rep1;_Caenorhabditis_...	AHA-1_GFP_L1_Input_Rep1	AHA-1_GFP_L1_Input_Rep1	OP124(official name : OP124 genotype : unc-119(ed3); wgIs124(aha-1::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The AHA-1::EGFP fusion protein is expressed in the correct aha-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the AHA-1 transcription factor. made_by : R. Waterston and S. Kim )|AHA-1_GFP_L1_Input_Rep1|fed L1	OP124(official name : ...	ChIP-Seq
SRX331042	SRA096574	Snyder_AHA-1_GFP_L1_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_AHA-1_GFP_L1_ChIP_Rep1;_Caenorhabditis_e...	AHA-1_GFP_L1_ChIP_Rep1	AHA-1_GFP_L1_ChIP_Rep1	OP124(official name : OP124 genotype : unc-119(ed3); wgIs124(aha-1::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The AHA-1::EGFP fusion protein is expressed in the correct aha-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the AHA-1 transcription factor. made_by : R. Waterston and S. Kim )|AHA-1_GFP_L1_ChIP_Rep1|fed L1	OP124(official name : ...	ChIP-Seq
SRX331043	SRA096574	Snyder_AHA-1_GFP_L1_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_AHA-1_GFP_L1_Input_Rep2;_Caenorhabditis_...	AHA-1_GFP_L1_Input_Rep2	AHA-1_GFP_L1_Input_Rep2	OP124(official name : OP124 genotype : unc-119(ed3); wgIs124(aha-1::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The AHA-1::EGFP fusion protein is expressed in the correct aha-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the AHA-1 transcription factor. made_by : R. Waterston and S. Kim )|AHA-1_GFP_L1_Input_Rep2|fed L1	OP124(official name : ...	ChIP-Seq
SRX331044	SRA096574	Snyder_AHA-1_GFP_L1_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_AHA-1_GFP_L1_ChIP_Rep2;_Caenorhabditis_e...	AHA-1_GFP_L1_ChIP_Rep2	AHA-1_GFP_L1_ChIP_Rep2	OP124(official name : OP124 genotype : unc-119(ed3); wgIs124(aha-1::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The AHA-1::EGFP fusion protein is expressed in the correct aha-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the AHA-1 transcription factor. made_by : R. Waterston and S. Kim )|AHA-1_GFP_L1_ChIP_Rep2|fed L1	OP124(official name : ...	ChIP-Seq
SRX331045	SRA096575	Snyder_FKH-2_GFP_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_FKH-2_GFP_L3_Input_Rep1;_Caenorhabditis_...	FKH-2_GFP_L3_Input_Rep1	FKH-2_GFP_L3_Input_Rep1	OP185(official name : OP185 genotype : unc-119(ed3); wgIs185(fkh-2::TY1 EGFP FLAG C; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The FKH-1::EGFP fusion protein is expressed in the correct fkh-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the FKH-2 transcription factor. made_by : R Waterston )|FKH-2_GFP_L3_Input_Rep1|L3	OP185(official name : ...	ChIP-Seq
SRX331046	SRA096575	Snyder_FKH-2_GFP_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_FKH-2_GFP_L3_ChIP_Rep1;_Caenorhabditis_e...	FKH-2_GFP_L3_ChIP_Rep1	FKH-2_GFP_L3_ChIP_Rep1	OP185(official name : OP185 genotype : unc-119(ed3); wgIs185(fkh-2::TY1 EGFP FLAG C; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The FKH-1::EGFP fusion protein is expressed in the correct fkh-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the FKH-2 transcription factor. made_by : R Waterston )|FKH-2_GFP_L3_ChIP_Rep1|L3	OP185(official name : ...	ChIP-Seq
SRX331047	SRA096575	Snyder_FKH-2_GFP_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_FKH-2_GFP_L3_Input_Rep2;_Caenorhabditis_...	FKH-2_GFP_L3_Input_Rep2	FKH-2_GFP_L3_Input_Rep2	OP185(official name : OP185 genotype : unc-119(ed3); wgIs185(fkh-2::TY1 EGFP FLAG C; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The FKH-1::EGFP fusion protein is expressed in the correct fkh-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the FKH-2 transcription factor. made_by : R Waterston )|FKH-2_GFP_L3_Input_Rep2|L3	OP185(official name : ...	ChIP-Seq
SRX331048	SRA096575	Snyder_FKH-2_GFP_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_FKH-2_GFP_L3_ChIP_Rep2;_Caenorhabditis_e...	FKH-2_GFP_L3_ChIP_Rep2	FKH-2_GFP_L3_ChIP_Rep2	OP185(official name : OP185 genotype : unc-119(ed3); wgIs185(fkh-2::TY1 EGFP FLAG C; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The FKH-1::EGFP fusion protein is expressed in the correct fkh-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the FKH-2 transcription factor. made_by : R Waterston )|FKH-2_GFP_L3_ChIP_Rep2|L3	OP185(official name : ...	ChIP-Seq
SRX331049	SRA096576	Snyder_MML-1_GFP_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_MML-1_GFP_L3_Input_Rep1;_Caenorhabditis_...	MML-1_GFP_L3_Input_Rep1	MML-1_GFP_L3_Input_Rep1	OP198(official name : OP198 genotype : unc-119(ed3); wgIs198(mml-1::TY1 EGFP FLAG C; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The MML-1::EGFP fusion protein is expressed in the correct mml-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the MML-1 transcription factor. made_by : R Waterston )|MML-1_GFP_L3_Input_Rep1|L3	OP198(official name : ...	ChIP-Seq
SRX331050	SRA096576	Snyder_MML-1_GFP_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_MML-1_GFP_L3_ChIP_Rep1;_Caenorhabditis_e...	MML-1_GFP_L3_ChIP_Rep1	MML-1_GFP_L3_ChIP_Rep1	OP198(official name : OP198 genotype : unc-119(ed3); wgIs198(mml-1::TY1 EGFP FLAG C; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The MML-1::EGFP fusion protein is expressed in the correct mml-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the MML-1 transcription factor. made_by : R Waterston )|MML-1_GFP_L3_ChIP_Rep1|L3	OP198(official name : ...	ChIP-Seq
SRX331051	SRA096576	Snyder_MML-1_GFP_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_MML-1_GFP_L3_Input_Rep2;_Caenorhabditis_...	MML-1_GFP_L3_Input_Rep2	MML-1_GFP_L3_Input_Rep2	OP198(official name : OP198 genotype : unc-119(ed3); wgIs198(mml-1::TY1 EGFP FLAG C; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The MML-1::EGFP fusion protein is expressed in the correct mml-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the MML-1 transcription factor. made_by : R Waterston )|MML-1_GFP_L3_Input_Rep2|L3	OP198(official name : ...	ChIP-Seq
SRX331052	SRA096576	Snyder_MML-1_GFP_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_MML-1_GFP_L3_ChIP_Rep2;_Caenorhabditis_e...	MML-1_GFP_L3_ChIP_Rep2	MML-1_GFP_L3_ChIP_Rep2	OP198(official name : OP198 genotype : unc-119(ed3); wgIs198(mml-1::TY1 EGFP FLAG C; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The MML-1::EGFP fusion protein is expressed in the correct mml-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the MML-1 transcription factor. made_by : R Waterston )|MML-1_GFP_L3_ChIP_Rep2|L3	OP198(official name : ...	ChIP-Seq
SRX331053	SRA096577	Snyder_NHR-76_GFP_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-76_GFP_L3_Input_Rep1;_Caenorhabditis...	NHR-76_GFP_L3_Input_Rep1	NHR-76_GFP_L3_Input_Rep1	OP203(official name : OP203 genotype : unc-119(ed3); wgIs203(nhr-76::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-76::EGFP fusion protein is expressed in the correct nhr-76 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-76 transcription factor. made_by : R. Waterston )|NHR-76_GFP_L3_Input_Rep1|L3	OP203(official name : ...	ChIP-Seq
SRX331054	SRA096577	Snyder_NHR-76_GFP_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-76_GFP_L3_ChIP_Rep1;_Caenorhabditis_...	NHR-76_GFP_L3_ChIP_Rep1	NHR-76_GFP_L3_ChIP_Rep1	OP203(official name : OP203 genotype : unc-119(ed3); wgIs203(nhr-76::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-76::EGFP fusion protein is expressed in the correct nhr-76 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-76 transcription factor. made_by : R. Waterston )|NHR-76_GFP_L3_ChIP_Rep1|L3	OP203(official name : ...	ChIP-Seq
SRX331055	SRA096577	Snyder_NHR-76_GFP_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-76_GFP_L3_Input_Rep2;_Caenorhabditis...	NHR-76_GFP_L3_Input_Rep2	NHR-76_GFP_L3_Input_Rep2	OP203(official name : OP203 genotype : unc-119(ed3); wgIs203(nhr-76::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-76::EGFP fusion protein is expressed in the correct nhr-76 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-76 transcription factor. made_by : R. Waterston )|NHR-76_GFP_L3_Input_Rep2|L3	OP203(official name : ...	ChIP-Seq
SRX331056	SRA096577	Snyder_NHR-76_GFP_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-76_GFP_L3_ChIP_Rep2;_Caenorhabditis_...	NHR-76_GFP_L3_ChIP_Rep2	NHR-76_GFP_L3_ChIP_Rep2	OP203(official name : OP203 genotype : unc-119(ed3); wgIs203(nhr-76::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-76::EGFP fusion protein is expressed in the correct nhr-76 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-76 transcription factor. made_by : R. Waterston )|NHR-76_GFP_L3_ChIP_Rep2|L3	OP203(official name : ...	ChIP-Seq
SRX331057	SRA096578	Snyder_PHA-4_GFP_L4_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_PHA-4_GFP_L4_Input_Rep1;_Caenorhabditis_...	PHA-4_GFP_L4_Input_Rep1	PHA-4_GFP_L4_Input_Rep1	OP37(official name : OP37 genotype : unc-119(ed3) III; wgIs37 unc-119(+) pha-4::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PHA-4::EGFP fusion protein is expressed in the correct pha-4 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PHA-4 transcription factor. made_by : R. Waterston and S. Kim )|PHA-4_GFP_L4_Input_Rep1|L4	OP37(official name : O...	ChIP-Seq
SRX331061	SRA096579	Snyder_GEI-11_GFP_YA_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_GEI-11_GFP_YA_Input_Rep1;_Caenorhabditis...	GEI-11_GFP_YA_Input_Rep1	GEI-11_GFP_YA_Input_Rep1	OP179(official name : OP179 genotype : unc-119(ed3) III; wgIs179 unc-119(+) gei-11::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The GEI-11::EGFP fusion protein is expressed in the correct gei-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the GEI-11 transcription factor. made_by : R. Waterston )|GEI-11_GFP_YA_Input_Rep1|Young Adult	OP179(official name : ...	ChIP-Seq
SRX331062	SRA096579	Snyder_GEI-11_GFP_YA_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_GEI-11_GFP_YA_ChIP_Rep1;_Caenorhabditis_...	GEI-11_GFP_YA_ChIP_Rep1	GEI-11_GFP_YA_ChIP_Rep1	OP179(official name : OP179 genotype : unc-119(ed3) III; wgIs179 unc-119(+) gei-11::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The GEI-11::EGFP fusion protein is expressed in the correct gei-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the GEI-11 transcription factor. made_by : R. Waterston )|GEI-11_GFP_YA_ChIP_Rep1|Young Adult	OP179(official name : ...	ChIP-Seq
SRX331063	SRA096579	Snyder_GEI-11_GFP_YA_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_GEI-11_GFP_YA_Input_Rep2;_Caenorhabditis...	GEI-11_GFP_YA_Input_Rep2	GEI-11_GFP_YA_Input_Rep2	OP179(official name : OP179 genotype : unc-119(ed3) III; wgIs179 unc-119(+) gei-11::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The GEI-11::EGFP fusion protein is expressed in the correct gei-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the GEI-11 transcription factor. made_by : R. Waterston )|GEI-11_GFP_YA_Input_Rep2|Young Adult	OP179(official name : ...	ChIP-Seq
SRX331064	SRA096579	Snyder_GEI-11_GFP_YA_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_GEI-11_GFP_YA_ChIP_Rep2;_Caenorhabditis_...	GEI-11_GFP_YA_ChIP_Rep2	GEI-11_GFP_YA_ChIP_Rep2	OP179(official name : OP179 genotype : unc-119(ed3) III; wgIs179 unc-119(+) gei-11::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The GEI-11::EGFP fusion protein is expressed in the correct gei-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the GEI-11 transcription factor. made_by : R. Waterston )|GEI-11_GFP_YA_ChIP_Rep2|Young Adult	OP179(official name : ...	ChIP-Seq
SRX331065	SRA096580	Snyder_R02D3.7_GFP_L4_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_R02D3.7_GFP_L4_Input_Rep1;_Caenorhabditi...	R02D3.7_GFP_L4_Input_Rep1	R02D3.7_GFP_L4_Input_Rep1	OP218(official name : OP218 genotype : unc-119(ed3); wgIs218(R02D3.7:TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The R02D3.7::EGFP fusion protein is expressed in the correct R02D3.7 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the RO2D3.7 transcription factor. made_by : )|R02D3.7_GFP_L4_Input_Rep1|L4	OP218(official name : ...	ChIP-Seq
SRX331066	SRA096580	Snyder_R02D3.7_GFP_L4_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_R02D3.7_GFP_L4_ChIP_Rep1;_Caenorhabditis...	R02D3.7_GFP_L4_ChIP_Rep1	R02D3.7_GFP_L4_ChIP_Rep1	OP218(official name : OP218 genotype : unc-119(ed3); wgIs218(R02D3.7:TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The R02D3.7::EGFP fusion protein is expressed in the correct R02D3.7 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the RO2D3.7 transcription factor. made_by : )|R02D3.7_GFP_L4_ChIP_Rep1|L4	OP218(official name : ...	ChIP-Seq
SRX331067	SRA096580	Snyder_R02D3.7_GFP_L4_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_R02D3.7_GFP_L4_Input_Rep2;_Caenorhabditi...	R02D3.7_GFP_L4_Input_Rep2	R02D3.7_GFP_L4_Input_Rep2	OP218(official name : OP218 genotype : unc-119(ed3); wgIs218(R02D3.7:TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The R02D3.7::EGFP fusion protein is expressed in the correct R02D3.7 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the RO2D3.7 transcription factor. made_by : )|R02D3.7_GFP_L4_Input_Rep2|L4	OP218(official name : ...	ChIP-Seq
SRX331068	SRA096580	Snyder_R02D3.7_GFP_L4_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_R02D3.7_GFP_L4_ChIP_Rep2;_Caenorhabditis...	R02D3.7_GFP_L4_ChIP_Rep2	R02D3.7_GFP_L4_ChIP_Rep2	OP218(official name : OP218 genotype : unc-119(ed3); wgIs218(R02D3.7:TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The R02D3.7::EGFP fusion protein is expressed in the correct R02D3.7 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the RO2D3.7 transcription factor. made_by : )|R02D3.7_GFP_L4_ChIP_Rep2|L4	OP218(official name : ...	ChIP-Seq
SRX331069	SRA096581	Snyder_HAM-1_GFP_L1_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_HAM-1_GFP_L1_Input_Rep1;_Caenorhabditis_...	HAM-1_GFP_L1_Input_Rep1	HAM-1_GFP_L1_Input_Rep1	OP102(official name : OP102 genotype : unc-119 (ed3); wgIs102 (ham-1::TY1 EGFP FLAG; unc-119(+)) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The HAM-1::EGFP fusion protein is expressed in the correct ham-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the HAM-1 transcription factor. made_by : R Waterston )|HAM-1_GFP_L1_Input_Rep1|fed L1	OP102(official name : ...	ChIP-Seq
SRX331070	SRA096581	Snyder_HAM-1_GFP_L1_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_HAM-1_GFP_L1_ChIP_Rep1;_Caenorhabditis_e...	HAM-1_GFP_L1_ChIP_Rep1	HAM-1_GFP_L1_ChIP_Rep1	OP102(official name : OP102 genotype : unc-119 (ed3); wgIs102 (ham-1::TY1 EGFP FLAG; unc-119(+)) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The HAM-1::EGFP fusion protein is expressed in the correct ham-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the HAM-1 transcription factor. made_by : R Waterston )|HAM-1_GFP_L1_ChIP_Rep1|fed L1	OP102(official name : ...	ChIP-Seq
SRX331071	SRA096581	Snyder_HAM-1_GFP_L1_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_HAM-1_GFP_L1_Input_Rep2;_Caenorhabditis_...	HAM-1_GFP_L1_Input_Rep2	HAM-1_GFP_L1_Input_Rep2	OP102(official name : OP102 genotype : unc-119 (ed3); wgIs102 (ham-1::TY1 EGFP FLAG; unc-119(+)) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The HAM-1::EGFP fusion protein is expressed in the correct ham-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the HAM-1 transcription factor. made_by : R Waterston )|HAM-1_GFP_L1_Input_Rep2|fed L1	OP102(official name : ...	ChIP-Seq
SRX331072	SRA096581	Snyder_HAM-1_GFP_L1_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_HAM-1_GFP_L1_ChIP_Rep2;_Caenorhabditis_e...	HAM-1_GFP_L1_ChIP_Rep2	HAM-1_GFP_L1_ChIP_Rep2	OP102(official name : OP102 genotype : unc-119 (ed3); wgIs102 (ham-1::TY1 EGFP FLAG; unc-119(+)) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The HAM-1::EGFP fusion protein is expressed in the correct ham-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the HAM-1 transcription factor. made_by : R Waterston )|HAM-1_GFP_L1_ChIP_Rep2|fed L1	OP102(official name : ...	ChIP-Seq
SRX331073	SRA096582	Snyder_C34F6.9_GFP_L2_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_C34F6.9_GFP_L2_Input_Rep1;_Caenorhabditi...	C34F6.9_GFP_L2_Input_Rep1	C34F6.9_GFP_L2_Input_Rep1	OP324(official name : OP324 genotype : unc119(ed3); wgIs324(C34F6.9::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of C34F6.9::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the C34F6.9 transcription factor. made_by : Bob Waterston's lab from UW )|C34F6.9_GFP_L2_Input_Rep1|L2	OP324(official name : ...	ChIP-Seq
SRX331074	SRA096582	Snyder_C34F6.9_GFP_L2_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_C34F6.9_GFP_L2_ChIP_Rep1;_Caenorhabditis...	C34F6.9_GFP_L2_ChIP_Rep1	C34F6.9_GFP_L2_ChIP_Rep1	OP324(official name : OP324 genotype : unc119(ed3); wgIs324(C34F6.9::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of C34F6.9::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the C34F6.9 transcription factor. made_by : Bob Waterston's lab from UW )|C34F6.9_GFP_L2_ChIP_Rep1|L2	OP324(official name : ...	ChIP-Seq
SRX331075	SRA096582	Snyder_C34F6.9_GFP_L2_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_C34F6.9_GFP_L2_Input_Rep2;_Caenorhabditi...	C34F6.9_GFP_L2_Input_Rep2	C34F6.9_GFP_L2_Input_Rep2	OP324(official name : OP324 genotype : unc119(ed3); wgIs324(C34F6.9::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of C34F6.9::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the C34F6.9 transcription factor. made_by : Bob Waterston's lab from UW )|C34F6.9_GFP_L2_Input_Rep2|L2	OP324(official name : ...	ChIP-Seq
SRX331076	SRA096582	Snyder_C34F6.9_GFP_L2_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_C34F6.9_GFP_L2_ChIP_Rep2;_Caenorhabditis...	C34F6.9_GFP_L2_ChIP_Rep2	C34F6.9_GFP_L2_ChIP_Rep2	OP324(official name : OP324 genotype : unc119(ed3); wgIs324(C34F6.9::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of C34F6.9::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the C34F6.9 transcription factor. made_by : Bob Waterston's lab from UW )|C34F6.9_GFP_L2_ChIP_Rep2|L2	OP324(official name : ...	ChIP-Seq
SRX331077	SRA096583	Snyder_CEH-16_GFP_L2_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_CEH-16_GFP_L2_Input_Rep1;_Caenorhabditis...	CEH-16_GFP_L2_Input_Rep1	CEH-16_GFP_L2_Input_Rep1	OP82(official name : OP82 genotype : unc119(ed3); wgIs82(ceh-16::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CEH-16::EGFP fusion protein is expressed in the correct CEH-16 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CEH-16 transcription factor. made_by : Bob Waterston's lab from UW )|CEH-16_GFP_L2_Input_Rep1|L2	OP82(official name : O...	ChIP-Seq
SRX331078	SRA096583	Snyder_CEH-16_GFP_L2_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_CEH-16_GFP_L2_ChIP_Rep1;_Caenorhabditis_...	CEH-16_GFP_L2_ChIP_Rep1	CEH-16_GFP_L2_ChIP_Rep1	OP82(official name : OP82 genotype : unc119(ed3); wgIs82(ceh-16::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CEH-16::EGFP fusion protein is expressed in the correct CEH-16 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CEH-16 transcription factor. made_by : Bob Waterston's lab from UW )|CEH-16_GFP_L2_ChIP_Rep1|L2	OP82(official name : O...	ChIP-Seq
SRX331079	SRA096583	Snyder_CEH-16_GFP_L2_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_CEH-16_GFP_L2_Input_Rep2;_Caenorhabditis...	CEH-16_GFP_L2_Input_Rep2	CEH-16_GFP_L2_Input_Rep2	OP82(official name : OP82 genotype : unc119(ed3); wgIs82(ceh-16::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CEH-16::EGFP fusion protein is expressed in the correct CEH-16 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CEH-16 transcription factor. made_by : Bob Waterston's lab from UW )|CEH-16_GFP_L2_Input_Rep2|L2	OP82(official name : O...	ChIP-Seq
SRX331080	SRA096583	Snyder_CEH-16_GFP_L2_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_CEH-16_GFP_L2_ChIP_Rep2;_Caenorhabditis_...	CEH-16_GFP_L2_ChIP_Rep2	CEH-16_GFP_L2_ChIP_Rep2	OP82(official name : OP82 genotype : unc119(ed3); wgIs82(ceh-16::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CEH-16::EGFP fusion protein is expressed in the correct CEH-16 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CEH-16 transcription factor. made_by : Bob Waterston's lab from UW )|CEH-16_GFP_L2_ChIP_Rep2|L2	OP82(official name : O...	ChIP-Seq
SRX331081	SRA096584	Snyder_DPL-1_GFP_L1_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_DPL-1_GFP_L1_Input_Rep1;_Caenorhabditis_...	DPL-1_GFP_L1_Input_Rep1	DPL-1_GFP_L1_Input_Rep1	YL448(official name : YL448 genotype : unc-119(ed3) III; vrIs83 pGES-1::DPL-1::GFP FLAG: DPL-1 3'UTR genotype : unc-119 (+) outcross : 0 mutagen : None tags : GFP::3xFlag made_by : Michelle Kudron (Valerie Reinke's lab) )|DPL-1_GFP_L1_Input_Rep1|fed L1	YL448(official name : ...	ChIP-Seq
SRX331082	SRA096584	Snyder_DPL-1_GFP_L1_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_DPL-1_GFP_L1_ChIP_Rep1;_Caenorhabditis_e...	DPL-1_GFP_L1_ChIP_Rep1	DPL-1_GFP_L1_ChIP_Rep1	YL448(official name : YL448 genotype : unc-119(ed3) III; vrIs83 pGES-1::DPL-1::GFP FLAG: DPL-1 3'UTR genotype : unc-119 (+) outcross : 0 mutagen : None tags : GFP::3xFlag made_by : Michelle Kudron (Valerie Reinke's lab) )|DPL-1_GFP_L1_ChIP_Rep1|fed L1	YL448(official name : ...	ChIP-Seq
SRX331083	SRA096584	Snyder_DPL-1_GFP_L1_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_DPL-1_GFP_L1_Input_Rep2;_Caenorhabditis_...	DPL-1_GFP_L1_Input_Rep2	DPL-1_GFP_L1_Input_Rep2	YL448(official name : YL448 genotype : unc-119(ed3) III; vrIs83 pGES-1::DPL-1::GFP FLAG: DPL-1 3'UTR genotype : unc-119 (+) outcross : 0 mutagen : None tags : GFP::3xFlag made_by : Michelle Kudron (Valerie Reinke's lab) )|DPL-1_GFP_L1_Input_Rep2|fed L1	YL448(official name : ...	ChIP-Seq
SRX331084	SRA096584	Snyder_DPL-1_GFP_L1_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_DPL-1_GFP_L1_ChIP_Rep2;_Caenorhabditis_e...	DPL-1_GFP_L1_ChIP_Rep2	DPL-1_GFP_L1_ChIP_Rep2	YL448(official name : YL448 genotype : unc-119(ed3) III; vrIs83 pGES-1::DPL-1::GFP FLAG: DPL-1 3'UTR genotype : unc-119 (+) outcross : 0 mutagen : None tags : GFP::3xFlag made_by : Michelle Kudron (Valerie Reinke's lab) )|DPL-1_GFP_L1_ChIP_Rep2|fed L1	YL448(official name : ...	ChIP-Seq
SRX331085	SRA096585	Snyder_LIN-35_GFP_L1_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_LIN-35_GFP_L1_Input_Rep1;_Caenorhabditis...	LIN-35_GFP_L1_Input_Rep1	LIN-35_GFP_L1_Input_Rep1	YL409(official name : YL409 genotype : unc-119(ed3) III; vrIs60 pLIN-35::LIN-35:GFP:FLAG::DPL-1 3'-UTR genotype : unc-119 (+)) outcross : 0 mutagen : None tags : GFP::3xFlag description : The LIN-35::GFP fusion protein is driven by its own lin-35 promoter. made_by : Michelle Kudron (Valerie Reinke's lab) )|LIN-35_GFP_L1_Input_Rep1|fed L1	YL409(official name : ...	ChIP-Seq
SRX331086	SRA096585	Snyder_LIN-35_GFP_L1_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_LIN-35_GFP_L1_ChIP_Rep1;_Caenorhabditis_...	LIN-35_GFP_L1_ChIP_Rep1	LIN-35_GFP_L1_ChIP_Rep1	YL409(official name : YL409 genotype : unc-119(ed3) III; vrIs60 pLIN-35::LIN-35:GFP:FLAG::DPL-1 3'-UTR genotype : unc-119 (+)) outcross : 0 mutagen : None tags : GFP::3xFlag description : The LIN-35::GFP fusion protein is driven by its own lin-35 promoter. made_by : Michelle Kudron (Valerie Reinke's lab) )|LIN-35_GFP_L1_ChIP_Rep1|fed L1	YL409(official name : ...	ChIP-Seq
SRX331087	SRA096585	Snyder_LIN-35_GFP_L1_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_LIN-35_GFP_L1_Input_Rep2;_Caenorhabditis...	LIN-35_GFP_L1_Input_Rep2	LIN-35_GFP_L1_Input_Rep2	YL409(official name : YL409 genotype : unc-119(ed3) III; vrIs60 pLIN-35::LIN-35:GFP:FLAG::DPL-1 3'-UTR genotype : unc-119 (+)) outcross : 0 mutagen : None tags : GFP::3xFlag description : The LIN-35::GFP fusion protein is driven by its own lin-35 promoter. made_by : Michelle Kudron (Valerie Reinke's lab) )|LIN-35_GFP_L1_Input_Rep2|fed L1	YL409(official name : ...	ChIP-Seq
SRX331088	SRA096585	Snyder_LIN-35_GFP_L1_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_LIN-35_GFP_L1_ChIP_Rep2;_Caenorhabditis_...	LIN-35_GFP_L1_ChIP_Rep2	LIN-35_GFP_L1_ChIP_Rep2	YL409(official name : YL409 genotype : unc-119(ed3) III; vrIs60 pLIN-35::LIN-35:GFP:FLAG::DPL-1 3'-UTR genotype : unc-119 (+)) outcross : 0 mutagen : None tags : GFP::3xFlag description : The LIN-35::GFP fusion protein is driven by its own lin-35 promoter. made_by : Michelle Kudron (Valerie Reinke's lab) )|LIN-35_GFP_L1_ChIP_Rep2|fed L1	YL409(official name : ...	ChIP-Seq
SRX331089	SRA096586	Snyder_NHR-12_GFP_L2_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-12_GFP_L2_Input_Rep1;_Caenorhabditis...	NHR-12_GFP_L2_Input_Rep1	NHR-12_GFP_L2_Input_Rep1	OP318(official name : OP318 genotype : unc-119(ed3); wgIs318(nhr-12::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of NHR-12::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-12 transcription factor. made_by : Bob Waterston's lab from UW )|NHR-12_GFP_L2_Input_Rep1|L2	OP318(official name : ...	ChIP-Seq
SRX331090	SRA096586	Snyder_NHR-12_GFP_L2_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-12_GFP_L2_ChIP_Rep1;_Caenorhabditis_...	NHR-12_GFP_L2_ChIP_Rep1	NHR-12_GFP_L2_ChIP_Rep1	OP318(official name : OP318 genotype : unc-119(ed3); wgIs318(nhr-12::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of NHR-12::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-12 transcription factor. made_by : Bob Waterston's lab from UW )|NHR-12_GFP_L2_ChIP_Rep1|L2	OP318(official name : ...	ChIP-Seq
SRX331091	SRA096586	Snyder_NHR-12_GFP_L2_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-12_GFP_L2_Input_Rep2;_Caenorhabditis...	NHR-12_GFP_L2_Input_Rep2	NHR-12_GFP_L2_Input_Rep2	OP318(official name : OP318 genotype : unc-119(ed3); wgIs318(nhr-12::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of NHR-12::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-12 transcription factor. made_by : Bob Waterston's lab from UW )|NHR-12_GFP_L2_Input_Rep2|L2	OP318(official name : ...	ChIP-Seq
SRX331092	SRA096586	Snyder_NHR-12_GFP_L2_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-12_GFP_L2_ChIP_Rep2;_Caenorhabditis_...	NHR-12_GFP_L2_ChIP_Rep2	NHR-12_GFP_L2_ChIP_Rep2	OP318(official name : OP318 genotype : unc-119(ed3); wgIs318(nhr-12::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The spatio-temporal expression pattern of NHR-12::EGFP fusion protein was examined through in vivo microscopy. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-12 transcription factor. made_by : Bob Waterston's lab from UW )|NHR-12_GFP_L2_ChIP_Rep2|L2	OP318(official name : ...	ChIP-Seq
SRX331093	SRA096587	Snyder_SMA-9_GFP_L2_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_SMA-9_GFP_L2_Input_Rep1;_Caenorhabditis_...	SMA-9_GFP_L2_Input_Rep1	SMA-9_GFP_L2_Input_Rep1	OP130(official name : OP130 genotype : unc119(ed3); wgIs130(sma-9::TY1 EGFP FLAG C; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The SMA-9::EGFP fusion protein is expressed in the correct sma-9 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the SMA-9 transcription factor. made_by : S Kim )|SMA-9_GFP_L2_Input_Rep1|L2	OP130(official name : ...	ChIP-Seq
SRX331094	SRA096587	Snyder_SMA-9_GFP_L2_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_SMA-9_GFP_L2_ChIP_Rep1;_Caenorhabditis_e...	SMA-9_GFP_L2_ChIP_Rep1	SMA-9_GFP_L2_ChIP_Rep1	OP130(official name : OP130 genotype : unc119(ed3); wgIs130(sma-9::TY1 EGFP FLAG C; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The SMA-9::EGFP fusion protein is expressed in the correct sma-9 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the SMA-9 transcription factor. made_by : S Kim )|SMA-9_GFP_L2_ChIP_Rep1|L2	OP130(official name : ...	ChIP-Seq
SRX331095	SRA096587	Snyder_SMA-9_GFP_L2_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_SMA-9_GFP_L2_Input_Rep2;_Caenorhabditis_...	SMA-9_GFP_L2_Input_Rep2	SMA-9_GFP_L2_Input_Rep2	OP130(official name : OP130 genotype : unc119(ed3); wgIs130(sma-9::TY1 EGFP FLAG C; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The SMA-9::EGFP fusion protein is expressed in the correct sma-9 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the SMA-9 transcription factor. made_by : S Kim )|SMA-9_GFP_L2_Input_Rep2|L2	OP130(official name : ...	ChIP-Seq
SRX331096	SRA096587	Snyder_SMA-9_GFP_L2_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_SMA-9_GFP_L2_ChIP_Rep2;_Caenorhabditis_e...	SMA-9_GFP_L2_ChIP_Rep2	SMA-9_GFP_L2_ChIP_Rep2	OP130(official name : OP130 genotype : unc119(ed3); wgIs130(sma-9::TY1 EGFP FLAG C; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The SMA-9::EGFP fusion protein is expressed in the correct sma-9 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the SMA-9 transcription factor. made_by : S Kim )|SMA-9_GFP_L2_ChIP_Rep2|L2	OP130(official name : ...	ChIP-Seq
SRX331097	SRA096588	Snyder_NHR-129_GFP_L2_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-129_GFP_L2_Input_Rep1;_Caenorhabditi...	NHR-129_GFP_L2_Input_Rep1	NHR-129_GFP_L2_Input_Rep1	OP339(official name : OP339 genotype : unc119(ed3); wgIs339(nhr-129::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The NHR-129::EGFP fusion protein was expressed in seam cells description : pharynx description : head neurons at L2 stage. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-129 transcription factor. made_by : Bob Waterston's lab from UW )|NHR-129_GFP_L2_Input_Rep1|L2	OP339(official name : ...	ChIP-Seq
SRX331098	SRA096588	Snyder_NHR-129_GFP_L2_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-129_GFP_L2_ChIP_Rep1;_Caenorhabditis...	NHR-129_GFP_L2_ChIP_Rep1	NHR-129_GFP_L2_ChIP_Rep1	OP339(official name : OP339 genotype : unc119(ed3); wgIs339(nhr-129::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The NHR-129::EGFP fusion protein was expressed in seam cells description : pharynx description : head neurons at L2 stage. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-129 transcription factor. made_by : Bob Waterston's lab from UW )|NHR-129_GFP_L2_ChIP_Rep1|L2	OP339(official name : ...	ChIP-Seq
SRX331099	SRA096588	Snyder_NHR-129_GFP_L2_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-129_GFP_L2_Input_Rep2;_Caenorhabditi...	NHR-129_GFP_L2_Input_Rep2	NHR-129_GFP_L2_Input_Rep2	OP339(official name : OP339 genotype : unc119(ed3); wgIs339(nhr-129::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The NHR-129::EGFP fusion protein was expressed in seam cells description : pharynx description : head neurons at L2 stage. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-129 transcription factor. made_by : Bob Waterston's lab from UW )|NHR-129_GFP_L2_Input_Rep2|L2	OP339(official name : ...	ChIP-Seq
SRX331100	SRA096588	Snyder_NHR-129_GFP_L2_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-129_GFP_L2_ChIP_Rep2;_Caenorhabditis...	NHR-129_GFP_L2_ChIP_Rep2	NHR-129_GFP_L2_ChIP_Rep2	OP339(official name : OP339 genotype : unc119(ed3); wgIs339(nhr-129::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The NHR-129::EGFP fusion protein was expressed in seam cells description : pharynx description : head neurons at L2 stage. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-129 transcription factor. made_by : Bob Waterston's lab from UW )|NHR-129_GFP_L2_ChIP_Rep2|L2	OP339(official name : ...	ChIP-Seq
SRX331101	SRA096589	Snyder_GEI-11_GFP_L1_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_GEI-11_GFP_L1_Input_Rep1;_Caenorhabditis...	GEI-11_GFP_L1_Input_Rep1	GEI-11_GFP_L1_Input_Rep1	OP179(official name : OP179 genotype : unc-119(ed3) III; wgIs179 unc-119(+) gei-11::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The GEI-11::EGFP fusion protein is expressed in the correct gei-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the GEI-11 transcription factor. made_by : R. Waterston )|GEI-11_GFP_L1_Input_Rep1|fed L1	OP179(official name : ...	ChIP-Seq
SRX331102	SRA096589	Snyder_GEI-11_GFP_L1_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_GEI-11_GFP_L1_ChIP_Rep1;_Caenorhabditis_...	GEI-11_GFP_L1_ChIP_Rep1	GEI-11_GFP_L1_ChIP_Rep1	OP179(official name : OP179 genotype : unc-119(ed3) III; wgIs179 unc-119(+) gei-11::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The GEI-11::EGFP fusion protein is expressed in the correct gei-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the GEI-11 transcription factor. made_by : R. Waterston )|GEI-11_GFP_L1_ChIP_Rep1|fed L1	OP179(official name : ...	ChIP-Seq
SRX331103	SRA096589	Snyder_GEI-11_GFP_L1_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_GEI-11_GFP_L1_Input_Rep2;_Caenorhabditis...	GEI-11_GFP_L1_Input_Rep2	GEI-11_GFP_L1_Input_Rep2	OP179(official name : OP179 genotype : unc-119(ed3) III; wgIs179 unc-119(+) gei-11::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The GEI-11::EGFP fusion protein is expressed in the correct gei-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the GEI-11 transcription factor. made_by : R. Waterston )|GEI-11_GFP_L1_Input_Rep2|fed L1	OP179(official name : ...	ChIP-Seq
SRX331104	SRA096589	Snyder_GEI-11_GFP_L1_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_GEI-11_GFP_L1_ChIP_Rep2;_Caenorhabditis_...	GEI-11_GFP_L1_ChIP_Rep2	GEI-11_GFP_L1_ChIP_Rep2	OP179(official name : OP179 genotype : unc-119(ed3) III; wgIs179 unc-119(+) gei-11::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The GEI-11::EGFP fusion protein is expressed in the correct gei-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the GEI-11 transcription factor. made_by : R. Waterston )|GEI-11_GFP_L1_ChIP_Rep2|fed L1	OP179(official name : ...	ChIP-Seq
SRX331105	SRA096590	Snyder_N2_EFL-1_Ab_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_N2_EFL-1_Ab_Input_Rep1;_Caenorhabditis_e...	N2_EFL-1_Ab_Input_Rep1	N2_EFL-1_Ab_Input_Rep1	DevStageWorm:L1 26dC:MS:1(official name : L1 26dC )|N2_EFL-1_Ab_Input_Rep1|L1 larva	DevStageWorm:L1 26dC:M...	ChIP-Seq
SRX331106	SRA096590	Snyder_N2_EFL-1_Ab_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_N2_EFL-1_Ab_ChIP_Rep1;_Caenorhabditis_el...	N2_EFL-1_Ab_ChIP_Rep1	N2_EFL-1_Ab_ChIP_Rep1	DevStageWorm:L1 26dC:MS:1(official name : L1 26dC )|N2_EFL-1_Ab_ChIP_Rep1|L1 larva	DevStageWorm:L1 26dC:M...	ChIP-Seq
SRX331107	SRA096590	Snyder_N2_EFL-1_Ab_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_N2_EFL-1_Ab_Input_Rep2;_Caenorhabditis_e...	N2_EFL-1_Ab_Input_Rep2	N2_EFL-1_Ab_Input_Rep2	DevStageWorm:L1 26dC:MS:1(official name : L1 26dC )|N2_EFL-1_Ab_Input_Rep2|L1 larva	DevStageWorm:L1 26dC:M...	ChIP-Seq
SRX331108	SRA096590	Snyder_N2_EFL-1_Ab_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_N2_EFL-1_Ab_ChIP_Rep2;_Caenorhabditis_el...	N2_EFL-1_Ab_ChIP_Rep2	N2_EFL-1_Ab_ChIP_Rep2	DevStageWorm:L1 26dC:MS:1(official name : L1 26dC )|N2_EFL-1_Ab_ChIP_Rep2|L1 larva	DevStageWorm:L1 26dC:M...	ChIP-Seq
SRX331109	SRA096591	Snyder_SEM-4_GFP_L2_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_SEM-4_GFP_L2_Input_Rep1;_Caenorhabditis_...	SEM-4_GFP_L2_Input_Rep1	SEM-4_GFP_L2_Input_Rep1	OP57(official name : OP57 genotype : unc-119(ed3); wgIs57(sem-4::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The SEM-4::EGFP fusion protein is expressed in the correct sem-4 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the sem-4 transcription factor. made_by : Bob Waterston's lab from UW )|SEM-4_GFP_L2_Input_Rep1|L2	OP57(official name : O...	ChIP-Seq
SRX331110	SRA096591	Snyder_SEM-4_GFP_L2_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_SEM-4_GFP_L2_ChIP_Rep1;_Caenorhabditis_e...	SEM-4_GFP_L2_ChIP_Rep1	SEM-4_GFP_L2_ChIP_Rep1	OP57(official name : OP57 genotype : unc-119(ed3); wgIs57(sem-4::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The SEM-4::EGFP fusion protein is expressed in the correct sem-4 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the sem-4 transcription factor. made_by : Bob Waterston's lab from UW )|SEM-4_GFP_L2_ChIP_Rep1|L2	OP57(official name : O...	ChIP-Seq
SRX331111	SRA096591	Snyder_SEM-4_GFP_L2_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_SEM-4_GFP_L2_Input_Rep2;_Caenorhabditis_...	SEM-4_GFP_L2_Input_Rep2	SEM-4_GFP_L2_Input_Rep2	OP57(official name : OP57 genotype : unc-119(ed3); wgIs57(sem-4::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The SEM-4::EGFP fusion protein is expressed in the correct sem-4 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the sem-4 transcription factor. made_by : Bob Waterston's lab from UW )|SEM-4_GFP_L2_Input_Rep2|L2	OP57(official name : O...	ChIP-Seq
SRX331112	SRA096591	Snyder_SEM-4_GFP_L2_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_SEM-4_GFP_L2_ChIP_Rep2;_Caenorhabditis_e...	SEM-4_GFP_L2_ChIP_Rep2	SEM-4_GFP_L2_ChIP_Rep2	OP57(official name : OP57 genotype : unc-119(ed3); wgIs57(sem-4::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The SEM-4::EGFP fusion protein is expressed in the correct sem-4 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the sem-4 transcription factor. made_by : Bob Waterston's lab from UW )|SEM-4_GFP_L2_ChIP_Rep2|L2	OP57(official name : O...	ChIP-Seq
SRX331113	SRA096592	Snyder_Pmex-5_LIN-35_YL468_yAd_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_Pmex-5_LIN-35_YL468_yAd_Input_Rep1;_Caen...	Pmex-5_LIN-35_YL468_yAd_Input_Rep1	Pmex-5_LIN-35_YL468_yA...	YL468(official name : YL468 genotype : unc-119(ed3) III; vrIs93 pMEX-5::LIN-35:GFP:FLAG::LIN-35 3-UTR genotype : unc-119 (+)) outcross : 0 mutagen : None tags : GFP::3xFlag description : LIN-35 expressed under the germline-specific promoter MEX-5. made_by : Michelle Kudron in Reinke lab )|Pmex-5_LIN-35_YL468_yAd_Input_Rep1|Young adult	YL468(official name : ...	ChIP-Seq
SRX331114	SRA096592	Snyder_Pmex-5_LIN-35_YL468_yAd_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_Pmex-5_LIN-35_YL468_yAd_ChIP_Rep1;_Caeno...	Pmex-5_LIN-35_YL468_yAd_ChIP_Rep1	Pmex-5_LIN-35_YL468_yA...	YL468(official name : YL468 genotype : unc-119(ed3) III; vrIs93 pMEX-5::LIN-35:GFP:FLAG::LIN-35 3-UTR genotype : unc-119 (+)) outcross : 0 mutagen : None tags : GFP::3xFlag description : LIN-35 expressed under the germline-specific promoter MEX-5. made_by : Michelle Kudron in Reinke lab )|Pmex-5_LIN-35_YL468_yAd_ChIP_Rep1|Young adult	YL468(official name : ...	ChIP-Seq
SRX331115	SRA096592	Snyder_Pmex-5_LIN-35_YL468_yAd_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_Pmex-5_LIN-35_YL468_yAd_Input_Rep2;_Caen...	Pmex-5_LIN-35_YL468_yAd_Input_Rep2	Pmex-5_LIN-35_YL468_yA...	YL468(official name : YL468 genotype : unc-119(ed3) III; vrIs93 pMEX-5::LIN-35:GFP:FLAG::LIN-35 3-UTR genotype : unc-119 (+)) outcross : 0 mutagen : None tags : GFP::3xFlag description : LIN-35 expressed under the germline-specific promoter MEX-5. made_by : Michelle Kudron in Reinke lab )|Pmex-5_LIN-35_YL468_yAd_Input_Rep2|Young adult	YL468(official name : ...	ChIP-Seq
SRX331116	SRA096592	Snyder_Pmex-5_LIN-35_YL468_yAd_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_Pmex-5_LIN-35_YL468_yAd_ChIP_Rep2;_Caeno...	Pmex-5_LIN-35_YL468_yAd_ChIP_Rep2	Pmex-5_LIN-35_YL468_yA...	YL468(official name : YL468 genotype : unc-119(ed3) III; vrIs93 pMEX-5::LIN-35:GFP:FLAG::LIN-35 3-UTR genotype : unc-119 (+)) outcross : 0 mutagen : None tags : GFP::3xFlag description : LIN-35 expressed under the germline-specific promoter MEX-5. made_by : Michelle Kudron in Reinke lab )|Pmex-5_LIN-35_YL468_yAd_ChIP_Rep2|Young adult	YL468(official name : ...	ChIP-Seq
SRX331117	SRA096593	Snyder_pGES_HPL-2_lin-35_YL474_L1_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_pGES_HPL-2_lin-35_YL474_L1_Input_Rep1;_C...	pGES_HPL-2_lin-35_YL474_L1_Input_Rep1	pGES_HPL-2_lin-35_YL47...	YL474(official name : YL474 genotype : lin-35(n745) I; unc-119(ed3) III; vrIs64pGES-1::HPL-2::GFP FLAG: HPL-2 3-UTR genotype : unc-119 (+) outcross : 0 mutagen : None tags : GFP::3xFlag description : The HPL-2::GFP fusion protein is driven by the ges-1 promoter and expressed in the intestine. The original transgene was subsequently crossed into a lin-35 mutant. made_by : Michelle Kudron in Reinke lab )|pGES_HPL-2_lin-35_YL474_L1_Input_Rep1|starved L1	YL474(official name : ...	ChIP-Seq
SRX331118	SRA096593	Snyder_pGES_HPL-2_lin-35_YL474_L1_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_pGES_HPL-2_lin-35_YL474_L1_ChIP_Rep1;_Ca...	pGES_HPL-2_lin-35_YL474_L1_ChIP_Rep1	pGES_HPL-2_lin-35_YL47...	YL474(official name : YL474 genotype : lin-35(n745) I; unc-119(ed3) III; vrIs64pGES-1::HPL-2::GFP FLAG: HPL-2 3-UTR genotype : unc-119 (+) outcross : 0 mutagen : None tags : GFP::3xFlag description : The HPL-2::GFP fusion protein is driven by the ges-1 promoter and expressed in the intestine. The original transgene was subsequently crossed into a lin-35 mutant. made_by : Michelle Kudron in Reinke lab )|pGES_HPL-2_lin-35_YL474_L1_ChIP_Rep1|starved L1	YL474(official name : ...	ChIP-Seq
SRX331119	SRA096593	Snyder_pGES_HPL-2_lin-35_YL474_L1_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_pGES_HPL-2_lin-35_YL474_L1_Input_Rep2;_C...	pGES_HPL-2_lin-35_YL474_L1_Input_Rep2	pGES_HPL-2_lin-35_YL47...	YL474(official name : YL474 genotype : lin-35(n745) I; unc-119(ed3) III; vrIs64pGES-1::HPL-2::GFP FLAG: HPL-2 3-UTR genotype : unc-119 (+) outcross : 0 mutagen : None tags : GFP::3xFlag description : The HPL-2::GFP fusion protein is driven by the ges-1 promoter and expressed in the intestine. The original transgene was subsequently crossed into a lin-35 mutant. made_by : Michelle Kudron in Reinke lab )|pGES_HPL-2_lin-35_YL474_L1_Input_Rep2|starved L1	YL474(official name : ...	ChIP-Seq
SRX331120	SRA096593	Snyder_pGES_HPL-2_lin-35_YL474_L1_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_pGES_HPL-2_lin-35_YL474_L1_ChIP_Rep2;_Ca...	pGES_HPL-2_lin-35_YL474_L1_ChIP_Rep2	pGES_HPL-2_lin-35_YL47...	YL474(official name : YL474 genotype : lin-35(n745) I; unc-119(ed3) III; vrIs64pGES-1::HPL-2::GFP FLAG: HPL-2 3-UTR genotype : unc-119 (+) outcross : 0 mutagen : None tags : GFP::3xFlag description : The HPL-2::GFP fusion protein is driven by the ges-1 promoter and expressed in the intestine. The original transgene was subsequently crossed into a lin-35 mutant. made_by : Michelle Kudron in Reinke lab )|pGES_HPL-2_lin-35_YL474_L1_ChIP_Rep2|starved L1	YL474(official name : ...	ChIP-Seq
SRX331121	SRA096594	Snyder_NHR-25_GFP_L2_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-25_GFP_L2_Input_Rep1;_Caenorhabditis...	NHR-25_GFP_L2_Input_Rep1	NHR-25_GFP_L2_Input_Rep1	OP33(official name : OP33 genotype : unc119(ed3); wgIs33(nhr-25::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. made_by : Bob Waterston's lab from UW )|NHR-25_GFP_L2_Input_Rep1|L2	OP33(official name : O...	ChIP-Seq
SRX331122	SRA096594	Snyder_NHR-25_GFP_L2_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-25_GFP_L2_ChIP_Rep1;_Caenorhabditis_...	NHR-25_GFP_L2_ChIP_Rep1	NHR-25_GFP_L2_ChIP_Rep1	OP33(official name : OP33 genotype : unc119(ed3); wgIs33(nhr-25::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. made_by : Bob Waterston's lab from UW )|NHR-25_GFP_L2_ChIP_Rep1|L2	OP33(official name : O...	ChIP-Seq
SRX331123	SRA096594	Snyder_NHR-25_GFP_L2_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-25_GFP_L2_Input_Rep2;_Caenorhabditis...	NHR-25_GFP_L2_Input_Rep2	NHR-25_GFP_L2_Input_Rep2	OP33(official name : OP33 genotype : unc119(ed3); wgIs33(nhr-25::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. made_by : Bob Waterston's lab from UW )|NHR-25_GFP_L2_Input_Rep2|L2	OP33(official name : O...	ChIP-Seq
SRX331124	SRA096594	Snyder_NHR-25_GFP_L2_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-25_GFP_L2_ChIP_Rep2;_Caenorhabditis_...	NHR-25_GFP_L2_ChIP_Rep2	NHR-25_GFP_L2_ChIP_Rep2	OP33(official name : OP33 genotype : unc119(ed3); wgIs33(nhr-25::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. made_by : Bob Waterston's lab from UW )|NHR-25_GFP_L2_ChIP_Rep2|L2	OP33(official name : O...	ChIP-Seq
SRX331125	SRA096594	Snyder_NHR-25_GFP_L2_Input_Rep3;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-25_GFP_L2_Input_Rep3;_Caenorhabditis...	NHR-25_GFP_L2_Input_Rep3	NHR-25_GFP_L2_Input_Rep3	OP33(official name : OP33 genotype : unc119(ed3); wgIs33(nhr-25::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. made_by : Bob Waterston's lab from UW )|NHR-25_GFP_L2_Input_Rep3|L2	OP33(official name : O...	ChIP-Seq
SRX331126	SRA096594	Snyder_NHR-25_GFP_L2_ChIP_Rep3;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-25_GFP_L2_ChIP_Rep3;_Caenorhabditis_...	NHR-25_GFP_L2_ChIP_Rep3	NHR-25_GFP_L2_ChIP_Rep3	OP33(official name : OP33 genotype : unc119(ed3); wgIs33(nhr-25::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. made_by : Bob Waterston's lab from UW )|NHR-25_GFP_L2_ChIP_Rep3|L2	OP33(official name : O...	ChIP-Seq
SRX331127	SRA096595	Snyder_NHR-6_GFP_L4_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-6_GFP_L4_Input_Rep1;_Caenorhabditis_...	NHR-6_GFP_L4_Input_Rep1	NHR-6_GFP_L4_Input_Rep1	OP90(official name : OP90 genotype : unc-119(ed3) III; wgIs90 unc-119(+) nhr-6::TY1::EGFP::3xFLAG outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-6::EGFP fusion protein is expressed in neurons surrounding pharynx at L2 stage. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-6 transcription factor. made_by : R. Waterston )|NHR-6_GFP_L4_Input_Rep1|L4	OP90(official name : O...	ChIP-Seq
SRX331128	SRA096595	Snyder_NHR-6_GFP_L4_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-6_GFP_L4_ChIP_Rep1;_Caenorhabditis_e...	NHR-6_GFP_L4_ChIP_Rep1	NHR-6_GFP_L4_ChIP_Rep1	OP90(official name : OP90 genotype : unc-119(ed3) III; wgIs90 unc-119(+) nhr-6::TY1::EGFP::3xFLAG outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-6::EGFP fusion protein is expressed in neurons surrounding pharynx at L2 stage. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-6 transcription factor. made_by : R. Waterston )|NHR-6_GFP_L4_ChIP_Rep1|L4	OP90(official name : O...	ChIP-Seq
SRX331129	SRA096595	Snyder_NHR-6_GFP_L4_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-6_GFP_L4_Input_Rep2;_Caenorhabditis_...	NHR-6_GFP_L4_Input_Rep2	NHR-6_GFP_L4_Input_Rep2	OP90(official name : OP90 genotype : unc-119(ed3) III; wgIs90 unc-119(+) nhr-6::TY1::EGFP::3xFLAG outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-6::EGFP fusion protein is expressed in neurons surrounding pharynx at L2 stage. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-6 transcription factor. made_by : R. Waterston )|NHR-6_GFP_L4_Input_Rep2|L4	OP90(official name : O...	ChIP-Seq
SRX331130	SRA096595	Snyder_NHR-6_GFP_L4_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-6_GFP_L4_ChIP_Rep2;_Caenorhabditis_e...	NHR-6_GFP_L4_ChIP_Rep2	NHR-6_GFP_L4_ChIP_Rep2	OP90(official name : OP90 genotype : unc-119(ed3) III; wgIs90 unc-119(+) nhr-6::TY1::EGFP::3xFLAG outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-6::EGFP fusion protein is expressed in neurons surrounding pharynx at L2 stage. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-6 transcription factor. made_by : R. Waterston )|NHR-6_GFP_L4_ChIP_Rep2|L4	OP90(official name : O...	ChIP-Seq
SRX331131	SRA096596	Snyder_NHR-23_GFP_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-23_GFP_L3_Input_Rep1;_Caenorhabditis...	NHR-23_GFP_L3_Input_Rep1	NHR-23_GFP_L3_Input_Rep1	OP43(official name : OP43 genotype : unc-119(ed3); wgIs43(nhr-23::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The NHR-23::EGFP fusion protein is expressed in the correct nhr-23 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-223 transcription factor. made_by : Bob Waterston's lab from UW )|NHR-23_GFP_L3_Input_Rep1|L3	OP43(official name : O...	ChIP-Seq
SRX331132	SRA096596	Snyder_NHR-23_GFP_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-23_GFP_L3_ChIP_Rep1;_Caenorhabditis_...	NHR-23_GFP_L3_ChIP_Rep1	NHR-23_GFP_L3_ChIP_Rep1	OP43(official name : OP43 genotype : unc-119(ed3); wgIs43(nhr-23::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The NHR-23::EGFP fusion protein is expressed in the correct nhr-23 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-223 transcription factor. made_by : Bob Waterston's lab from UW )|NHR-23_GFP_L3_ChIP_Rep1|L3	OP43(official name : O...	ChIP-Seq
SRX331133	SRA096596	Snyder_NHR-23_GFP_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-23_GFP_L3_Input_Rep2;_Caenorhabditis...	NHR-23_GFP_L3_Input_Rep2	NHR-23_GFP_L3_Input_Rep2	OP43(official name : OP43 genotype : unc-119(ed3); wgIs43(nhr-23::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The NHR-23::EGFP fusion protein is expressed in the correct nhr-23 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-223 transcription factor. made_by : Bob Waterston's lab from UW )|NHR-23_GFP_L3_Input_Rep2|L3	OP43(official name : O...	ChIP-Seq
SRX331134	SRA096596	Snyder_NHR-23_GFP_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-23_GFP_L3_ChIP_Rep2;_Caenorhabditis_...	NHR-23_GFP_L3_ChIP_Rep2	NHR-23_GFP_L3_ChIP_Rep2	OP43(official name : OP43 genotype : unc-119(ed3); wgIs43(nhr-23::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The NHR-23::EGFP fusion protein is expressed in the correct nhr-23 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-223 transcription factor. made_by : Bob Waterston's lab from UW )|NHR-23_GFP_L3_ChIP_Rep2|L3	OP43(official name : O...	ChIP-Seq
SRX331135	SRA096597	Snyder_SKN-1_GFP_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_SKN-1_GFP_L3_Input_Rep1;_Caenorhabditis_...	SKN-1_GFP_L3_Input_Rep1	SKN-1_GFP_L3_Input_Rep1	OP342(official name : OP342 genotype : unc119(ed3); wgIs341(skn-1::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. made_by : Bob Waterston's lab from UW )|SKN-1_GFP_L3_Input_Rep1|L3	OP342(official name : ...	ChIP-Seq
SRX331136	SRA096597	Snyder_SKN-1_GFP_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_SKN-1_GFP_L3_ChIP_Rep1;_Caenorhabditis_e...	SKN-1_GFP_L3_ChIP_Rep1	SKN-1_GFP_L3_ChIP_Rep1	OP342(official name : OP342 genotype : unc119(ed3); wgIs341(skn-1::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. made_by : Bob Waterston's lab from UW )|SKN-1_GFP_L3_ChIP_Rep1|L3	OP342(official name : ...	ChIP-Seq
SRX331137	SRA096597	Snyder_SKN-1_GFP_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_SKN-1_GFP_L3_Input_Rep2;_Caenorhabditis_...	SKN-1_GFP_L3_Input_Rep2	SKN-1_GFP_L3_Input_Rep2	OP342(official name : OP342 genotype : unc119(ed3); wgIs341(skn-1::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. made_by : Bob Waterston's lab from UW )|SKN-1_GFP_L3_Input_Rep2|L3	OP342(official name : ...	ChIP-Seq
SRX331138	SRA096597	Snyder_SKN-1_GFP_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_SKN-1_GFP_L3_ChIP_Rep2;_Caenorhabditis_e...	SKN-1_GFP_L3_ChIP_Rep2	SKN-1_GFP_L3_ChIP_Rep2	OP342(official name : OP342 genotype : unc119(ed3); wgIs341(skn-1::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. made_by : Bob Waterston's lab from UW )|SKN-1_GFP_L3_ChIP_Rep2|L3	OP342(official name : ...	ChIP-Seq
SRX331139	SRA096598	Snyder_F23F12.9_GFP_Emb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_F23F12.9_GFP_Emb_Input_Rep1;_Caenorhabdi...	F23F12.9_GFP_Emb_Input_Rep1	F23F12.9_GFP_Emb_Input...	OP327(official name : OP327 genotype : unc327(ed3); wgIs102(F23F12.::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. made_by : Bob Waterston's lab from UW )|F23F12.9_GFP_Emb_Input_Rep1|embryo	OP327(official name : ...	ChIP-Seq
SRX331140	SRA096598	Snyder_F23F12.9_GFP_Emb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_F23F12.9_GFP_Emb_ChIP_Rep1;_Caenorhabdit...	F23F12.9_GFP_Emb_ChIP_Rep1	F23F12.9_GFP_Emb_ChIP_...	OP327(official name : OP327 genotype : unc327(ed3); wgIs102(F23F12.::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. made_by : Bob Waterston's lab from UW )|F23F12.9_GFP_Emb_ChIP_Rep1|embryo	OP327(official name : ...	ChIP-Seq
SRX331141	SRA096598	Snyder_F23F12.9_GFP_Emb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_F23F12.9_GFP_Emb_Input_Rep2;_Caenorhabdi...	F23F12.9_GFP_Emb_Input_Rep2	F23F12.9_GFP_Emb_Input...	OP327(official name : OP327 genotype : unc327(ed3); wgIs102(F23F12.::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. made_by : Bob Waterston's lab from UW )|F23F12.9_GFP_Emb_Input_Rep2|embryo	OP327(official name : ...	ChIP-Seq
SRX331142	SRA096598	Snyder_F23F12.9_GFP_Emb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_F23F12.9_GFP_Emb_ChIP_Rep2;_Caenorhabdit...	F23F12.9_GFP_Emb_ChIP_Rep2	F23F12.9_GFP_Emb_ChIP_...	OP327(official name : OP327 genotype : unc327(ed3); wgIs102(F23F12.::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. made_by : Bob Waterston's lab from UW )|F23F12.9_GFP_Emb_ChIP_Rep2|embryo	OP327(official name : ...	ChIP-Seq
SRX331143	SRA096599	Snyder_PEB-1_GFP_L2_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_PEB-1_GFP_L2_Input_Rep1;_Caenorhabditis_...	PEB-1_GFP_L2_Input_Rep1	PEB-1_GFP_L2_Input_Rep1	OP86(official name : OP86 genotype : unc119(ed3); wgIs86(peb-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PEB-1::EGFP fusion protein is expressed in the correct peb-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PEB-1 transcription factor. made_by : R Waterston )|PEB-1_GFP_L2_Input_Rep1|L2	OP86(official name : O...	ChIP-Seq
SRX331144	SRA096599	Snyder_PEB-1_GFP_L2_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_PEB-1_GFP_L2_ChIP_Rep1;_Caenorhabditis_e...	PEB-1_GFP_L2_ChIP_Rep1	PEB-1_GFP_L2_ChIP_Rep1	OP86(official name : OP86 genotype : unc119(ed3); wgIs86(peb-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PEB-1::EGFP fusion protein is expressed in the correct peb-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PEB-1 transcription factor. made_by : R Waterston )|PEB-1_GFP_L2_ChIP_Rep1|L2	OP86(official name : O...	ChIP-Seq
SRX331145	SRA096599	Snyder_PEB-1_GFP_L2_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_PEB-1_GFP_L2_Input_Rep2;_Caenorhabditis_...	PEB-1_GFP_L2_Input_Rep2	PEB-1_GFP_L2_Input_Rep2	OP86(official name : OP86 genotype : unc119(ed3); wgIs86(peb-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PEB-1::EGFP fusion protein is expressed in the correct peb-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PEB-1 transcription factor. made_by : R Waterston )|PEB-1_GFP_L2_Input_Rep2|L2	OP86(official name : O...	ChIP-Seq
SRX331146	SRA096599	Snyder_PEB-1_GFP_L2_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_PEB-1_GFP_L2_ChIP_Rep2;_Caenorhabditis_e...	PEB-1_GFP_L2_ChIP_Rep2	PEB-1_GFP_L2_ChIP_Rep2	OP86(official name : OP86 genotype : unc119(ed3); wgIs86(peb-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PEB-1::EGFP fusion protein is expressed in the correct peb-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PEB-1 transcription factor. made_by : R Waterston )|PEB-1_GFP_L2_ChIP_Rep2|L2	OP86(official name : O...	ChIP-Seq
SRX331147	SRA096600	Snyder_HAM-1_GFP_L4_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_HAM-1_GFP_L4_Input_Rep1;_Caenorhabditis_...	HAM-1_GFP_L4_Input_Rep1	HAM-1_GFP_L4_Input_Rep1	OP102(official name : OP102 genotype : unc-119 (ed3); wgIs102 (ham-1::TY1 EGFP FLAG; unc-119(+)) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The HAM-1::EGFP fusion protein is expressed in the correct ham-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the HAM-1 transcription factor. made_by : R Waterston )|HAM-1_GFP_L4_Input_Rep1|L4	OP102(official name : ...	ChIP-Seq
SRX331148	SRA096600	Snyder_HAM-1_GFP_L4_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_HAM-1_GFP_L4_ChIP_Rep1;_Caenorhabditis_e...	HAM-1_GFP_L4_ChIP_Rep1	HAM-1_GFP_L4_ChIP_Rep1	OP102(official name : OP102 genotype : unc-119 (ed3); wgIs102 (ham-1::TY1 EGFP FLAG; unc-119(+)) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The HAM-1::EGFP fusion protein is expressed in the correct ham-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the HAM-1 transcription factor. made_by : R Waterston )|HAM-1_GFP_L4_ChIP_Rep1|L4	OP102(official name : ...	ChIP-Seq
SRX331149	SRA096600	Snyder_HAM-1_GFP_L4_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_HAM-1_GFP_L4_Input_Rep2;_Caenorhabditis_...	HAM-1_GFP_L4_Input_Rep2	HAM-1_GFP_L4_Input_Rep2	OP102(official name : OP102 genotype : unc-119 (ed3); wgIs102 (ham-1::TY1 EGFP FLAG; unc-119(+)) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The HAM-1::EGFP fusion protein is expressed in the correct ham-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the HAM-1 transcription factor. made_by : R Waterston )|HAM-1_GFP_L4_Input_Rep2|L4	OP102(official name : ...	ChIP-Seq
SRX331150	SRA096600	Snyder_HAM-1_GFP_L4_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_HAM-1_GFP_L4_ChIP_Rep2;_Caenorhabditis_e...	HAM-1_GFP_L4_ChIP_Rep2	HAM-1_GFP_L4_ChIP_Rep2	OP102(official name : OP102 genotype : unc-119 (ed3); wgIs102 (ham-1::TY1 EGFP FLAG; unc-119(+)) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The HAM-1::EGFP fusion protein is expressed in the correct ham-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the HAM-1 transcription factor. made_by : R Waterston )|HAM-1_GFP_L4_ChIP_Rep2|L4	OP102(official name : ...	ChIP-Seq
SRX331151	SRA096600	Snyder_HAM-1_GFP_L4_Input_Rep3;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_HAM-1_GFP_L4_Input_Rep3;_Caenorhabditis_...	HAM-1_GFP_L4_Input_Rep3	HAM-1_GFP_L4_Input_Rep3	OP102(official name : OP102 genotype : unc-119 (ed3); wgIs102 (ham-1::TY1 EGFP FLAG; unc-119(+)) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The HAM-1::EGFP fusion protein is expressed in the correct ham-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the HAM-1 transcription factor. made_by : R Waterston )|HAM-1_GFP_L4_Input_Rep3|L4	OP102(official name : ...	ChIP-Seq
SRX331152	SRA096600	Snyder_HAM-1_GFP_L4_ChIP_Rep3;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_HAM-1_GFP_L4_ChIP_Rep3;_Caenorhabditis_e...	HAM-1_GFP_L4_ChIP_Rep3	HAM-1_GFP_L4_ChIP_Rep3	OP102(official name : OP102 genotype : unc-119 (ed3); wgIs102 (ham-1::TY1 EGFP FLAG; unc-119(+)) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The HAM-1::EGFP fusion protein is expressed in the correct ham-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the HAM-1 transcription factor. made_by : R Waterston )|HAM-1_GFP_L4_ChIP_Rep3|L4	OP102(official name : ...	ChIP-Seq
SRX331153	SRA096601	Snyder_MAB-5_GFP_Embryo_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_MAB-5_GFP_Embryo_Input_Rep1;_Caenorhabdi...	MAB-5_GFP_Embryo_Input_Rep1	MAB-5_GFP_Embryo_Input...	OP27(official name : OP27 genotype : unc-119(ed3); wgIs27(mab-5::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The MAB-5::EGFP fusion protein is expressed in the correct mab-5 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the MAB-5 transcription factor. made_by : Bob Waterston's lab from UW )|MAB-5_GFP_Embryo_Input_Rep1|embryo	OP27(official name : O...	ChIP-Seq
SRX331154	SRA096601	Snyder_MAB-5_GFP_Embryo_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_MAB-5_GFP_Embryo_ChIP_Rep1;_Caenorhabdit...	MAB-5_GFP_Embryo_ChIP_Rep1	MAB-5_GFP_Embryo_ChIP_...	OP27(official name : OP27 genotype : unc-119(ed3); wgIs27(mab-5::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The MAB-5::EGFP fusion protein is expressed in the correct mab-5 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the MAB-5 transcription factor. made_by : Bob Waterston's lab from UW )|MAB-5_GFP_Embryo_ChIP_Rep1|embryo	OP27(official name : O...	ChIP-Seq
SRX331155	SRA096601	Snyder_MAB-5_GFP_Embryo_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_MAB-5_GFP_Embryo_Input_Rep2;_Caenorhabdi...	MAB-5_GFP_Embryo_Input_Rep2	MAB-5_GFP_Embryo_Input...	OP27(official name : OP27 genotype : unc-119(ed3); wgIs27(mab-5::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The MAB-5::EGFP fusion protein is expressed in the correct mab-5 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the MAB-5 transcription factor. made_by : Bob Waterston's lab from UW )|MAB-5_GFP_Embryo_Input_Rep2|embryo	OP27(official name : O...	ChIP-Seq
SRX331156	SRA096601	Snyder_MAB-5_GFP_Embryo_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_MAB-5_GFP_Embryo_ChIP_Rep2;_Caenorhabdit...	MAB-5_GFP_Embryo_ChIP_Rep2	MAB-5_GFP_Embryo_ChIP_...	OP27(official name : OP27 genotype : unc-119(ed3); wgIs27(mab-5::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The MAB-5::EGFP fusion protein is expressed in the correct mab-5 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the MAB-5 transcription factor. made_by : Bob Waterston's lab from UW )|MAB-5_GFP_Embryo_ChIP_Rep2|embryo	OP27(official name : O...	ChIP-Seq
SRX331157	SRA096602	Snyder_ELT-1_GFP_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_ELT-1_GFP_L3_Input_Rep1;_Caenorhabditis_...	ELT-1_GFP_L3_Input_Rep1	ELT-1_GFP_L3_Input_Rep1	OP354(official name : OP354 genotype : unc119(ed3); wgIs354(elt-1::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. made_by : Bob Waterston's lab from UW )|ELT-1_GFP_L3_Input_Rep1|L3	OP354(official name : ...	ChIP-Seq
SRX331158	SRA096602	Snyder_ELT-1_GFP_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_ELT-1_GFP_L3_ChIP_Rep1;_Caenorhabditis_e...	ELT-1_GFP_L3_ChIP_Rep1	ELT-1_GFP_L3_ChIP_Rep1	OP354(official name : OP354 genotype : unc119(ed3); wgIs354(elt-1::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. made_by : Bob Waterston's lab from UW )|ELT-1_GFP_L3_ChIP_Rep1|L3	OP354(official name : ...	ChIP-Seq
SRX331159	SRA096602	Snyder_ELT-1_GFP_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_ELT-1_GFP_L3_Input_Rep2;_Caenorhabditis_...	ELT-1_GFP_L3_Input_Rep2	ELT-1_GFP_L3_Input_Rep2	OP354(official name : OP354 genotype : unc119(ed3); wgIs354(elt-1::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. made_by : Bob Waterston's lab from UW )|ELT-1_GFP_L3_Input_Rep2|L3	OP354(official name : ...	ChIP-Seq
SRX331160	SRA096602	Snyder_ELT-1_GFP_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_ELT-1_GFP_L3_ChIP_Rep2;_Caenorhabditis_e...	ELT-1_GFP_L3_ChIP_Rep2	ELT-1_GFP_L3_ChIP_Rep2	OP354(official name : OP354 genotype : unc119(ed3); wgIs354(elt-1::TY1 EGFP FLAG; unc119) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. made_by : Bob Waterston's lab from UW )|ELT-1_GFP_L3_ChIP_Rep2|L3	OP354(official name : ...	ChIP-Seq
SRX331161	SRA096603	Snyder_LSY-2_GFP_Embryo_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_LSY-2_GFP_Embryo_Input_Rep1;_Caenorhabdi...	LSY-2_GFP_Embryo_Input_Rep1	LSY-2_GFP_Embryo_Input...	OP367(official name : OP367 genotype : unc-119(ed3); wgIs367(lsy-2::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The LSY-2::EGFP fusion protein is expressed in the correct lsy-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LSY-2 transcription factor. made_by : Bob Waterston's lab from UW )|LSY-2_GFP_Embryo_Input_Rep1|embryo	OP367(official name : ...	ChIP-Seq
SRX331162	SRA096603	Snyder_LSY-2_GFP_Embryo_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_LSY-2_GFP_Embryo_ChIP_Rep1;_Caenorhabdit...	LSY-2_GFP_Embryo_ChIP_Rep1	LSY-2_GFP_Embryo_ChIP_...	OP367(official name : OP367 genotype : unc-119(ed3); wgIs367(lsy-2::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The LSY-2::EGFP fusion protein is expressed in the correct lsy-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LSY-2 transcription factor. made_by : Bob Waterston's lab from UW )|LSY-2_GFP_Embryo_ChIP_Rep1|embryo	OP367(official name : ...	ChIP-Seq
SRX331163	SRA096603	Snyder_LSY-2_GFP_Embryo_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_LSY-2_GFP_Embryo_Input_Rep2;_Caenorhabdi...	LSY-2_GFP_Embryo_Input_Rep2	LSY-2_GFP_Embryo_Input...	OP367(official name : OP367 genotype : unc-119(ed3); wgIs367(lsy-2::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The LSY-2::EGFP fusion protein is expressed in the correct lsy-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LSY-2 transcription factor. made_by : Bob Waterston's lab from UW )|LSY-2_GFP_Embryo_Input_Rep2|embryo	OP367(official name : ...	ChIP-Seq
SRX331164	SRA096603	Snyder_LSY-2_GFP_Embryo_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_LSY-2_GFP_Embryo_ChIP_Rep2;_Caenorhabdit...	LSY-2_GFP_Embryo_ChIP_Rep2	LSY-2_GFP_Embryo_ChIP_...	OP367(official name : OP367 genotype : unc-119(ed3); wgIs367(lsy-2::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The LSY-2::EGFP fusion protein is expressed in the correct lsy-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LSY-2 transcription factor. made_by : Bob Waterston's lab from UW )|LSY-2_GFP_Embryo_ChIP_Rep2|embryo	OP367(official name : ...	ChIP-Seq
SRX331165	SRA096604	Snyder_LSY-2_GFP_L1_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_LSY-2_GFP_L1_Input_Rep1;_Caenorhabditis_...	LSY-2_GFP_L1_Input_Rep1	LSY-2_GFP_L1_Input_Rep1	OP367(official name : OP367 genotype : unc-119(ed3); wgIs367(lsy-2::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The LSY-2::EGFP fusion protein is expressed in the correct lsy-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LSY-2 transcription factor. made_by : Bob Waterston's lab from UW )|LSY-2_GFP_L1_Input_Rep1|fed L1	OP367(official name : ...	ChIP-Seq
SRX331166	SRA096604	Snyder_LSY-2_GFP_L1_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_LSY-2_GFP_L1_ChIP_Rep1;_Caenorhabditis_e...	LSY-2_GFP_L1_ChIP_Rep1	LSY-2_GFP_L1_ChIP_Rep1	OP367(official name : OP367 genotype : unc-119(ed3); wgIs367(lsy-2::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The LSY-2::EGFP fusion protein is expressed in the correct lsy-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LSY-2 transcription factor. made_by : Bob Waterston's lab from UW )|LSY-2_GFP_L1_ChIP_Rep1|fed L1	OP367(official name : ...	ChIP-Seq
SRX331168	SRA096604	Snyder_LSY-2_GFP_L1_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_LSY-2_GFP_L1_ChIP_Rep2;_Caenorhabditis_e...	LSY-2_GFP_L1_ChIP_Rep2	LSY-2_GFP_L1_ChIP_Rep2	OP367(official name : OP367 genotype : unc-119(ed3); wgIs367(lsy-2::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The LSY-2::EGFP fusion protein is expressed in the correct lsy-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LSY-2 transcription factor. made_by : Bob Waterston's lab from UW )|LSY-2_GFP_L1_ChIP_Rep2|fed L1	OP367(official name : ...	ChIP-Seq
SRX331169	SRA096605	Snyder_LSY-2_GFP_Starved_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_LSY-2_GFP_Starved_Input_Rep1;_Caenorhabd...	LSY-2_GFP_Starved_Input_Rep1	LSY-2_GFP_Starved_Inpu...	DevStageWorm:starved L1:MS:1(official name : starved L1 )|LSY-2_GFP_Starved_Input_Rep1|L1 larva	DevStageWorm:starved L...	ChIP-Seq
SRX331170	SRA096605	Snyder_LSY-2_GFP_Starved_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_LSY-2_GFP_Starved_ChIP_Rep1;_Caenorhabdi...	LSY-2_GFP_Starved_ChIP_Rep1	LSY-2_GFP_Starved_ChIP...	DevStageWorm:starved L1:MS:1(official name : starved L1 )|LSY-2_GFP_Starved_ChIP_Rep1|L1 larva	DevStageWorm:starved L...	ChIP-Seq
SRX331171	SRA096605	Snyder_LSY-2_GFP_Starved_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_LSY-2_GFP_Starved_Input_Rep2;_Caenorhabd...	LSY-2_GFP_Starved_Input_Rep2	LSY-2_GFP_Starved_Inpu...	DevStageWorm:starved L1:MS:1(official name : starved L1 )|LSY-2_GFP_Starved_Input_Rep2|L1 larva	DevStageWorm:starved L...	ChIP-Seq
SRX331172	SRA096605	Snyder_LSY-2_GFP_Starved_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_LSY-2_GFP_Starved_ChIP_Rep2;_Caenorhabdi...	LSY-2_GFP_Starved_ChIP_Rep2	LSY-2_GFP_Starved_ChIP...	DevStageWorm:starved L1:MS:1(official name : starved L1 )|LSY-2_GFP_Starved_ChIP_Rep2|L1 larva	DevStageWorm:starved L...	ChIP-Seq
SRX331173	SRA096606	Snyder_NHR-237_GFP_L2_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-237_GFP_L2_Input_Rep1;_Caenorhabditi...	NHR-237_GFP_L2_Input_Rep1	NHR-237_GFP_L2_Input_Rep1	OP228(official name : OP228 genotype : unc119(ed3); wgIs228(nhr-237:TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-237::EGFP fusion protein is expressed in the correct nhr-237 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-237 transcription factor. made_by : Unknown )|NHR-237_GFP_L2_Input_Rep1|L2	OP228(official name : ...	ChIP-Seq
SRX331174	SRA096606	Snyder_NHR-237_GFP_L2_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-237_GFP_L2_ChIP_Rep1;_Caenorhabditis...	NHR-237_GFP_L2_ChIP_Rep1	NHR-237_GFP_L2_ChIP_Rep1	OP228(official name : OP228 genotype : unc119(ed3); wgIs228(nhr-237:TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-237::EGFP fusion protein is expressed in the correct nhr-237 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-237 transcription factor. made_by : Unknown )|NHR-237_GFP_L2_ChIP_Rep1|L2	OP228(official name : ...	ChIP-Seq
SRX331175	SRA096606	Snyder_NHR-237_GFP_L2_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-237_GFP_L2_Input_Rep2;_Caenorhabditi...	NHR-237_GFP_L2_Input_Rep2	NHR-237_GFP_L2_Input_Rep2	OP228(official name : OP228 genotype : unc119(ed3); wgIs228(nhr-237:TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-237::EGFP fusion protein is expressed in the correct nhr-237 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-237 transcription factor. made_by : Unknown )|NHR-237_GFP_L2_Input_Rep2|L2	OP228(official name : ...	ChIP-Seq
SRX331176	SRA096606	Snyder_NHR-237_GFP_L2_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-237_GFP_L2_ChIP_Rep2;_Caenorhabditis...	NHR-237_GFP_L2_ChIP_Rep2	NHR-237_GFP_L2_ChIP_Rep2	OP228(official name : OP228 genotype : unc119(ed3); wgIs228(nhr-237:TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-237::EGFP fusion protein is expressed in the correct nhr-237 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-237 transcription factor. made_by : Unknown )|NHR-237_GFP_L2_ChIP_Rep2|L2	OP228(official name : ...	ChIP-Seq
SRX331177	SRA096607	Snyder_nhr-237_GFP_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_nhr-237_GFP_L3_Input_Rep1;_Caenorhabditi...	nhr-237_GFP_L3_Input_Rep1	nhr-237_GFP_L3_Input_Rep1	OP228(official name : OP228 genotype : unc119(ed3); wgIs228(nhr-237:TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-237::EGFP fusion protein is expressed in the correct nhr-237 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-237 transcription factor. made_by : Unknown )|nhr-237_GFP_L3_Input_Rep1|L3	OP228(official name : ...	ChIP-Seq
SRX331178	SRA096607	Snyder_nhr-237_GFP_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_nhr-237_GFP_L3_ChIP_Rep1;_Caenorhabditis...	nhr-237_GFP_L3_ChIP_Rep1	nhr-237_GFP_L3_ChIP_Rep1	OP228(official name : OP228 genotype : unc119(ed3); wgIs228(nhr-237:TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-237::EGFP fusion protein is expressed in the correct nhr-237 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-237 transcription factor. made_by : Unknown )|nhr-237_GFP_L3_ChIP_Rep1|L3	OP228(official name : ...	ChIP-Seq
SRX331179	SRA096607	Snyder_nhr-237_GFP_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_nhr-237_GFP_L3_Input_Rep2;_Caenorhabditi...	nhr-237_GFP_L3_Input_Rep2	nhr-237_GFP_L3_Input_Rep2	OP228(official name : OP228 genotype : unc119(ed3); wgIs228(nhr-237:TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-237::EGFP fusion protein is expressed in the correct nhr-237 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-237 transcription factor. made_by : Unknown )|nhr-237_GFP_L3_Input_Rep2|L3	OP228(official name : ...	ChIP-Seq
SRX331180	SRA096607	Snyder_nhr-237_GFP_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_nhr-237_GFP_L3_ChIP_Rep2;_Caenorhabditis...	nhr-237_GFP_L3_ChIP_Rep2	nhr-237_GFP_L3_ChIP_Rep2	OP228(official name : OP228 genotype : unc119(ed3); wgIs228(nhr-237:TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-237::EGFP fusion protein is expressed in the correct nhr-237 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-237 transcription factor. made_by : Unknown )|nhr-237_GFP_L3_ChIP_Rep2|L3	OP228(official name : ...	ChIP-Seq
SRX331181	SRA096608	Snyder_nhr-237_GFP_L1_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_nhr-237_GFP_L1_Input_Rep1;_Caenorhabditi...	nhr-237_GFP_L1_Input_Rep1	nhr-237_GFP_L1_Input_Rep1	OP228(official name : OP228 genotype : unc119(ed3); wgIs228(nhr-237:TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-237::EGFP fusion protein is expressed in the correct nhr-237 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-237 transcription factor. made_by : Unknown )|nhr-237_GFP_L1_Input_Rep1|L1 26dC	OP228(official name : ...	ChIP-Seq
SRX331182	SRA096608	Snyder_nhr-237_GFP_L1_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_nhr-237_GFP_L1_ChIP_Rep1;_Caenorhabditis...	nhr-237_GFP_L1_ChIP_Rep1	nhr-237_GFP_L1_ChIP_Rep1	OP228(official name : OP228 genotype : unc119(ed3); wgIs228(nhr-237:TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-237::EGFP fusion protein is expressed in the correct nhr-237 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-237 transcription factor. made_by : Unknown )|nhr-237_GFP_L1_ChIP_Rep1|L1 26dC	OP228(official name : ...	ChIP-Seq
SRX331183	SRA096608	Snyder_nhr-237_GFP_L1_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_nhr-237_GFP_L1_Input_Rep2;_Caenorhabditi...	nhr-237_GFP_L1_Input_Rep2	nhr-237_GFP_L1_Input_Rep2	OP228(official name : OP228 genotype : unc119(ed3); wgIs228(nhr-237:TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-237::EGFP fusion protein is expressed in the correct nhr-237 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-237 transcription factor. made_by : Unknown )|nhr-237_GFP_L1_Input_Rep2|L1 26dC	OP228(official name : ...	ChIP-Seq
SRX331184	SRA096608	Snyder_nhr-237_GFP_L1_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_nhr-237_GFP_L1_ChIP_Rep2;_Caenorhabditis...	nhr-237_GFP_L1_ChIP_Rep2	nhr-237_GFP_L1_ChIP_Rep2	OP228(official name : OP228 genotype : unc119(ed3); wgIs228(nhr-237:TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-237::EGFP fusion protein is expressed in the correct nhr-237 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-237 transcription factor. made_by : Unknown )|nhr-237_GFP_L1_ChIP_Rep2|L1 26dC	OP228(official name : ...	ChIP-Seq
SRX331185	SRA096609	Snyder_NHR-237_GFP_EMB_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-237_GFP_EMB_Input_Rep1;_Caenorhabdit...	NHR-237_GFP_EMB_Input_Rep1	NHR-237_GFP_EMB_Input_...	OP228(official name : OP228 genotype : unc119(ed3); wgIs228(nhr-237:TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-237::EGFP fusion protein is expressed in the correct nhr-237 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-237 transcription factor. made_by : Unknown )|NHR-237_GFP_EMB_Input_Rep1|embryo	OP228(official name : ...	ChIP-Seq
SRX331186	SRA096609	Snyder_NHR-237_GFP_EMB_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-237_GFP_EMB_ChIP_Rep1;_Caenorhabditi...	NHR-237_GFP_EMB_ChIP_Rep1	NHR-237_GFP_EMB_ChIP_Rep1	OP228(official name : OP228 genotype : unc119(ed3); wgIs228(nhr-237:TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-237::EGFP fusion protein is expressed in the correct nhr-237 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-237 transcription factor. made_by : Unknown )|NHR-237_GFP_EMB_ChIP_Rep1|embryo	OP228(official name : ...	ChIP-Seq
SRX331187	SRA096609	Snyder_NHR-237_GFP_EMB_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-237_GFP_EMB_Input_Rep2;_Caenorhabdit...	NHR-237_GFP_EMB_Input_Rep2	NHR-237_GFP_EMB_Input_...	OP228(official name : OP228 genotype : unc119(ed3); wgIs228(nhr-237:TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-237::EGFP fusion protein is expressed in the correct nhr-237 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-237 transcription factor. made_by : Unknown )|NHR-237_GFP_EMB_Input_Rep2|embryo	OP228(official name : ...	ChIP-Seq
SRX331188	SRA096609	Snyder_NHR-237_GFP_EMB_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-237_GFP_EMB_ChIP_Rep2;_Caenorhabditi...	NHR-237_GFP_EMB_ChIP_Rep2	NHR-237_GFP_EMB_ChIP_Rep2	OP228(official name : OP228 genotype : unc119(ed3); wgIs228(nhr-237:TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-237::EGFP fusion protein is expressed in the correct nhr-237 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-237 transcription factor. made_by : Unknown )|NHR-237_GFP_EMB_ChIP_Rep2|embryo	OP228(official name : ...	ChIP-Seq
SRX331189	SRA096610	Snyder_PAX-1_GFP_EMB_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_PAX-1_GFP_EMB_Input_Rep1;_Caenorhabditis...	PAX-1_GFP_EMB_Input_Rep1	PAX-1_GFP_EMB_Input_Rep1	OP117(official name : OP117 genotype : unc119(ed3); wgIs117(pax-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PAX-1::EGFP fusion protein is expressed in the correct pax-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PAX-1 transcription factor. made_by : Unknown )|PAX-1_GFP_EMB_Input_Rep1|embryo	OP117(official name : ...	ChIP-Seq
SRX331190	SRA096610	Snyder_PAX-1_GFP_EMB_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_PAX-1_GFP_EMB_ChIP_Rep1;_Caenorhabditis_...	PAX-1_GFP_EMB_ChIP_Rep1	PAX-1_GFP_EMB_ChIP_Rep1	OP117(official name : OP117 genotype : unc119(ed3); wgIs117(pax-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PAX-1::EGFP fusion protein is expressed in the correct pax-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PAX-1 transcription factor. made_by : Unknown )|PAX-1_GFP_EMB_ChIP_Rep1|embryo	OP117(official name : ...	ChIP-Seq
SRX331191	SRA096610	Snyder_PAX-1_GFP_EMB_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_PAX-1_GFP_EMB_Input_Rep2;_Caenorhabditis...	PAX-1_GFP_EMB_Input_Rep2	PAX-1_GFP_EMB_Input_Rep2	OP117(official name : OP117 genotype : unc119(ed3); wgIs117(pax-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PAX-1::EGFP fusion protein is expressed in the correct pax-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PAX-1 transcription factor. made_by : Unknown )|PAX-1_GFP_EMB_Input_Rep2|embryo	OP117(official name : ...	ChIP-Seq
SRX331192	SRA096610	Snyder_PAX-1_GFP_EMB_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_PAX-1_GFP_EMB_ChIP_Rep2;_Caenorhabditis_...	PAX-1_GFP_EMB_ChIP_Rep2	PAX-1_GFP_EMB_ChIP_Rep2	OP117(official name : OP117 genotype : unc119(ed3); wgIs117(pax-1::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PAX-1::EGFP fusion protein is expressed in the correct pax-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PAX-1 transcription factor. made_by : Unknown )|PAX-1_GFP_EMB_ChIP_Rep2|embryo	OP117(official name : ...	ChIP-Seq
SRX331193	SRA096611	Snyder_CES-1_GFP_EMB_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_CES-1_GFP_EMB_Input_Rep1;_Caenorhabditis...	CES-1_GFP_EMB_Input_Rep1	CES-1_GFP_EMB_Input_Rep1	OP174(official name : OP174 genotype : unc-119(ed3); wgIs174(ces-1::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CES-1::EGFP fusion protein is expressed in the correct ces-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CES-1 transcription factor. made_by : S. Kim )|CES-1_GFP_EMB_Input_Rep1|embryo	OP174(official name : ...	ChIP-Seq
SRX331194	SRA096611	Snyder_CES-1_GFP_EMB_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_CES-1_GFP_EMB_ChIP_Rep1;_Caenorhabditis_...	CES-1_GFP_EMB_ChIP_Rep1	CES-1_GFP_EMB_ChIP_Rep1	OP174(official name : OP174 genotype : unc-119(ed3); wgIs174(ces-1::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CES-1::EGFP fusion protein is expressed in the correct ces-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CES-1 transcription factor. made_by : S. Kim )|CES-1_GFP_EMB_ChIP_Rep1|embryo	OP174(official name : ...	ChIP-Seq
SRX331195	SRA096611	Snyder_CES-1_GFP_EMB_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_CES-1_GFP_EMB_Input_Rep2;_Caenorhabditis...	CES-1_GFP_EMB_Input_Rep2	CES-1_GFP_EMB_Input_Rep2	OP174(official name : OP174 genotype : unc-119(ed3); wgIs174(ces-1::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CES-1::EGFP fusion protein is expressed in the correct ces-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CES-1 transcription factor. made_by : S. Kim )|CES-1_GFP_EMB_Input_Rep2|embryo	OP174(official name : ...	ChIP-Seq
SRX331196	SRA096611	Snyder_CES-1_GFP_EMB_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_CES-1_GFP_EMB_ChIP_Rep2;_Caenorhabditis_...	CES-1_GFP_EMB_ChIP_Rep2	CES-1_GFP_EMB_ChIP_Rep2	OP174(official name : OP174 genotype : unc-119(ed3); wgIs174(ces-1::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CES-1::EGFP fusion protein is expressed in the correct ces-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CES-1 transcription factor. made_by : S. Kim )|CES-1_GFP_EMB_ChIP_Rep2|embryo	OP174(official name : ...	ChIP-Seq
SRX331197	SRA096612	Snyder_CEH-39_GFP_EMB_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_CEH-39_GFP_EMB_Input_Rep1;_Caenorhabditi...	CEH-39_GFP_EMB_Input_Rep1	CEH-39_GFP_EMB_Input_Rep1	OP169(official name : OP169 genotype : unc119(ed3); wgIs169(ceh-39::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CEH-39::EGFP fusion protein is expressed in the correct ceh-39 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CEH-39 transcription factor. made_by : Unknown )|CEH-39_GFP_EMB_Input_Rep1|embryo	OP169(official name : ...	ChIP-Seq
SRX331198	SRA096612	Snyder_CEH-39_GFP_EMB_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_CEH-39_GFP_EMB_ChIP_Rep1;_Caenorhabditis...	CEH-39_GFP_EMB_ChIP_Rep1	CEH-39_GFP_EMB_ChIP_Rep1	OP169(official name : OP169 genotype : unc119(ed3); wgIs169(ceh-39::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CEH-39::EGFP fusion protein is expressed in the correct ceh-39 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CEH-39 transcription factor. made_by : Unknown )|CEH-39_GFP_EMB_ChIP_Rep1|embryo	OP169(official name : ...	ChIP-Seq
SRX331199	SRA096612	Snyder_CEH-39_GFP_EMB_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_CEH-39_GFP_EMB_Input_Rep2;_Caenorhabditi...	CEH-39_GFP_EMB_Input_Rep2	CEH-39_GFP_EMB_Input_Rep2	OP169(official name : OP169 genotype : unc119(ed3); wgIs169(ceh-39::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CEH-39::EGFP fusion protein is expressed in the correct ceh-39 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CEH-39 transcription factor. made_by : Unknown )|CEH-39_GFP_EMB_Input_Rep2|embryo	OP169(official name : ...	ChIP-Seq
SRX331200	SRA096612	Snyder_CEH-39_GFP_EMB_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_CEH-39_GFP_EMB_ChIP_Rep2;_Caenorhabditis...	CEH-39_GFP_EMB_ChIP_Rep2	CEH-39_GFP_EMB_ChIP_Rep2	OP169(official name : OP169 genotype : unc119(ed3); wgIs169(ceh-39::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The CEH-39::EGFP fusion protein is expressed in the correct ceh-39 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the CEH-39 transcription factor. made_by : Unknown )|CEH-39_GFP_EMB_ChIP_Rep2|embryo	OP169(official name : ...	ChIP-Seq
SRX331201	SRA096613	Snyder_NHR-11_GFP_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-11_GFP_L3_Input_Rep1;_Caenorhabditis...	NHR-11_GFP_L3_Input_Rep1	NHR-11_GFP_L3_Input_Rep1	OP305(official name : OP305 genotype : unc119(ed3); wgIs305(nhr-11::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-11::EGFP fusion protein is expressed in the correct nhr-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-11 transcription factor. made_by : R Waterston )|NHR-11_GFP_L3_Input_Rep1|L3	OP305(official name : ...	ChIP-Seq
SRX331202	SRA096613	Snyder_NHR-11_GFP_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-11_GFP_L3_ChIP_Rep1;_Caenorhabditis_...	NHR-11_GFP_L3_ChIP_Rep1	NHR-11_GFP_L3_ChIP_Rep1	OP305(official name : OP305 genotype : unc119(ed3); wgIs305(nhr-11::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-11::EGFP fusion protein is expressed in the correct nhr-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-11 transcription factor. made_by : R Waterston )|NHR-11_GFP_L3_ChIP_Rep1|L3	OP305(official name : ...	ChIP-Seq
SRX331203	SRA096613	Snyder_NHR-11_GFP_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-11_GFP_L3_Input_Rep2;_Caenorhabditis...	NHR-11_GFP_L3_Input_Rep2	NHR-11_GFP_L3_Input_Rep2	OP305(official name : OP305 genotype : unc119(ed3); wgIs305(nhr-11::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-11::EGFP fusion protein is expressed in the correct nhr-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-11 transcription factor. made_by : R Waterston )|NHR-11_GFP_L3_Input_Rep2|L3	OP305(official name : ...	ChIP-Seq
SRX331204	SRA096613	Snyder_NHR-11_GFP_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-11_GFP_L3_ChIP_Rep2;_Caenorhabditis_...	NHR-11_GFP_L3_ChIP_Rep2	NHR-11_GFP_L3_ChIP_Rep2	OP305(official name : OP305 genotype : unc119(ed3); wgIs305(nhr-11::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-11::EGFP fusion protein is expressed in the correct nhr-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-11 transcription factor. made_by : R Waterston )|NHR-11_GFP_L3_ChIP_Rep2|L3	OP305(official name : ...	ChIP-Seq
SRX331205	SRA096614	Snyder_NHR-11_GFP_L4_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-11_GFP_L4_Input_Rep1;_Caenorhabditis...	NHR-11_GFP_L4_Input_Rep1	NHR-11_GFP_L4_Input_Rep1	OP305(official name : OP305 genotype : unc119(ed3); wgIs305(nhr-11::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-11::EGFP fusion protein is expressed in the correct nhr-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-11 transcription factor. made_by : R Waterston )|NHR-11_GFP_L4_Input_Rep1|L4	OP305(official name : ...	ChIP-Seq
SRX331206	SRA096614	Snyder_NHR-11_GFP_L4_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-11_GFP_L4_ChIP_Rep1;_Caenorhabditis_...	NHR-11_GFP_L4_ChIP_Rep1	NHR-11_GFP_L4_ChIP_Rep1	OP305(official name : OP305 genotype : unc119(ed3); wgIs305(nhr-11::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-11::EGFP fusion protein is expressed in the correct nhr-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-11 transcription factor. made_by : R Waterston )|NHR-11_GFP_L4_ChIP_Rep1|L4	OP305(official name : ...	ChIP-Seq
SRX331207	SRA096614	Snyder_NHR-11_GFP_L4_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-11_GFP_L4_Input_Rep2;_Caenorhabditis...	NHR-11_GFP_L4_Input_Rep2	NHR-11_GFP_L4_Input_Rep2	OP305(official name : OP305 genotype : unc119(ed3); wgIs305(nhr-11::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-11::EGFP fusion protein is expressed in the correct nhr-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-11 transcription factor. made_by : R Waterston )|NHR-11_GFP_L4_Input_Rep2|L4	OP305(official name : ...	ChIP-Seq
SRX331208	SRA096614	Snyder_NHR-11_GFP_L4_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-11_GFP_L4_ChIP_Rep2;_Caenorhabditis_...	NHR-11_GFP_L4_ChIP_Rep2	NHR-11_GFP_L4_ChIP_Rep2	OP305(official name : OP305 genotype : unc119(ed3); wgIs305(nhr-11::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-11::EGFP fusion protein is expressed in the correct nhr-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-11 transcription factor. made_by : R Waterston )|NHR-11_GFP_L4_ChIP_Rep2|L4	OP305(official name : ...	ChIP-Seq
SRX331209	SRA096615	Snyder_LIN-39_GFP_L2_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_LIN-39_GFP_L2_Input_Rep1;_Caenorhabditis...	LIN-39_GFP_L2_Input_Rep1	LIN-39_GFP_L2_Input_Rep1	OP18(official name : OP18 genotype : unc-119(ed3) III; wgIs18 unc-119(+) lin-39::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-39::EGFP fusion protein is expressed in the correct lin-39 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-39 transcription factor. made_by : R. Waterston and S. Kim )|LIN-39_GFP_L2_Input_Rep1|L2	OP18(official name : O...	ChIP-Seq
SRX331210	SRA096615	Snyder_LIN-39_GFP_L2_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_LIN-39_GFP_L2_ChIP_Rep1;_Caenorhabditis_...	LIN-39_GFP_L2_ChIP_Rep1	LIN-39_GFP_L2_ChIP_Rep1	OP18(official name : OP18 genotype : unc-119(ed3) III; wgIs18 unc-119(+) lin-39::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-39::EGFP fusion protein is expressed in the correct lin-39 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-39 transcription factor. made_by : R. Waterston and S. Kim )|LIN-39_GFP_L2_ChIP_Rep1|L2	OP18(official name : O...	ChIP-Seq
SRX331211	SRA096615	Snyder_LIN-39_GFP_L2_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_LIN-39_GFP_L2_Input_Rep2;_Caenorhabditis...	LIN-39_GFP_L2_Input_Rep2	LIN-39_GFP_L2_Input_Rep2	OP18(official name : OP18 genotype : unc-119(ed3) III; wgIs18 unc-119(+) lin-39::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-39::EGFP fusion protein is expressed in the correct lin-39 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-39 transcription factor. made_by : R. Waterston and S. Kim )|LIN-39_GFP_L2_Input_Rep2|L2	OP18(official name : O...	ChIP-Seq
SRX331212	SRA096615	Snyder_LIN-39_GFP_L2_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_LIN-39_GFP_L2_ChIP_Rep2;_Caenorhabditis_...	LIN-39_GFP_L2_ChIP_Rep2	LIN-39_GFP_L2_ChIP_Rep2	OP18(official name : OP18 genotype : unc-119(ed3) III; wgIs18 unc-119(+) lin-39::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-39::EGFP fusion protein is expressed in the correct lin-39 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-39 transcription factor. made_by : R. Waterston and S. Kim )|LIN-39_GFP_L2_ChIP_Rep2|L2	OP18(official name : O...	ChIP-Seq
SRX331213	SRA096616	Snyder_LIN-39_GFP_L4_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_LIN-39_GFP_L4_Input_Rep1;_Caenorhabditis...	LIN-39_GFP_L4_Input_Rep1	LIN-39_GFP_L4_Input_Rep1	OP18(official name : OP18 genotype : unc-119(ed3) III; wgIs18 unc-119(+) lin-39::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-39::EGFP fusion protein is expressed in the correct lin-39 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-39 transcription factor. made_by : R. Waterston and S. Kim )|LIN-39_GFP_L4_Input_Rep1|L4	OP18(official name : O...	ChIP-Seq
SRX331214	SRA096616	Snyder_LIN-39_GFP_L4_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_LIN-39_GFP_L4_ChIP_Rep1;_Caenorhabditis_...	LIN-39_GFP_L4_ChIP_Rep1	LIN-39_GFP_L4_ChIP_Rep1	OP18(official name : OP18 genotype : unc-119(ed3) III; wgIs18 unc-119(+) lin-39::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-39::EGFP fusion protein is expressed in the correct lin-39 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-39 transcription factor. made_by : R. Waterston and S. Kim )|LIN-39_GFP_L4_ChIP_Rep1|L4	OP18(official name : O...	ChIP-Seq
SRX331215	SRA096616	Snyder_LIN-39_GFP_L4_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_LIN-39_GFP_L4_Input_Rep2;_Caenorhabditis...	LIN-39_GFP_L4_Input_Rep2	LIN-39_GFP_L4_Input_Rep2	OP18(official name : OP18 genotype : unc-119(ed3) III; wgIs18 unc-119(+) lin-39::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-39::EGFP fusion protein is expressed in the correct lin-39 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-39 transcription factor. made_by : R. Waterston and S. Kim )|LIN-39_GFP_L4_Input_Rep2|L4	OP18(official name : O...	ChIP-Seq
SRX331216	SRA096616	Snyder_LIN-39_GFP_L4_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_LIN-39_GFP_L4_ChIP_Rep2;_Caenorhabditis_...	LIN-39_GFP_L4_ChIP_Rep2	LIN-39_GFP_L4_ChIP_Rep2	OP18(official name : OP18 genotype : unc-119(ed3) III; wgIs18 unc-119(+) lin-39::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-39::EGFP fusion protein is expressed in the correct lin-39 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-39 transcription factor. made_by : R. Waterston and S. Kim )|LIN-39_GFP_L4_ChIP_Rep2|L4	OP18(official name : O...	ChIP-Seq
SRX331217	SRA096617	Snyder_UNC_62_GFP_L4_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_UNC_62_GFP_L4_Input_Rep1;_Caenorhabditis...	UNC_62_GFP_L4_Input_Rep1	UNC_62_GFP_L4_Input_Rep1	OP600(official name : OP600 genotype : unc119(ed3); wgIs600(unc-62::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-62::EGFP fusion protein is expressed in the correct unc-62 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-62 transcription factor. made_by : S Kim )|UNC_62_GFP_L4_Input_Rep1|L4	OP600(official name : ...	ChIP-Seq
SRX331218	SRA096617	Snyder_UNC_62_GFP_L4_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_UNC_62_GFP_L4_ChIP_Rep1;_Caenorhabditis_...	UNC_62_GFP_L4_ChIP_Rep1	UNC_62_GFP_L4_ChIP_Rep1	OP600(official name : OP600 genotype : unc119(ed3); wgIs600(unc-62::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-62::EGFP fusion protein is expressed in the correct unc-62 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-62 transcription factor. made_by : S Kim )|UNC_62_GFP_L4_ChIP_Rep1|L4	OP600(official name : ...	ChIP-Seq
SRX331219	SRA096617	Snyder_UNC_62_GFP_L4_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_UNC_62_GFP_L4_Input_Rep2;_Caenorhabditis...	UNC_62_GFP_L4_Input_Rep2	UNC_62_GFP_L4_Input_Rep2	OP600(official name : OP600 genotype : unc119(ed3); wgIs600(unc-62::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-62::EGFP fusion protein is expressed in the correct unc-62 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-62 transcription factor. made_by : S Kim )|UNC_62_GFP_L4_Input_Rep2|L4	OP600(official name : ...	ChIP-Seq
SRX331220	SRA096617	Snyder_UNC_62_GFP_L4_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_UNC_62_GFP_L4_ChIP_Rep2;_Caenorhabditis_...	UNC_62_GFP_L4_ChIP_Rep2	UNC_62_GFP_L4_ChIP_Rep2	OP600(official name : OP600 genotype : unc119(ed3); wgIs600(unc-62::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-62::EGFP fusion protein is expressed in the correct unc-62 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-62 transcription factor. made_by : S Kim )|UNC_62_GFP_L4_ChIP_Rep2|L4	OP600(official name : ...	ChIP-Seq
SRX331221	SRA096618	Snyder_UNC_62_GFP_EMB_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_UNC_62_GFP_EMB_Input_Rep1;_Caenorhabditi...	UNC_62_GFP_EMB_Input_Rep1	UNC_62_GFP_EMB_Input_Rep1	OP600(official name : OP600 genotype : unc119(ed3); wgIs600(unc-62::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-62::EGFP fusion protein is expressed in the correct unc-62 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-62 transcription factor. made_by : S Kim )|UNC_62_GFP_EMB_Input_Rep1|embryo	OP600(official name : ...	ChIP-Seq
SRX331222	SRA096618	Snyder_UNC_62_GFP_EMB_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_UNC_62_GFP_EMB_ChIP_Rep1;_Caenorhabditis...	UNC_62_GFP_EMB_ChIP_Rep1	UNC_62_GFP_EMB_ChIP_Rep1	OP600(official name : OP600 genotype : unc119(ed3); wgIs600(unc-62::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-62::EGFP fusion protein is expressed in the correct unc-62 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-62 transcription factor. made_by : S Kim )|UNC_62_GFP_EMB_ChIP_Rep1|embryo	OP600(official name : ...	ChIP-Seq
SRX331223	SRA096618	Snyder_UNC_62_GFP_EMB_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_UNC_62_GFP_EMB_Input_Rep2;_Caenorhabditi...	UNC_62_GFP_EMB_Input_Rep2	UNC_62_GFP_EMB_Input_Rep2	OP600(official name : OP600 genotype : unc119(ed3); wgIs600(unc-62::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-62::EGFP fusion protein is expressed in the correct unc-62 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-62 transcription factor. made_by : S Kim )|UNC_62_GFP_EMB_Input_Rep2|embryo	OP600(official name : ...	ChIP-Seq
SRX331224	SRA096618	Snyder_UNC_62_GFP_EMB_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_UNC_62_GFP_EMB_ChIP_Rep2;_Caenorhabditis...	UNC_62_GFP_EMB_ChIP_Rep2	UNC_62_GFP_EMB_ChIP_Rep2	OP600(official name : OP600 genotype : unc119(ed3); wgIs600(unc-62::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The UNC-62::EGFP fusion protein is expressed in the correct unc-62 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the UNC-62 transcription factor. made_by : S Kim )|UNC_62_GFP_EMB_ChIP_Rep2|embryo	OP600(official name : ...	ChIP-Seq
SRX331225	SRA096619	Snyder_NHR-28_GFP_EMB_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-28_GFP_EMB_Input_Rep1;_Caenorhabditi...	NHR-28_GFP_EMB_Input_Rep1	NHR-28_GFP_EMB_Input_Rep1	OP317(official name : OP317 genotype : unc119(ed3); wgIs317(nhr-28::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-28::EGFP fusion protein is expressed in the correct nhr-28 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-28 transcription factor. made_by : R Waterston )|NHR-28_GFP_EMB_Input_Rep1|embryo	OP317(official name : ...	ChIP-Seq
SRX331226	SRA096619	Snyder_NHR-28_GFP_EMB_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-28_GFP_EMB_ChIP_Rep1;_Caenorhabditis...	NHR-28_GFP_EMB_ChIP_Rep1	NHR-28_GFP_EMB_ChIP_Rep1	OP317(official name : OP317 genotype : unc119(ed3); wgIs317(nhr-28::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-28::EGFP fusion protein is expressed in the correct nhr-28 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-28 transcription factor. made_by : R Waterston )|NHR-28_GFP_EMB_ChIP_Rep1|embryo	OP317(official name : ...	ChIP-Seq
SRX331227	SRA096619	Snyder_NHR-28_GFP_EMB_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-28_GFP_EMB_Input_Rep2;_Caenorhabditi...	NHR-28_GFP_EMB_Input_Rep2	NHR-28_GFP_EMB_Input_Rep2	OP317(official name : OP317 genotype : unc119(ed3); wgIs317(nhr-28::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-28::EGFP fusion protein is expressed in the correct nhr-28 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-28 transcription factor. made_by : R Waterston )|NHR-28_GFP_EMB_Input_Rep2|embryo	OP317(official name : ...	ChIP-Seq
SRX331228	SRA096619	Snyder_NHR-28_GFP_EMB_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-28_GFP_EMB_ChIP_Rep2;_Caenorhabditis...	NHR-28_GFP_EMB_ChIP_Rep2	NHR-28_GFP_EMB_ChIP_Rep2	OP317(official name : OP317 genotype : unc119(ed3); wgIs317(nhr-28::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-28::EGFP fusion protein is expressed in the correct nhr-28 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-28 transcription factor. made_by : R Waterston )|NHR-28_GFP_EMB_ChIP_Rep2|embryo	OP317(official name : ...	ChIP-Seq
SRX331229	SRA096620	Snyder_NHR-11_GFP_LEMB_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-11_GFP_LEMB_Input_Rep1;_Caenorhabdit...	NHR-11_GFP_LEMB_Input_Rep1	NHR-11_GFP_LEMB_Input_...	OP305(official name : OP305 genotype : unc119(ed3); wgIs305(nhr-11::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-11::EGFP fusion protein is expressed in the correct nhr-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-11 transcription factor. made_by : R Waterston )|NHR-11_GFP_LEMB_Input_Rep1|Late Embryo	OP305(official name : ...	ChIP-Seq
SRX331230	SRA096620	Snyder_NHR-11_GFP_LEMB_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-11_GFP_LEMB_ChIP_Rep1;_Caenorhabditi...	NHR-11_GFP_LEMB_ChIP_Rep1	NHR-11_GFP_LEMB_ChIP_Rep1	OP305(official name : OP305 genotype : unc119(ed3); wgIs305(nhr-11::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-11::EGFP fusion protein is expressed in the correct nhr-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-11 transcription factor. made_by : R Waterston )|NHR-11_GFP_LEMB_ChIP_Rep1|Late Embryo	OP305(official name : ...	ChIP-Seq
SRX331231	SRA096620	Snyder_NHR-11_GFP_LEMB_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-11_GFP_LEMB_Input_Rep2;_Caenorhabdit...	NHR-11_GFP_LEMB_Input_Rep2	NHR-11_GFP_LEMB_Input_...	OP305(official name : OP305 genotype : unc119(ed3); wgIs305(nhr-11::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-11::EGFP fusion protein is expressed in the correct nhr-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-11 transcription factor. made_by : R Waterston )|NHR-11_GFP_LEMB_Input_Rep2|Late Embryo	OP305(official name : ...	ChIP-Seq
SRX331232	SRA096620	Snyder_NHR-11_GFP_LEMB_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-11_GFP_LEMB_ChIP_Rep2;_Caenorhabditi...	NHR-11_GFP_LEMB_ChIP_Rep2	NHR-11_GFP_LEMB_ChIP_Rep2	OP305(official name : OP305 genotype : unc119(ed3); wgIs305(nhr-11::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-11::EGFP fusion protein is expressed in the correct nhr-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-11 transcription factor. made_by : R Waterston )|NHR-11_GFP_LEMB_ChIP_Rep2|Late Embryo	OP305(official name : ...	ChIP-Seq
SRX331233	SRA096621	Snyder_NHR-11_GFP_L1_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-11_GFP_L1_Input_Rep1;_Caenorhabditis...	NHR-11_GFP_L1_Input_Rep1	NHR-11_GFP_L1_Input_Rep1	OP305(official name : OP305 genotype : unc119(ed3); wgIs305(nhr-11::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-11::EGFP fusion protein is expressed in the correct nhr-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-11 transcription factor. made_by : R Waterston )|NHR-11_GFP_L1_Input_Rep1|L1 26dC	OP305(official name : ...	ChIP-Seq
SRX331234	SRA096621	Snyder_NHR-11_GFP_L1_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-11_GFP_L1_ChIP_Rep1;_Caenorhabditis_...	NHR-11_GFP_L1_ChIP_Rep1	NHR-11_GFP_L1_ChIP_Rep1	OP305(official name : OP305 genotype : unc119(ed3); wgIs305(nhr-11::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-11::EGFP fusion protein is expressed in the correct nhr-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-11 transcription factor. made_by : R Waterston )|NHR-11_GFP_L1_ChIP_Rep1|L1 26dC	OP305(official name : ...	ChIP-Seq
SRX331235	SRA096621	Snyder_NHR-11_GFP_L1_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-11_GFP_L1_Input_Rep2;_Caenorhabditis...	NHR-11_GFP_L1_Input_Rep2	NHR-11_GFP_L1_Input_Rep2	OP305(official name : OP305 genotype : unc119(ed3); wgIs305(nhr-11::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-11::EGFP fusion protein is expressed in the correct nhr-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-11 transcription factor. made_by : R Waterston )|NHR-11_GFP_L1_Input_Rep2|L1 26dC	OP305(official name : ...	ChIP-Seq
SRX331236	SRA096621	Snyder_NHR-11_GFP_L1_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-11_GFP_L1_ChIP_Rep2;_Caenorhabditis_...	NHR-11_GFP_L1_ChIP_Rep2	NHR-11_GFP_L1_ChIP_Rep2	OP305(official name : OP305 genotype : unc119(ed3); wgIs305(nhr-11::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-11::EGFP fusion protein is expressed in the correct nhr-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-11 transcription factor. made_by : R Waterston )|NHR-11_GFP_L1_ChIP_Rep2|L1 26dC	OP305(official name : ...	ChIP-Seq
SRX331237	SRA096622	Snyder_NHR-28_GFP_L1_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-28_GFP_L1_Input_Rep1;_Caenorhabditis...	NHR-28_GFP_L1_Input_Rep1	NHR-28_GFP_L1_Input_Rep1	OP317(official name : OP317 genotype : unc119(ed3); wgIs317(nhr-28::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-28::EGFP fusion protein is expressed in the correct nhr-28 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-28 transcription factor. made_by : R Waterston )|NHR-28_GFP_L1_Input_Rep1|L1 26dC	OP317(official name : ...	ChIP-Seq
SRX331238	SRA096622	Snyder_NHR-28_GFP_L1_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-28_GFP_L1_ChIP_Rep1;_Caenorhabditis_...	NHR-28_GFP_L1_ChIP_Rep1	NHR-28_GFP_L1_ChIP_Rep1	OP317(official name : OP317 genotype : unc119(ed3); wgIs317(nhr-28::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-28::EGFP fusion protein is expressed in the correct nhr-28 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-28 transcription factor. made_by : R Waterston )|NHR-28_GFP_L1_ChIP_Rep1|L1 26dC	OP317(official name : ...	ChIP-Seq
SRX331239	SRA096622	Snyder_NHR-28_GFP_L1_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-28_GFP_L1_Input_Rep2;_Caenorhabditis...	NHR-28_GFP_L1_Input_Rep2	NHR-28_GFP_L1_Input_Rep2	OP317(official name : OP317 genotype : unc119(ed3); wgIs317(nhr-28::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-28::EGFP fusion protein is expressed in the correct nhr-28 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-28 transcription factor. made_by : R Waterston )|NHR-28_GFP_L1_Input_Rep2|L1 26dC	OP317(official name : ...	ChIP-Seq
SRX331240	SRA096622	Snyder_NHR-28_GFP_L1_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-28_GFP_L1_ChIP_Rep2;_Caenorhabditis_...	NHR-28_GFP_L1_ChIP_Rep2	NHR-28_GFP_L1_ChIP_Rep2	OP317(official name : OP317 genotype : unc119(ed3); wgIs317(nhr-28::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-28::EGFP fusion protein is expressed in the correct nhr-28 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-28 transcription factor. made_by : R Waterston )|NHR-28_GFP_L1_ChIP_Rep2|L1 26dC	OP317(official name : ...	ChIP-Seq
SRX331241	SRA096623	Snyder_NHR-2_GFP_EMB_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-2_GFP_EMB_Input_Rep1;_Caenorhabditis...	NHR-2_GFP_EMB_Input_Rep1	NHR-2_GFP_EMB_Input_Rep1	OP99(official name : OP99 genotype : unc119(ed3); wgIs99(nhr-2::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-2::EGFP fusion protein is expressed in the correct nhr-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-2 transcription factor. made_by : Unknown )|NHR-2_GFP_EMB_Input_Rep1|embryo	OP99(official name : O...	ChIP-Seq
SRX331242	SRA096623	Snyder_NHR-2_GFP_EMB_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-2_GFP_EMB_ChIP_Rep1;_Caenorhabditis_...	NHR-2_GFP_EMB_ChIP_Rep1	NHR-2_GFP_EMB_ChIP_Rep1	OP99(official name : OP99 genotype : unc119(ed3); wgIs99(nhr-2::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-2::EGFP fusion protein is expressed in the correct nhr-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-2 transcription factor. made_by : Unknown )|NHR-2_GFP_EMB_ChIP_Rep1|embryo	OP99(official name : O...	ChIP-Seq
SRX331243	SRA096623	Snyder_NHR-2_GFP_EMB_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-2_GFP_EMB_Input_Rep2;_Caenorhabditis...	NHR-2_GFP_EMB_Input_Rep2	NHR-2_GFP_EMB_Input_Rep2	OP99(official name : OP99 genotype : unc119(ed3); wgIs99(nhr-2::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-2::EGFP fusion protein is expressed in the correct nhr-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-2 transcription factor. made_by : Unknown )|NHR-2_GFP_EMB_Input_Rep2|embryo	OP99(official name : O...	ChIP-Seq
SRX331244	SRA096623	Snyder_NHR-2_GFP_EMB_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-2_GFP_EMB_ChIP_Rep2;_Caenorhabditis_...	NHR-2_GFP_EMB_ChIP_Rep2	NHR-2_GFP_EMB_ChIP_Rep2	OP99(official name : OP99 genotype : unc119(ed3); wgIs99(nhr-2::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NHR-2::EGFP fusion protein is expressed in the correct nhr-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-2 transcription factor. made_by : Unknown )|NHR-2_GFP_EMB_ChIP_Rep2|embryo	OP99(official name : O...	ChIP-Seq
SRX331245	SRA096624	Snyder_FKH-10_GFP_LEMB_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_FKH-10_GFP_LEMB_Input_Rep1;_Caenorhabdit...	FKH-10_GFP_LEMB_Input_Rep1	FKH-10_GFP_LEMB_Input_...	OP337(official name : OP337 genotype : unc119(ed3); wgIs377(fkh-10::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The FKH-10::EGFP fusion protein is expressed in the correct fkh-10 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the FKH-10 transcription factor. made_by : Unknown )|FKH-10_GFP_LEMB_Input_Rep1|Late Embryo	OP337(official name : ...	ChIP-Seq
SRX331246	SRA096624	Snyder_FKH-10_GFP_LEMB_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_FKH-10_GFP_LEMB_ChIP_Rep1;_Caenorhabditi...	FKH-10_GFP_LEMB_ChIP_Rep1	FKH-10_GFP_LEMB_ChIP_Rep1	OP337(official name : OP337 genotype : unc119(ed3); wgIs377(fkh-10::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The FKH-10::EGFP fusion protein is expressed in the correct fkh-10 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the FKH-10 transcription factor. made_by : Unknown )|FKH-10_GFP_LEMB_ChIP_Rep1|Late Embryo	OP337(official name : ...	ChIP-Seq
SRX331247	SRA096624	Snyder_FKH-10_GFP_LEMB_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_FKH-10_GFP_LEMB_Input_Rep2;_Caenorhabdit...	FKH-10_GFP_LEMB_Input_Rep2	FKH-10_GFP_LEMB_Input_...	OP337(official name : OP337 genotype : unc119(ed3); wgIs377(fkh-10::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The FKH-10::EGFP fusion protein is expressed in the correct fkh-10 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the FKH-10 transcription factor. made_by : Unknown )|FKH-10_GFP_LEMB_Input_Rep2|Late Embryo	OP337(official name : ...	ChIP-Seq
SRX331248	SRA096624	Snyder_FKH-10_GFP_LEMB_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_FKH-10_GFP_LEMB_ChIP_Rep2;_Caenorhabditi...	FKH-10_GFP_LEMB_ChIP_Rep2	FKH-10_GFP_LEMB_ChIP_Rep2	OP337(official name : OP337 genotype : unc119(ed3); wgIs377(fkh-10::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The FKH-10::EGFP fusion protein is expressed in the correct fkh-10 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the FKH-10 transcription factor. made_by : Unknown )|FKH-10_GFP_LEMB_ChIP_Rep2|Late Embryo	OP337(official name : ...	ChIP-Seq
SRX331249	SRA096625	Snyder_FKH-10_GFP_L4_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_FKH-10_GFP_L4_Input_Rep1;_Caenorhabditis...	FKH-10_GFP_L4_Input_Rep1	FKH-10_GFP_L4_Input_Rep1	OP337(official name : OP337 genotype : unc119(ed3); wgIs377(fkh-10::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The FKH-10::EGFP fusion protein is expressed in the correct fkh-10 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the FKH-10 transcription factor. made_by : Unknown )|FKH-10_GFP_L4_Input_Rep1|L4	OP337(official name : ...	ChIP-Seq
SRX331250	SRA096625	Snyder_FKH-10_GFP_L4_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_FKH-10_GFP_L4_ChIP_Rep1;_Caenorhabditis_...	FKH-10_GFP_L4_ChIP_Rep1	FKH-10_GFP_L4_ChIP_Rep1	OP337(official name : OP337 genotype : unc119(ed3); wgIs377(fkh-10::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The FKH-10::EGFP fusion protein is expressed in the correct fkh-10 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the FKH-10 transcription factor. made_by : Unknown )|FKH-10_GFP_L4_ChIP_Rep1|L4	OP337(official name : ...	ChIP-Seq
SRX331251	SRA096625	Snyder_FKH-10_GFP_L4_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_FKH-10_GFP_L4_Input_Rep2;_Caenorhabditis...	FKH-10_GFP_L4_Input_Rep2	FKH-10_GFP_L4_Input_Rep2	OP337(official name : OP337 genotype : unc119(ed3); wgIs377(fkh-10::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The FKH-10::EGFP fusion protein is expressed in the correct fkh-10 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the FKH-10 transcription factor. made_by : Unknown )|FKH-10_GFP_L4_Input_Rep2|L4	OP337(official name : ...	ChIP-Seq
SRX331252	SRA096625	Snyder_FKH-10_GFP_L4_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_FKH-10_GFP_L4_ChIP_Rep2;_Caenorhabditis_...	FKH-10_GFP_L4_ChIP_Rep2	FKH-10_GFP_L4_ChIP_Rep2	OP337(official name : OP337 genotype : unc119(ed3); wgIs377(fkh-10::TY1 EGFP FLAG; unc119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The FKH-10::EGFP fusion protein is expressed in the correct fkh-10 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the FKH-10 transcription factor. made_by : Unknown )|FKH-10_GFP_L4_ChIP_Rep2|L4	OP337(official name : ...	ChIP-Seq
SRX331253	SRA096626	Snyder_NHR-67_GFP_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-67_GFP_L3_Input_Rep1;_Caenorhabditis...	NHR-67_GFP_L3_Input_Rep1	NHR-67_GFP_L3_Input_Rep1	OP373(official name : OP373 genotype : unc119(ed3); wgIs373(nhr-67::TY1 EGFP FLAG; unc119 outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-67 transcription factor. made_by : Bob Waterston's lab from UW )|NHR-67_GFP_L3_Input_Rep1|L3	OP373(official name : ...	ChIP-Seq
SRX331254	SRA096626	Snyder_NHR-67_GFP_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-67_GFP_L3_ChIP_Rep1;_Caenorhabditis_...	NHR-67_GFP_L3_ChIP_Rep1	NHR-67_GFP_L3_ChIP_Rep1	OP373(official name : OP373 genotype : unc119(ed3); wgIs373(nhr-67::TY1 EGFP FLAG; unc119 outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-67 transcription factor. made_by : Bob Waterston's lab from UW )|NHR-67_GFP_L3_ChIP_Rep1|L3	OP373(official name : ...	ChIP-Seq
SRX331255	SRA096626	Snyder_NHR-67_GFP_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-67_GFP_L3_Input_Rep2;_Caenorhabditis...	NHR-67_GFP_L3_Input_Rep2	NHR-67_GFP_L3_Input_Rep2	OP373(official name : OP373 genotype : unc119(ed3); wgIs373(nhr-67::TY1 EGFP FLAG; unc119 outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-67 transcription factor. made_by : Bob Waterston's lab from UW )|NHR-67_GFP_L3_Input_Rep2|L3	OP373(official name : ...	ChIP-Seq
SRX331256	SRA096626	Snyder_NHR-67_GFP_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NHR-67_GFP_L3_ChIP_Rep2;_Caenorhabditis_...	NHR-67_GFP_L3_ChIP_Rep2	NHR-67_GFP_L3_ChIP_Rep2	OP373(official name : OP373 genotype : unc119(ed3); wgIs373(nhr-67::TY1 EGFP FLAG; unc119 outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NHR-67 transcription factor. made_by : Bob Waterston's lab from UW )|NHR-67_GFP_L3_ChIP_Rep2|L3	OP373(official name : ...	ChIP-Seq
SRX331257	SRA096627	Snyder_LIN-39_GFP_L1_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_LIN-39_GFP_L1_Input_Rep1;_Caenorhabditis...	LIN-39_GFP_L1_Input_Rep1	LIN-39_GFP_L1_Input_Rep1	OP18(official name : OP18 genotype : unc-119(ed3) III; wgIs18 unc-119(+) lin-39::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-39::EGFP fusion protein is expressed in the correct lin-39 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-39 transcription factor. made_by : R. Waterston and S. Kim )|LIN-39_GFP_L1_Input_Rep1|fed L1	OP18(official name : O...	ChIP-Seq
SRX331258	SRA096627	Snyder_LIN-39_GFP_L1_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_LIN-39_GFP_L1_ChIP_Rep1;_Caenorhabditis_...	LIN-39_GFP_L1_ChIP_Rep1	LIN-39_GFP_L1_ChIP_Rep1	OP18(official name : OP18 genotype : unc-119(ed3) III; wgIs18 unc-119(+) lin-39::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-39::EGFP fusion protein is expressed in the correct lin-39 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-39 transcription factor. made_by : R. Waterston and S. Kim )|LIN-39_GFP_L1_ChIP_Rep1|fed L1	OP18(official name : O...	ChIP-Seq
SRX331259	SRA096627	Snyder_LIN-39_GFP_L1_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_LIN-39_GFP_L1_Input_Rep2;_Caenorhabditis...	LIN-39_GFP_L1_Input_Rep2	LIN-39_GFP_L1_Input_Rep2	OP18(official name : OP18 genotype : unc-119(ed3) III; wgIs18 unc-119(+) lin-39::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-39::EGFP fusion protein is expressed in the correct lin-39 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-39 transcription factor. made_by : R. Waterston and S. Kim )|LIN-39_GFP_L1_Input_Rep2|fed L1	OP18(official name : O...	ChIP-Seq
SRX331260	SRA096627	Snyder_LIN-39_GFP_L1_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_LIN-39_GFP_L1_ChIP_Rep2;_Caenorhabditis_...	LIN-39_GFP_L1_ChIP_Rep2	LIN-39_GFP_L1_ChIP_Rep2	OP18(official name : OP18 genotype : unc-119(ed3) III; wgIs18 unc-119(+) lin-39::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The LIN-39::EGFP fusion protein is expressed in the correct lin-39 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the LIN-39 transcription factor. made_by : R. Waterston and S. Kim )|LIN-39_GFP_L1_ChIP_Rep2|fed L1	OP18(official name : O...	ChIP-Seq
SRX331261	SRA096628	Snyder_PHA-4_Male_L4_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_PHA-4_Male_L4_Input_Rep1;_Caenorhabditis...	PHA-4_Male_L4_Input_Rep1	PHA-4_Male_L4_Input_Rep1	OP37(official name : OP37 genotype : unc-119(ed3) III; wgIs37 unc-119(+) pha-4::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PHA-4::EGFP fusion protein is expressed in the correct pha-4 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PHA-4 transcription factor. made_by : R. Waterston and S. Kim )|PHA-4_Male_L4_Input_Rep1|L4	OP37(official name : O...	ChIP-Seq
SRX331262	SRA096628	Snyder_PHA-4_Male_L4_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_PHA-4_Male_L4_ChIP_Rep1;_Caenorhabditis_...	PHA-4_Male_L4_ChIP_Rep1	PHA-4_Male_L4_ChIP_Rep1	OP37(official name : OP37 genotype : unc-119(ed3) III; wgIs37 unc-119(+) pha-4::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PHA-4::EGFP fusion protein is expressed in the correct pha-4 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PHA-4 transcription factor. made_by : R. Waterston and S. Kim )|PHA-4_Male_L4_ChIP_Rep1|L4	OP37(official name : O...	ChIP-Seq
SRX331263	SRA096628	Snyder_PHA-4_Male_L4_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_PHA-4_Male_L4_Input_Rep2;_Caenorhabditis...	PHA-4_Male_L4_Input_Rep2	PHA-4_Male_L4_Input_Rep2	OP37(official name : OP37 genotype : unc-119(ed3) III; wgIs37 unc-119(+) pha-4::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PHA-4::EGFP fusion protein is expressed in the correct pha-4 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PHA-4 transcription factor. made_by : R. Waterston and S. Kim )|PHA-4_Male_L4_Input_Rep2|L4	OP37(official name : O...	ChIP-Seq
SRX331264	SRA096628	Snyder_PHA-4_Male_L4_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_PHA-4_Male_L4_ChIP_Rep2;_Caenorhabditis_...	PHA-4_Male_L4_ChIP_Rep2	PHA-4_Male_L4_ChIP_Rep2	OP37(official name : OP37 genotype : unc-119(ed3) III; wgIs37 unc-119(+) pha-4::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PHA-4::EGFP fusion protein is expressed in the correct pha-4 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PHA-4 transcription factor. made_by : R. Waterston and S. Kim )|PHA-4_Male_L4_ChIP_Rep2|L4	OP37(official name : O...	ChIP-Seq
SRX331265	SRA096628	Snyder_PHA-4_Male_L4_Input_Rep3;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_PHA-4_Male_L4_Input_Rep3;_Caenorhabditis...	PHA-4_Male_L4_Input_Rep3	PHA-4_Male_L4_Input_Rep3	OP37(official name : OP37 genotype : unc-119(ed3) III; wgIs37 unc-119(+) pha-4::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PHA-4::EGFP fusion protein is expressed in the correct pha-4 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PHA-4 transcription factor. made_by : R. Waterston and S. Kim )|PHA-4_Male_L4_Input_Rep3|L4	OP37(official name : O...	ChIP-Seq
SRX331266	SRA096628	Snyder_PHA-4_Male_L4_ChIP_Rep3;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_PHA-4_Male_L4_ChIP_Rep3;_Caenorhabditis_...	PHA-4_Male_L4_ChIP_Rep3	PHA-4_Male_L4_ChIP_Rep3	OP37(official name : OP37 genotype : unc-119(ed3) III; wgIs37 unc-119(+) pha-4::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The PHA-4::EGFP fusion protein is expressed in the correct pha-4 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the PHA-4 transcription factor. made_by : R. Waterston and S. Kim )|PHA-4_Male_L4_ChIP_Rep3|L4	OP37(official name : O...	ChIP-Seq
SRX331267	SRA096629	Snyder_N2_POLIII_YA_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_N2_POLIII_YA_Input_Rep1;_Caenorhabditis_...	N2_POLIII_YA_Input_Rep1	N2_POLIII_YA_Input_Rep1	N2(official name : N2 genotype : wild type genotype : DR subclone of DB original (Tc1 pattern I) )|N2_POLIII_YA_Input_Rep1|Young adult	N2(official name : N2 ...	ChIP-Seq
SRX331268	SRA096629	Snyder_N2_POLIII_YA_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_N2_POLIII_YA_ChIP_Rep1;_Caenorhabditis_e...	N2_POLIII_YA_ChIP_Rep1	N2_POLIII_YA_ChIP_Rep1	N2(official name : N2 genotype : wild type genotype : DR subclone of DB original (Tc1 pattern I) )|N2_POLIII_YA_ChIP_Rep1|Young adult	N2(official name : N2 ...	ChIP-Seq
SRX331269	SRA096629	Snyder_N2_POLIII_YA_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_N2_POLIII_YA_Input_Rep2;_Caenorhabditis_...	N2_POLIII_YA_Input_Rep2	N2_POLIII_YA_Input_Rep2	N2(official name : N2 genotype : wild type genotype : DR subclone of DB original (Tc1 pattern I) )|N2_POLIII_YA_Input_Rep2|Young adult	N2(official name : N2 ...	ChIP-Seq
SRX331270	SRA096629	Snyder_N2_POLIII_YA_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_N2_POLIII_YA_ChIP_Rep2;_Caenorhabditis_e...	N2_POLIII_YA_ChIP_Rep2	N2_POLIII_YA_ChIP_Rep2	N2(official name : N2 genotype : wild type genotype : DR subclone of DB original (Tc1 pattern I) )|N2_POLIII_YA_ChIP_Rep2|Young adult	N2(official name : N2 ...	ChIP-Seq
SRX331271	SRA096630	Snyder_UNC-55_GFP_L2_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_UNC-55_GFP_L2_Input_Rep1;_Caenorhabditis...	UNC-55_GFP_L2_Input_Rep1	UNC-55_GFP_L2_Input_Rep1	NC1639(official name : NC1639 genotype : wdIs49 (pttr39::UNC-55a::GFP; dpy-20+) III outcross : 0 mutagen : None tags : GFP description : Expresses functional *GFP-tagged UNC-55* (COUP-TF) in ventral cord GABA motor neurons (also some ectopic expression in other cells). This line is integrated and shows strong GFP expression. made_by : David Miller lab )|UNC-55_GFP_L2_Input_Rep1|L2	NC1639(official name :...	ChIP-Seq
SRX331272	SRA096630	Snyder_UNC-55_GFP_L2_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_UNC-55_GFP_L2_ChIP_Rep1;_Caenorhabditis_...	UNC-55_GFP_L2_ChIP_Rep1	UNC-55_GFP_L2_ChIP_Rep1	NC1639(official name : NC1639 genotype : wdIs49 (pttr39::UNC-55a::GFP; dpy-20+) III outcross : 0 mutagen : None tags : GFP description : Expresses functional *GFP-tagged UNC-55* (COUP-TF) in ventral cord GABA motor neurons (also some ectopic expression in other cells). This line is integrated and shows strong GFP expression. made_by : David Miller lab )|UNC-55_GFP_L2_ChIP_Rep1|L2	NC1639(official name :...	ChIP-Seq
SRX331273	SRA096630	Snyder_UNC-55_GFP_L2_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_UNC-55_GFP_L2_Input_Rep2;_Caenorhabditis...	UNC-55_GFP_L2_Input_Rep2	UNC-55_GFP_L2_Input_Rep2	NC1639(official name : NC1639 genotype : wdIs49 (pttr39::UNC-55a::GFP; dpy-20+) III outcross : 0 mutagen : None tags : GFP description : Expresses functional *GFP-tagged UNC-55* (COUP-TF) in ventral cord GABA motor neurons (also some ectopic expression in other cells). This line is integrated and shows strong GFP expression. made_by : David Miller lab )|UNC-55_GFP_L2_Input_Rep2|L2	NC1639(official name :...	ChIP-Seq
SRX331274	SRA096630	Snyder_UNC-55_GFP_L2_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_UNC-55_GFP_L2_ChIP_Rep2;_Caenorhabditis_...	UNC-55_GFP_L2_ChIP_Rep2	UNC-55_GFP_L2_ChIP_Rep2	NC1639(official name : NC1639 genotype : wdIs49 (pttr39::UNC-55a::GFP; dpy-20+) III outcross : 0 mutagen : None tags : GFP description : Expresses functional *GFP-tagged UNC-55* (COUP-TF) in ventral cord GABA motor neurons (also some ectopic expression in other cells). This line is integrated and shows strong GFP expression. made_by : David Miller lab )|UNC-55_GFP_L2_ChIP_Rep2|L2	NC1639(official name :...	ChIP-Seq
SRX331275	SRA096630	Snyder_UNC-55_GFP_L2_Input_Rep3;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_UNC-55_GFP_L2_Input_Rep3;_Caenorhabditis...	UNC-55_GFP_L2_Input_Rep3	UNC-55_GFP_L2_Input_Rep3	NC1639(official name : NC1639 genotype : wdIs49 (pttr39::UNC-55a::GFP; dpy-20+) III outcross : 0 mutagen : None tags : GFP description : Expresses functional *GFP-tagged UNC-55* (COUP-TF) in ventral cord GABA motor neurons (also some ectopic expression in other cells). This line is integrated and shows strong GFP expression. made_by : David Miller lab )|UNC-55_GFP_L2_Input_Rep3|L2	NC1639(official name :...	ChIP-Seq
SRX331276	SRA096630	Snyder_UNC-55_GFP_L2_ChIP_Rep3;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_UNC-55_GFP_L2_ChIP_Rep3;_Caenorhabditis_...	UNC-55_GFP_L2_ChIP_Rep3	UNC-55_GFP_L2_ChIP_Rep3	NC1639(official name : NC1639 genotype : wdIs49 (pttr39::UNC-55a::GFP; dpy-20+) III outcross : 0 mutagen : None tags : GFP description : Expresses functional *GFP-tagged UNC-55* (COUP-TF) in ventral cord GABA motor neurons (also some ectopic expression in other cells). This line is integrated and shows strong GFP expression. made_by : David Miller lab )|UNC-55_GFP_L2_ChIP_Rep3|L2	NC1639(official name :...	ChIP-Seq
SRX331277	SRA096631	Snyder_BLMP-1_GFP_Emb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_BLMP-1_GFP_Emb_Input_Rep1;_Caenorhabditi...	BLMP-1_GFP_Emb_Input_Rep1	BLMP-1_GFP_Emb_Input_Rep1	OP109(official name : OP109 genotype : unc-119 (ed3) III; wgIs109 blmp-1::TY1::EGFP::FLAG; unc-119 (+) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The BLMP-1::EGFP fusion protein is expressed in the correct blmp-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the BLMP-1 transcription factor. made_by : R Waterston )|BLMP-1_GFP_Emb_Input_Rep1|embryo	OP109(official name : ...	ChIP-Seq
SRX331278	SRA096631	Snyder_BLMP-1_GFP_Emb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_BLMP-1_GFP_Emb_ChIP_Rep1;_Caenorhabditis...	BLMP-1_GFP_Emb_ChIP_Rep1	BLMP-1_GFP_Emb_ChIP_Rep1	OP109(official name : OP109 genotype : unc-119 (ed3) III; wgIs109 blmp-1::TY1::EGFP::FLAG; unc-119 (+) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The BLMP-1::EGFP fusion protein is expressed in the correct blmp-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the BLMP-1 transcription factor. made_by : R Waterston )|BLMP-1_GFP_Emb_ChIP_Rep1|embryo	OP109(official name : ...	ChIP-Seq
SRX331279	SRA096631	Snyder_BLMP-1_GFP_Emb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_BLMP-1_GFP_Emb_Input_Rep2;_Caenorhabditi...	BLMP-1_GFP_Emb_Input_Rep2	BLMP-1_GFP_Emb_Input_Rep2	OP109(official name : OP109 genotype : unc-119 (ed3) III; wgIs109 blmp-1::TY1::EGFP::FLAG; unc-119 (+) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The BLMP-1::EGFP fusion protein is expressed in the correct blmp-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the BLMP-1 transcription factor. made_by : R Waterston )|BLMP-1_GFP_Emb_Input_Rep2|embryo	OP109(official name : ...	ChIP-Seq
SRX331280	SRA096631	Snyder_BLMP-1_GFP_Emb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_BLMP-1_GFP_Emb_ChIP_Rep2;_Caenorhabditis...	BLMP-1_GFP_Emb_ChIP_Rep2	BLMP-1_GFP_Emb_ChIP_Rep2	OP109(official name : OP109 genotype : unc-119 (ed3) III; wgIs109 blmp-1::TY1::EGFP::FLAG; unc-119 (+) outcross : 0 mutagen : None tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The BLMP-1::EGFP fusion protein is expressed in the correct blmp-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the BLMP-1 transcription factor. made_by : R Waterston )|BLMP-1_GFP_Emb_ChIP_Rep2|embryo	OP109(official name : ...	ChIP-Seq
SRX331281	SRA096632	Snyder_GEI-11_GFP_Emb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_GEI-11_GFP_Emb_Input_Rep1;_Caenorhabditi...	GEI-11_GFP_Emb_Input_Rep1	GEI-11_GFP_Emb_Input_Rep1	OP179(official name : OP179 genotype : unc-119(ed3) III; wgIs179 unc-119(+) gei-11::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The GEI-11::EGFP fusion protein is expressed in the correct gei-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the GEI-11 transcription factor. made_by : R. Waterston )|GEI-11_GFP_Emb_Input_Rep1|embryo	OP179(official name : ...	ChIP-Seq
SRX331282	SRA096632	Snyder_GEI-11_GFP_Emb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_GEI-11_GFP_Emb_ChIP_Rep1;_Caenorhabditis...	GEI-11_GFP_Emb_ChIP_Rep1	GEI-11_GFP_Emb_ChIP_Rep1	OP179(official name : OP179 genotype : unc-119(ed3) III; wgIs179 unc-119(+) gei-11::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The GEI-11::EGFP fusion protein is expressed in the correct gei-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the GEI-11 transcription factor. made_by : R. Waterston )|GEI-11_GFP_Emb_ChIP_Rep1|embryo	OP179(official name : ...	ChIP-Seq
SRX331283	SRA096632	Snyder_GEI-11_GFP_Emb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_GEI-11_GFP_Emb_Input_Rep2;_Caenorhabditi...	GEI-11_GFP_Emb_Input_Rep2	GEI-11_GFP_Emb_Input_Rep2	OP179(official name : OP179 genotype : unc-119(ed3) III; wgIs179 unc-119(+) gei-11::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The GEI-11::EGFP fusion protein is expressed in the correct gei-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the GEI-11 transcription factor. made_by : R. Waterston )|GEI-11_GFP_Emb_Input_Rep2|embryo	OP179(official name : ...	ChIP-Seq
SRX331284	SRA096632	Snyder_GEI-11_GFP_Emb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_GEI-11_GFP_Emb_ChIP_Rep2;_Caenorhabditis...	GEI-11_GFP_Emb_ChIP_Rep2	GEI-11_GFP_Emb_ChIP_Rep2	OP179(official name : OP179 genotype : unc-119(ed3) III; wgIs179 unc-119(+) gei-11::TY1::EGFP::3xFLAG outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology in Tubiginen using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The GEI-11::EGFP fusion protein is expressed in the correct gei-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the GEI-11 transcription factor. made_by : R. Waterston )|GEI-11_GFP_Emb_ChIP_Rep2|embryo	OP179(official name : ...	ChIP-Seq
SRX331285	SRA096633	Snyder_MAB-5_GFP_L2_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_MAB-5_GFP_L2_Input_Rep1;_Caenorhabditis_...	MAB-5_GFP_L2_Input_Rep1	MAB-5_GFP_L2_Input_Rep1	OP27(official name : OP27 genotype : unc-119(ed3); wgIs27(mab-5::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The MAB-5::EGFP fusion protein is expressed in the correct mab-5 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the MAB-5 transcription factor. made_by : Bob Waterston's lab from UW )|MAB-5_GFP_L2_Input_Rep1|L2	OP27(official name : O...	ChIP-Seq
SRX331286	SRA096633	Snyder_MAB-5_GFP_L2_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_MAB-5_GFP_L2_ChIP_Rep1;_Caenorhabditis_e...	MAB-5_GFP_L2_ChIP_Rep1	MAB-5_GFP_L2_ChIP_Rep1	OP27(official name : OP27 genotype : unc-119(ed3); wgIs27(mab-5::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The MAB-5::EGFP fusion protein is expressed in the correct mab-5 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the MAB-5 transcription factor. made_by : Bob Waterston's lab from UW )|MAB-5_GFP_L2_ChIP_Rep1|L2	OP27(official name : O...	ChIP-Seq
SRX331287	SRA096633	Snyder_MAB-5_GFP_L2_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_MAB-5_GFP_L2_Input_Rep2;_Caenorhabditis_...	MAB-5_GFP_L2_Input_Rep2	MAB-5_GFP_L2_Input_Rep2	OP27(official name : OP27 genotype : unc-119(ed3); wgIs27(mab-5::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The MAB-5::EGFP fusion protein is expressed in the correct mab-5 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the MAB-5 transcription factor. made_by : Bob Waterston's lab from UW )|MAB-5_GFP_L2_Input_Rep2|L2	OP27(official name : O...	ChIP-Seq
SRX331288	SRA096633	Snyder_MAB-5_GFP_L2_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_MAB-5_GFP_L2_ChIP_Rep2;_Caenorhabditis_e...	MAB-5_GFP_L2_ChIP_Rep2	MAB-5_GFP_L2_ChIP_Rep2	OP27(official name : OP27 genotype : unc-119(ed3); wgIs27(mab-5::TY1 EGFP FLAG; unc-119) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden using Tony Hyman's recombineering pipeline. The resulting plasmid was used for bombardment transformation of an unc-119(ed3) strain. The MAB-5::EGFP fusion protein is expressed in the correct mab-5 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the MAB-5 transcription factor. made_by : Bob Waterston's lab from UW )|MAB-5_GFP_L2_ChIP_Rep2|L2	OP27(official name : O...	ChIP-Seq
SRX331289	SRA096634	Snyder_ZTF-11_GFP_EMB_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_ZTF-11_GFP_EMB_Input_Rep1;_Caenorhabditi...	ZTF-11_GFP_EMB_Input_Rep1	ZTF-11_GFP_EMB_Input_Rep1	OP236(official name : OP236 genotype : unc-119(ed3) III; wgIs236(ekl-2::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ZTF-11::EGFP fusion protein is expressed in the correct ztf-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZTF-11 transcription factor. made_by : Unknown )|ZTF-11_GFP_EMB_Input_Rep1|embryo	OP236(official name : ...	ChIP-Seq
SRX331290	SRA096634	Snyder_ZTF-11_GFP_EMB_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_ZTF-11_GFP_EMB_ChIP_Rep1;_Caenorhabditis...	ZTF-11_GFP_EMB_ChIP_Rep1	ZTF-11_GFP_EMB_ChIP_Rep1	OP236(official name : OP236 genotype : unc-119(ed3) III; wgIs236(ekl-2::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ZTF-11::EGFP fusion protein is expressed in the correct ztf-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZTF-11 transcription factor. made_by : Unknown )|ZTF-11_GFP_EMB_ChIP_Rep1|embryo	OP236(official name : ...	ChIP-Seq
SRX331291	SRA096634	Snyder_ZTF-11_GFP_EMB_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_ZTF-11_GFP_EMB_Input_Rep2;_Caenorhabditi...	ZTF-11_GFP_EMB_Input_Rep2	ZTF-11_GFP_EMB_Input_Rep2	OP236(official name : OP236 genotype : unc-119(ed3) III; wgIs236(ekl-2::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ZTF-11::EGFP fusion protein is expressed in the correct ztf-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZTF-11 transcription factor. made_by : Unknown )|ZTF-11_GFP_EMB_Input_Rep2|embryo	OP236(official name : ...	ChIP-Seq
SRX331292	SRA096634	Snyder_ZTF-11_GFP_EMB_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_ZTF-11_GFP_EMB_ChIP_Rep2;_Caenorhabditis...	ZTF-11_GFP_EMB_ChIP_Rep2	ZTF-11_GFP_EMB_ChIP_Rep2	OP236(official name : OP236 genotype : unc-119(ed3) III; wgIs236(ekl-2::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ZTF-11::EGFP fusion protein is expressed in the correct ztf-11 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZTF-11 transcription factor. made_by : Unknown )|ZTF-11_GFP_EMB_ChIP_Rep2|embryo	OP236(official name : ...	ChIP-Seq
SRX331293	SRA096635	Snyder_ZIP-2_GFP_L4_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_ZIP-2_GFP_L4_Input_Rep1;_Caenorhabditis_...	ZIP-2_GFP_L4_Input_Rep1	ZIP-2_GFP_L4_Input_Rep1	OP432(official name : OP432 genotype : unc-119(ed3) III; wgIs432(zip-2::TY1-GFP-3xFLA; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ZIP-2::EGFP fusion protein is expressed in the correct zip-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZIP-2 transcription factor. made_by : Unknown )|ZIP-2_GFP_L4_Input_Rep1|L4	OP432(official name : ...	ChIP-Seq
SRX331294	SRA096635	Snyder_ZIP-2_GFP_L4_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_ZIP-2_GFP_L4_ChIP_Rep1;_Caenorhabditis_e...	ZIP-2_GFP_L4_ChIP_Rep1	ZIP-2_GFP_L4_ChIP_Rep1	OP432(official name : OP432 genotype : unc-119(ed3) III; wgIs432(zip-2::TY1-GFP-3xFLA; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ZIP-2::EGFP fusion protein is expressed in the correct zip-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZIP-2 transcription factor. made_by : Unknown )|ZIP-2_GFP_L4_ChIP_Rep1|L4	OP432(official name : ...	ChIP-Seq
SRX331295	SRA096635	Snyder_ZIP-2_GFP_L4_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_ZIP-2_GFP_L4_Input_Rep2;_Caenorhabditis_...	ZIP-2_GFP_L4_Input_Rep2	ZIP-2_GFP_L4_Input_Rep2	OP432(official name : OP432 genotype : unc-119(ed3) III; wgIs432(zip-2::TY1-GFP-3xFLA; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ZIP-2::EGFP fusion protein is expressed in the correct zip-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZIP-2 transcription factor. made_by : Unknown )|ZIP-2_GFP_L4_Input_Rep2|L4	OP432(official name : ...	ChIP-Seq
SRX331296	SRA096635	Snyder_ZIP-2_GFP_L4_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_ZIP-2_GFP_L4_ChIP_Rep2;_Caenorhabditis_e...	ZIP-2_GFP_L4_ChIP_Rep2	ZIP-2_GFP_L4_ChIP_Rep2	OP432(official name : OP432 genotype : unc-119(ed3) III; wgIs432(zip-2::TY1-GFP-3xFLA; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The ZIP-2::EGFP fusion protein is expressed in the correct zip-2 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the ZIP-2 transcription factor. made_by : Unknown )|ZIP-2_GFP_L4_ChIP_Rep2|L4	OP432(official name : ...	ChIP-Seq
SRX331297	SRA096636	Snyder_DVE-1_GFP_L4_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_DVE-1_GFP_L4_Input_Rep1;_Caenorhabditis_...	DVE-1_GFP_L4_Input_Rep1	DVE-1_GFP_L4_Input_Rep1	OP398(official name : OP398 genotype : unc-119(ed3) III; wgIs398(dve-1::TY1EGFPFLAG C; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The DVE-1::EGFP fusion protein is expressed in the correct dve-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the DVE-1 transcription factor. made_by : Unknown )|DVE-1_GFP_L4_Input_Rep1|L4	OP398(official name : ...	ChIP-Seq
SRX331298	SRA096636	Snyder_DVE-1_GFP_L4_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_DVE-1_GFP_L4_ChIP_Rep1;_Caenorhabditis_e...	DVE-1_GFP_L4_ChIP_Rep1	DVE-1_GFP_L4_ChIP_Rep1	OP398(official name : OP398 genotype : unc-119(ed3) III; wgIs398(dve-1::TY1EGFPFLAG C; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The DVE-1::EGFP fusion protein is expressed in the correct dve-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the DVE-1 transcription factor. made_by : Unknown )|DVE-1_GFP_L4_ChIP_Rep1|L4	OP398(official name : ...	ChIP-Seq
SRX331299	SRA096636	Snyder_DVE-1_GFP_L4_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_DVE-1_GFP_L4_Input_Rep2;_Caenorhabditis_...	DVE-1_GFP_L4_Input_Rep2	DVE-1_GFP_L4_Input_Rep2	OP398(official name : OP398 genotype : unc-119(ed3) III; wgIs398(dve-1::TY1EGFPFLAG C; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The DVE-1::EGFP fusion protein is expressed in the correct dve-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the DVE-1 transcription factor. made_by : Unknown )|DVE-1_GFP_L4_Input_Rep2|L4	OP398(official name : ...	ChIP-Seq
SRX331300	SRA096636	Snyder_DVE-1_GFP_L4_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_DVE-1_GFP_L4_ChIP_Rep2;_Caenorhabditis_e...	DVE-1_GFP_L4_ChIP_Rep2	DVE-1_GFP_L4_ChIP_Rep2	OP398(official name : OP398 genotype : unc-119(ed3) III; wgIs398(dve-1::TY1EGFPFLAG C; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The DVE-1::EGFP fusion protein is expressed in the correct dve-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the DVE-1 transcription factor. made_by : Unknown )|DVE-1_GFP_L4_ChIP_Rep2|L4	OP398(official name : ...	ChIP-Seq
SRX331301	SRA096637	Snyder_DVE-1_GFP_LateEMB_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_DVE-1_GFP_LateEMB_Input_Rep1;_Caenorhabd...	DVE-1_GFP_LateEMB_Input_Rep1	DVE-1_GFP_LateEMB_Inpu...	OP398(official name : OP398 genotype : unc-119(ed3) III; wgIs398(dve-1::TY1EGFPFLAG C; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The DVE-1::EGFP fusion protein is expressed in the correct dve-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the DVE-1 transcription factor. made_by : Unknown )|DVE-1_GFP_LateEMB_Input_Rep1|Late Embryo	OP398(official name : ...	ChIP-Seq
SRX331302	SRA096637	Snyder_DVE-1_GFP_LateEMB_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_DVE-1_GFP_LateEMB_ChIP_Rep1;_Caenorhabdi...	DVE-1_GFP_LateEMB_ChIP_Rep1	DVE-1_GFP_LateEMB_ChIP...	OP398(official name : OP398 genotype : unc-119(ed3) III; wgIs398(dve-1::TY1EGFPFLAG C; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The DVE-1::EGFP fusion protein is expressed in the correct dve-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the DVE-1 transcription factor. made_by : Unknown )|DVE-1_GFP_LateEMB_ChIP_Rep1|Late Embryo	OP398(official name : ...	ChIP-Seq
SRX331303	SRA096637	Snyder_DVE-1_GFP_LateEMB_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_DVE-1_GFP_LateEMB_Input_Rep2;_Caenorhabd...	DVE-1_GFP_LateEMB_Input_Rep2	DVE-1_GFP_LateEMB_Inpu...	OP398(official name : OP398 genotype : unc-119(ed3) III; wgIs398(dve-1::TY1EGFPFLAG C; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The DVE-1::EGFP fusion protein is expressed in the correct dve-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the DVE-1 transcription factor. made_by : Unknown )|DVE-1_GFP_LateEMB_Input_Rep2|Late Embryo	OP398(official name : ...	ChIP-Seq
SRX331304	SRA096637	Snyder_DVE-1_GFP_LateEMB_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_DVE-1_GFP_LateEMB_ChIP_Rep2;_Caenorhabdi...	DVE-1_GFP_LateEMB_ChIP_Rep2	DVE-1_GFP_LateEMB_ChIP...	OP398(official name : OP398 genotype : unc-119(ed3) III; wgIs398(dve-1::TY1EGFPFLAG C; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The DVE-1::EGFP fusion protein is expressed in the correct dve-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the DVE-1 transcription factor. made_by : Unknown )|DVE-1_GFP_LateEMB_ChIP_Rep2|Late Embryo	OP398(official name : ...	ChIP-Seq
SRX331305	SRA096638	Snyder_F23B12.7_GFP_YA_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_F23B12.7_GFP_YA_Input_Rep1;_Caenorhabdit...	F23B12.7_GFP_YA_Input_Rep1	F23B12.7_GFP_YA_Input_...	OP429(official name : OP429 genotype : unc-119(ed3) III; wgIs429(F23B12.7::TY1GFP-3xFLA; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The F23B12.7::EGFP fusion protein is expressed in the correct F23B12.7 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the F23B12.7 transcription factor. made_by : Unknown )|F23B12.7_GFP_YA_Input_Rep1|Young adult	OP429(official name : ...	ChIP-Seq
SRX331306	SRA096638	Snyder_F23B12.7_GFP_YA_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_F23B12.7_GFP_YA_ChIP_Rep1;_Caenorhabditi...	F23B12.7_GFP_YA_ChIP_Rep1	F23B12.7_GFP_YA_ChIP_Rep1	OP429(official name : OP429 genotype : unc-119(ed3) III; wgIs429(F23B12.7::TY1GFP-3xFLA; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The F23B12.7::EGFP fusion protein is expressed in the correct F23B12.7 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the F23B12.7 transcription factor. made_by : Unknown )|F23B12.7_GFP_YA_ChIP_Rep1|Young adult	OP429(official name : ...	ChIP-Seq
SRX331307	SRA096638	Snyder_F23B12.7_GFP_YA_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_F23B12.7_GFP_YA_Input_Rep2;_Caenorhabdit...	F23B12.7_GFP_YA_Input_Rep2	F23B12.7_GFP_YA_Input_...	OP429(official name : OP429 genotype : unc-119(ed3) III; wgIs429(F23B12.7::TY1GFP-3xFLA; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The F23B12.7::EGFP fusion protein is expressed in the correct F23B12.7 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the F23B12.7 transcription factor. made_by : Unknown )|F23B12.7_GFP_YA_Input_Rep2|Young adult	OP429(official name : ...	ChIP-Seq
SRX331308	SRA096638	Snyder_F23B12.7_GFP_YA_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_F23B12.7_GFP_YA_ChIP_Rep2;_Caenorhabditi...	F23B12.7_GFP_YA_ChIP_Rep2	F23B12.7_GFP_YA_ChIP_Rep2	OP429(official name : OP429 genotype : unc-119(ed3) III; wgIs429(F23B12.7::TY1GFP-3xFLA; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The F23B12.7::EGFP fusion protein is expressed in the correct F23B12.7 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the F23B12.7 transcription factor. made_by : Unknown )|F23B12.7_GFP_YA_ChIP_Rep2|Young adult	OP429(official name : ...	ChIP-Seq
SRX331309	SRA096639	Snyder_HLH-30_GFP_L4_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_HLH-30_GFP_L4_Input_Rep1;_Caenorhabditis...	HLH-30_GFP_L4_Input_Rep1	HLH-30_GFP_L4_Input_Rep1	OP433(official name : OP433 genotype : unc-119(ed3) III; wgIs433(hlh-30::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The HLH-30::EGFP fusion protein is expressed in the correct hlh-30 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the HLH-30 transcription factor. made_by : Unknown )|HLH-30_GFP_L4_Input_Rep1|L4	OP433(official name : ...	ChIP-Seq
SRX331310	SRA096639	Snyder_HLH-30_GFP_L4_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_HLH-30_GFP_L4_ChIP_Rep1;_Caenorhabditis_...	HLH-30_GFP_L4_ChIP_Rep1	HLH-30_GFP_L4_ChIP_Rep1	OP433(official name : OP433 genotype : unc-119(ed3) III; wgIs433(hlh-30::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The HLH-30::EGFP fusion protein is expressed in the correct hlh-30 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the HLH-30 transcription factor. made_by : Unknown )|HLH-30_GFP_L4_ChIP_Rep1|L4	OP433(official name : ...	ChIP-Seq
SRX331311	SRA096639	Snyder_HLH-30_GFP_L4_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_HLH-30_GFP_L4_Input_Rep2;_Caenorhabditis...	HLH-30_GFP_L4_Input_Rep2	HLH-30_GFP_L4_Input_Rep2	OP433(official name : OP433 genotype : unc-119(ed3) III; wgIs433(hlh-30::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The HLH-30::EGFP fusion protein is expressed in the correct hlh-30 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the HLH-30 transcription factor. made_by : Unknown )|HLH-30_GFP_L4_Input_Rep2|L4	OP433(official name : ...	ChIP-Seq
SRX331312	SRA096639	Snyder_HLH-30_GFP_L4_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_HLH-30_GFP_L4_ChIP_Rep2;_Caenorhabditis_...	HLH-30_GFP_L4_ChIP_Rep2	HLH-30_GFP_L4_ChIP_Rep2	OP433(official name : OP433 genotype : unc-119(ed3) III; wgIs433(hlh-30::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The HLH-30::EGFP fusion protein is expressed in the correct hlh-30 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the HLH-30 transcription factor. made_by : Unknown )|HLH-30_GFP_L4_ChIP_Rep2|L4	OP433(official name : ...	ChIP-Seq
SRX331313	SRA096640	Snyder_HLH-30_GFP_LateEMB_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_HLH-30_GFP_LateEMB_Input_Rep1;_Caenorhab...	HLH-30_GFP_LateEMB_Input_Rep1	HLH-30_GFP_LateEMB_Inp...	OP433(official name : OP433 genotype : unc-119(ed3) III; wgIs433(hlh-30::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The HLH-30::EGFP fusion protein is expressed in the correct hlh-30 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the HLH-30 transcription factor. made_by : Unknown )|HLH-30_GFP_LateEMB_Input_Rep1|Late Embryo	OP433(official name : ...	ChIP-Seq
SRX331314	SRA096640	Snyder_HLH-30_GFP_LateEMB_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_HLH-30_GFP_LateEMB_ChIP_Rep1;_Caenorhabd...	HLH-30_GFP_LateEMB_ChIP_Rep1	HLH-30_GFP_LateEMB_ChI...	OP433(official name : OP433 genotype : unc-119(ed3) III; wgIs433(hlh-30::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The HLH-30::EGFP fusion protein is expressed in the correct hlh-30 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the HLH-30 transcription factor. made_by : Unknown )|HLH-30_GFP_LateEMB_ChIP_Rep1|Late Embryo	OP433(official name : ...	ChIP-Seq
SRX331315	SRA096640	Snyder_HLH-30_GFP_LateEMB_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_HLH-30_GFP_LateEMB_Input_Rep2;_Caenorhab...	HLH-30_GFP_LateEMB_Input_Rep2	HLH-30_GFP_LateEMB_Inp...	OP433(official name : OP433 genotype : unc-119(ed3) III; wgIs433(hlh-30::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The HLH-30::EGFP fusion protein is expressed in the correct hlh-30 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the HLH-30 transcription factor. made_by : Unknown )|HLH-30_GFP_LateEMB_Input_Rep2|Late Embryo	OP433(official name : ...	ChIP-Seq
SRX331316	SRA096640	Snyder_HLH-30_GFP_LateEMB_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_HLH-30_GFP_LateEMB_ChIP_Rep2;_Caenorhabd...	HLH-30_GFP_LateEMB_ChIP_Rep2	HLH-30_GFP_LateEMB_ChI...	OP433(official name : OP433 genotype : unc-119(ed3) III; wgIs433(hlh-30::TY1 EGFP FLAG; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The HLH-30::EGFP fusion protein is expressed in the correct hlh-30 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the HLH-30 transcription factor. made_by : Unknown )|HLH-30_GFP_LateEMB_ChIP_Rep2|Late Embryo	OP433(official name : ...	ChIP-Seq
SRX331317	SRA096641	Snyder_MED-1_GFP_MIDEMB_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_MED-1_GFP_MIDEMB_Input_Rep1;_Caenorhabdi...	MED-1_GFP_MIDEMB_Input_Rep1	MED-1_GFP_MIDEMB_Input...	OP391(official name : OP391 genotype : unc-119(ed3) III; wgIs391(med-1::TY1 EGFP FLAG C; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The MED-1::EGFP fusion protein is expressed in the correct med-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the MED-1 transcription factor. made_by : Unknown )|MED-1_GFP_MIDEMB_Input_Rep1|embryo	OP391(official name : ...	ChIP-Seq
SRX331318	SRA096641	Snyder_MED-1_GFP_MIDEMB_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_MED-1_GFP_MIDEMB_ChIP_Rep1;_Caenorhabdit...	MED-1_GFP_MIDEMB_ChIP_Rep1	MED-1_GFP_MIDEMB_ChIP_...	OP391(official name : OP391 genotype : unc-119(ed3) III; wgIs391(med-1::TY1 EGFP FLAG C; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The MED-1::EGFP fusion protein is expressed in the correct med-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the MED-1 transcription factor. made_by : Unknown )|MED-1_GFP_MIDEMB_ChIP_Rep1|embryo	OP391(official name : ...	ChIP-Seq
SRX331319	SRA096641	Snyder_MED-1_GFP_MIDEMB_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_MED-1_GFP_MIDEMB_Input_Rep2;_Caenorhabdi...	MED-1_GFP_MIDEMB_Input_Rep2	MED-1_GFP_MIDEMB_Input...	OP391(official name : OP391 genotype : unc-119(ed3) III; wgIs391(med-1::TY1 EGFP FLAG C; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The MED-1::EGFP fusion protein is expressed in the correct med-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the MED-1 transcription factor. made_by : Unknown )|MED-1_GFP_MIDEMB_Input_Rep2|embryo	OP391(official name : ...	ChIP-Seq
SRX331320	SRA096641	Snyder_MED-1_GFP_MIDEMB_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_MED-1_GFP_MIDEMB_ChIP_Rep2;_Caenorhabdit...	MED-1_GFP_MIDEMB_ChIP_Rep2	MED-1_GFP_MIDEMB_ChIP_...	OP391(official name : OP391 genotype : unc-119(ed3) III; wgIs391(med-1::TY1 EGFP FLAG C; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The MED-1::EGFP fusion protein is expressed in the correct med-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the MED-1 transcription factor. made_by : Unknown )|MED-1_GFP_MIDEMB_ChIP_Rep2|embryo	OP391(official name : ...	ChIP-Seq
SRX331321	SRA096642	Snyder_NFYA-1_GFP_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NFYA-1_GFP_L3_Input_Rep1;_Caenorhabditis...	NFYA-1_GFP_L3_Input_Rep1	NFYA-1_GFP_L3_Input_Rep1	OP404(official name : OP404 genotype : unc-119(ed3) III; wgIs404(nfya-1::TY1-GFP-3xFLA; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NFYA-1::EGFP fusion protein is expressed in the correct nfya-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NFYA-1 transcription factor. made_by : Unknown )|NFYA-1_GFP_L3_Input_Rep1|L3	OP404(official name : ...	ChIP-Seq
SRX331322	SRA096642	Snyder_NFYA-1_GFP_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NFYA-1_GFP_L3_ChIP_Rep1;_Caenorhabditis_...	NFYA-1_GFP_L3_ChIP_Rep1	NFYA-1_GFP_L3_ChIP_Rep1	OP404(official name : OP404 genotype : unc-119(ed3) III; wgIs404(nfya-1::TY1-GFP-3xFLA; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NFYA-1::EGFP fusion protein is expressed in the correct nfya-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NFYA-1 transcription factor. made_by : Unknown )|NFYA-1_GFP_L3_ChIP_Rep1|L3	OP404(official name : ...	ChIP-Seq
SRX331323	SRA096642	Snyder_NFYA-1_GFP_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NFYA-1_GFP_L3_Input_Rep2;_Caenorhabditis...	NFYA-1_GFP_L3_Input_Rep2	NFYA-1_GFP_L3_Input_Rep2	OP404(official name : OP404 genotype : unc-119(ed3) III; wgIs404(nfya-1::TY1-GFP-3xFLA; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NFYA-1::EGFP fusion protein is expressed in the correct nfya-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NFYA-1 transcription factor. made_by : Unknown )|NFYA-1_GFP_L3_Input_Rep2|L3	OP404(official name : ...	ChIP-Seq
SRX331324	SRA096642	Snyder_NFYA-1_GFP_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NFYA-1_GFP_L3_ChIP_Rep2;_Caenorhabditis_...	NFYA-1_GFP_L3_ChIP_Rep2	NFYA-1_GFP_L3_ChIP_Rep2	OP404(official name : OP404 genotype : unc-119(ed3) III; wgIs404(nfya-1::TY1-GFP-3xFLA; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NFYA-1::EGFP fusion protein is expressed in the correct nfya-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NFYA-1 transcription factor. made_by : Unknown )|NFYA-1_GFP_L3_ChIP_Rep2|L3	OP404(official name : ...	ChIP-Seq
SRX331325	SRA096643	Snyder_NFYA-1_GFP_LateEMB_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NFYA-1_GFP_LateEMB_Input_Rep1;_Caenorhab...	NFYA-1_GFP_LateEMB_Input_Rep1	NFYA-1_GFP_LateEMB_Inp...	OP404(official name : OP404 genotype : unc-119(ed3) III; wgIs404(nfya-1::TY1-GFP-3xFLA; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NFYA-1::EGFP fusion protein is expressed in the correct nfya-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NFYA-1 transcription factor. made_by : Unknown )|NFYA-1_GFP_LateEMB_Input_Rep1|Late Embryo	OP404(official name : ...	ChIP-Seq
SRX331326	SRA096643	Snyder_NFYA-1_GFP_LateEMB_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NFYA-1_GFP_LateEMB_ChIP_Rep1;_Caenorhabd...	NFYA-1_GFP_LateEMB_ChIP_Rep1	NFYA-1_GFP_LateEMB_ChI...	OP404(official name : OP404 genotype : unc-119(ed3) III; wgIs404(nfya-1::TY1-GFP-3xFLA; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NFYA-1::EGFP fusion protein is expressed in the correct nfya-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NFYA-1 transcription factor. made_by : Unknown )|NFYA-1_GFP_LateEMB_ChIP_Rep1|Late Embryo	OP404(official name : ...	ChIP-Seq
SRX331327	SRA096643	Snyder_NFYA-1_GFP_LateEMB_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NFYA-1_GFP_LateEMB_Input_Rep2;_Caenorhab...	NFYA-1_GFP_LateEMB_Input_Rep2	NFYA-1_GFP_LateEMB_Inp...	OP404(official name : OP404 genotype : unc-119(ed3) III; wgIs404(nfya-1::TY1-GFP-3xFLA; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NFYA-1::EGFP fusion protein is expressed in the correct nfya-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NFYA-1 transcription factor. made_by : Unknown )|NFYA-1_GFP_LateEMB_Input_Rep2|Late Embryo	OP404(official name : ...	ChIP-Seq
SRX331328	SRA096643	Snyder_NFYA-1_GFP_LateEMB_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NFYA-1_GFP_LateEMB_ChIP_Rep2;_Caenorhabd...	NFYA-1_GFP_LateEMB_ChIP_Rep2	NFYA-1_GFP_LateEMB_ChI...	OP404(official name : OP404 genotype : unc-119(ed3) III; wgIs404(nfya-1::TY1-GFP-3xFLA; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NFYA-1::EGFP fusion protein is expressed in the correct nfya-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NFYA-1 transcription factor. made_by : Unknown )|NFYA-1_GFP_LateEMB_ChIP_Rep2|Late Embryo	OP404(official name : ...	ChIP-Seq
SRX331329	SRA096644	Snyder_NFYA-1_GFP_YA_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NFYA-1_GFP_YA_Input_Rep1;_Caenorhabditis...	NFYA-1_GFP_YA_Input_Rep1	NFYA-1_GFP_YA_Input_Rep1	OP404(official name : OP404 genotype : unc-119(ed3) III; wgIs404(nfya-1::TY1-GFP-3xFLA; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NFYA-1::EGFP fusion protein is expressed in the correct nfya-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NFYA-1 transcription factor. made_by : Unknown )|NFYA-1_GFP_YA_Input_Rep1|Young adult	OP404(official name : ...	ChIP-Seq
SRX331330	SRA096644	Snyder_NFYA-1_GFP_YA_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NFYA-1_GFP_YA_ChIP_Rep1;_Caenorhabditis_...	NFYA-1_GFP_YA_ChIP_Rep1	NFYA-1_GFP_YA_ChIP_Rep1	OP404(official name : OP404 genotype : unc-119(ed3) III; wgIs404(nfya-1::TY1-GFP-3xFLA; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NFYA-1::EGFP fusion protein is expressed in the correct nfya-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NFYA-1 transcription factor. made_by : Unknown )|NFYA-1_GFP_YA_ChIP_Rep1|Young adult	OP404(official name : ...	ChIP-Seq
SRX331331	SRA096644	Snyder_NFYA-1_GFP_YA_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NFYA-1_GFP_YA_Input_Rep2;_Caenorhabditis...	NFYA-1_GFP_YA_Input_Rep2	NFYA-1_GFP_YA_Input_Rep2	OP404(official name : OP404 genotype : unc-119(ed3) III; wgIs404(nfya-1::TY1-GFP-3xFLA; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NFYA-1::EGFP fusion protein is expressed in the correct nfya-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NFYA-1 transcription factor. made_by : Unknown )|NFYA-1_GFP_YA_Input_Rep2|Young adult	OP404(official name : ...	ChIP-Seq
SRX331332	SRA096644	Snyder_NFYA-1_GFP_YA_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_NFYA-1_GFP_YA_ChIP_Rep2;_Caenorhabditis_...	NFYA-1_GFP_YA_ChIP_Rep2	NFYA-1_GFP_YA_ChIP_Rep2	OP404(official name : OP404 genotype : unc-119(ed3) III; wgIs404(nfya-1::TY1-GFP-3xFLA; unc-119(+)) outcross : 3 mutagen : Bombard tags : GFP::3xFlag description : This strain's transgene was constructed by Mihail Sarov at the Max Planck Institute for Cell Biology and Genetics in Dresden description : using Tony Hyman's recombineering pipeline. The resulting plasmid was used for biolistic transformation of an unc-119(ed3) strain. The NFYA-1::EGFP fusion protein is expressed in the correct nfya-1 spatio-temporal expression pattern. This strain was used for ChIP-seq experiments to map the in vivo binding sites for the NFYA-1 transcription factor. made_by : Unknown )|NFYA-1_GFP_YA_ChIP_Rep2|Young adult	OP404(official name : ...	ChIP-Seq
SRX331333	SRA096645	seq-HK00009_H3K9me3_2F3_N2_Eemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00009_H3K9me3_2F3_N2_Eemb_Input_Rep1;_Cae...	seq-HK00009_H3K9me3_2F3_N2_Eemb_Input_Rep1	seq-HK00009_H3K9me3_2F...	N2|seq-HK00009_H3K9me3_2F3_N2_Eemb_Input_Rep1|Early Embryo	N2	ChIP-Seq
SRX331334	SRA096645	seq-HK00009_H3K9me3_2F3_N2_Eemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00009_H3K9me3_2F3_N2_Eemb_Input_Rep2;_Cae...	seq-HK00009_H3K9me3_2F3_N2_Eemb_Input_Rep2	seq-HK00009_H3K9me3_2F...	N2|seq-HK00009_H3K9me3_2F3_N2_Eemb_Input_Rep2|Early Embryo	N2	ChIP-Seq
SRX331335	SRA096645	seq-HK00009_H3K9me3_2F3_N2_Eemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00009_H3K9me3_2F3_N2_Eemb_ChIP_Rep1;_Caen...	seq-HK00009_H3K9me3_2F3_N2_Eemb_ChIP_Rep1	seq-HK00009_H3K9me3_2F...	N2|seq-HK00009_H3K9me3_2F3_N2_Eemb_ChIP_Rep1|Early Embryo	N2	ChIP-Seq
SRX331336	SRA096645	seq-HK00009_H3K9me3_2F3_N2_Eemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00009_H3K9me3_2F3_N2_Eemb_ChIP_Rep2;_Caen...	seq-HK00009_H3K9me3_2F3_N2_Eemb_ChIP_Rep2	seq-HK00009_H3K9me3_2F...	N2|seq-HK00009_H3K9me3_2F3_N2_Eemb_ChIP_Rep2|Early Embryo	N2	ChIP-Seq
SRX331337	SRA096646	seq-Ab2621_H3K79me3_FEM2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-Ab2621_H3K79me3_FEM2_AD_Input_Rep1;_Caenorh...	seq-Ab2621_H3K79me3_FEM2_AD_Input_Rep1	seq-Ab2621_H3K79me3_FE...	fem-2(b245)|seq-Ab2621_H3K79me3_FEM2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX331338	SRA096646	seq-Ab2621_H3K79me3_FEM2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-Ab2621_H3K79me3_FEM2_AD_Input_Rep2;_Caenorh...	seq-Ab2621_H3K79me3_FEM2_AD_Input_Rep2	seq-Ab2621_H3K79me3_FE...	fem-2(b245)|seq-Ab2621_H3K79me3_FEM2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX331340	SRA096646	seq-Ab2621_H3K79me3_FEM2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-Ab2621_H3K79me3_FEM2_AD_ChIP_Rep2;_Caenorha...	seq-Ab2621_H3K79me3_FEM2_AD_ChIP_Rep2	seq-Ab2621_H3K79me3_FE...	fem-2(b245)|seq-Ab2621_H3K79me3_FEM2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX331341	SRA096647	seq-SDQ3520_LIN61_N2_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3520_LIN61_N2_L3_Input_Rep1;_Caenorhabdi...	seq-SDQ3520_LIN61_N2_L3_Input_Rep1	seq-SDQ3520_LIN61_N2_L...	N2|seq-SDQ3520_LIN61_N2_L3_Input_Rep1|L3 Larva	N2	ChIP-Seq
SRX331342	SRA096647	seq-SDQ3520_LIN61_N2_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3520_LIN61_N2_L3_Input_Rep2;_Caenorhabdi...	seq-SDQ3520_LIN61_N2_L3_Input_Rep2	seq-SDQ3520_LIN61_N2_L...	N2|seq-SDQ3520_LIN61_N2_L3_Input_Rep2|L3 Larva	N2	ChIP-Seq
SRX331343	SRA096647	seq-SDQ3520_LIN61_N2_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3520_LIN61_N2_L3_ChIP_Rep1;_Caenorhabdit...	seq-SDQ3520_LIN61_N2_L3_ChIP_Rep1	seq-SDQ3520_LIN61_N2_L...	N2|seq-SDQ3520_LIN61_N2_L3_ChIP_Rep1|L3 Larva	N2	ChIP-Seq
SRX331344	SRA096647	seq-SDQ3520_LIN61_N2_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3520_LIN61_N2_L3_ChIP_Rep2;_Caenorhabdit...	seq-SDQ3520_LIN61_N2_L3_ChIP_Rep2	seq-SDQ3520_LIN61_N2_L...	N2|seq-SDQ3520_LIN61_N2_L3_ChIP_Rep2|L3 Larva	N2	ChIP-Seq
SRX331345	SRA096648	seq-ab12181_H3K9acS10_873968_N2_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab12181_H3K9acS10_873968_N2_L3_Input_Rep1;_...	seq-ab12181_H3K9acS10_873968_N2_L3_Input_Rep1	seq-ab12181_H3K9acS10_...	N2|seq-ab12181_H3K9acS10_873968_N2_L3_Input_Rep1|L3 Larva	N2	ChIP-Seq
SRX331346	SRA096648	seq-ab12181_H3K9acS10_873968_N2_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab12181_H3K9acS10_873968_N2_L3_Input_Rep2;_...	seq-ab12181_H3K9acS10_873968_N2_L3_Input_Rep2	seq-ab12181_H3K9acS10_...	N2|seq-ab12181_H3K9acS10_873968_N2_L3_Input_Rep2|L3 Larva	N2	ChIP-Seq
SRX331347	SRA096648	seq-ab12181_H3K9acS10_873968_N2_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab12181_H3K9acS10_873968_N2_L3_ChIP_Rep1;_C...	seq-ab12181_H3K9acS10_873968_N2_L3_ChIP_Rep1	seq-ab12181_H3K9acS10_...	N2|seq-ab12181_H3K9acS10_873968_N2_L3_ChIP_Rep1|L3 Larva	N2	ChIP-Seq
SRX331348	SRA096648	seq-ab12181_H3K9acS10_873968_N2_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab12181_H3K9acS10_873968_N2_L3_ChIP_Rep2;_C...	seq-ab12181_H3K9acS10_873968_N2_L3_ChIP_Rep2	seq-ab12181_H3K9acS10_...	N2|seq-ab12181_H3K9acS10_873968_N2_L3_ChIP_Rep2|L3 Larva	N2	ChIP-Seq
SRX331349	SRA096649	seq-HK72A9_H4K8ac_FEM2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK72A9_H4K8ac_FEM2_AD_Input_Rep1;_Caenorhab...	seq-HK72A9_H4K8ac_FEM2_AD_Input_Rep1	seq-HK72A9_H4K8ac_FEM2...	fem-2(b245)|seq-HK72A9_H4K8ac_FEM2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX331350	SRA096649	seq-HK72A9_H4K8ac_FEM2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK72A9_H4K8ac_FEM2_AD_Input_Rep2;_Caenorhab...	seq-HK72A9_H4K8ac_FEM2_AD_Input_Rep2	seq-HK72A9_H4K8ac_FEM2...	fem-2(b245)|seq-HK72A9_H4K8ac_FEM2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX331351	SRA096649	seq-HK72A9_H4K8ac_FEM2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK72A9_H4K8ac_FEM2_AD_ChIP_Rep1;_Caenorhabd...	seq-HK72A9_H4K8ac_FEM2_AD_ChIP_Rep1	seq-HK72A9_H4K8ac_FEM2...	fem-2(b245)|seq-HK72A9_H4K8ac_FEM2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX331352	SRA096649	seq-HK72A9_H4K8ac_FEM2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK72A9_H4K8ac_FEM2_AD_ChIP_Rep2;_Caenorhabd...	seq-HK72A9_H4K8ac_FEM2_AD_ChIP_Rep2	seq-HK72A9_H4K8ac_FEM2...	fem-2(b245)|seq-HK72A9_H4K8ac_FEM2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX331353	SRA096650	seq-SDQ2966_MIS12_N2_Mxemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2966_MIS12_N2_Mxemb_Input_Rep1;_Caenorha...	seq-SDQ2966_MIS12_N2_Mxemb_Input_Rep1	seq-SDQ2966_MIS12_N2_M...	N2|seq-SDQ2966_MIS12_N2_Mxemb_Input_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX331354	SRA096650	seq-SDQ2966_MIS12_N2_Mxemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2966_MIS12_N2_Mxemb_Input_Rep2;_Caenorha...	seq-SDQ2966_MIS12_N2_Mxemb_Input_Rep2	seq-SDQ2966_MIS12_N2_M...	N2|seq-SDQ2966_MIS12_N2_Mxemb_Input_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX331355	SRA096650	seq-SDQ2966_MIS12_N2_Mxemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2966_MIS12_N2_Mxemb_ChIP_Rep1;_Caenorhab...	seq-SDQ2966_MIS12_N2_Mxemb_ChIP_Rep1	seq-SDQ2966_MIS12_N2_M...	N2|seq-SDQ2966_MIS12_N2_Mxemb_ChIP_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX331356	SRA096650	seq-SDQ2966_MIS12_N2_Mxemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2966_MIS12_N2_Mxemb_ChIP_Rep2;_Caenorhab...	seq-SDQ2966_MIS12_N2_Mxemb_ChIP_Rep2	seq-SDQ2966_MIS12_N2_M...	N2|seq-SDQ2966_MIS12_N2_Mxemb_ChIP_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX331357	SRA096651	seq-AB46540_NIgG_N2_Mxemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-AB46540_NIgG_N2_Mxemb_Input_Rep1;_Caenorhab...	seq-AB46540_NIgG_N2_Mxemb_Input_Rep1	seq-AB46540_NIgG_N2_Mx...	N2|seq-AB46540_NIgG_N2_Mxemb_Input_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX331358	SRA096651	seq-AB46540_NIgG_N2_Mxemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-AB46540_NIgG_N2_Mxemb_Input_Rep2;_Caenorhab...	seq-AB46540_NIgG_N2_Mxemb_Input_Rep2	seq-AB46540_NIgG_N2_Mx...	N2|seq-AB46540_NIgG_N2_Mxemb_Input_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX331359	SRA096651	seq-AB46540_NIgG_N2_Mxemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-AB46540_NIgG_N2_Mxemb_ChIP_Rep1;_Caenorhabd...	seq-AB46540_NIgG_N2_Mxemb_ChIP_Rep1	seq-AB46540_NIgG_N2_Mx...	N2|seq-AB46540_NIgG_N2_Mxemb_ChIP_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX331360	SRA096651	seq-AB46540_NIgG_N2_Mxemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-AB46540_NIgG_N2_Mxemb_ChIP_Rep2;_Caenorhabd...	seq-AB46540_NIgG_N2_Mxemb_ChIP_Rep2	seq-AB46540_NIgG_N2_Mx...	N2|seq-AB46540_NIgG_N2_Mxemb_ChIP_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX331361	SRA096652	seq-ab9051_H4K20me1_N2_Mxemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab9051_H4K20me1_N2_Mxemb_Input_Rep1;_Caenor...	seq-ab9051_H4K20me1_N2_Mxemb_Input_Rep1	seq-ab9051_H4K20me1_N2...	N2|seq-ab9051_H4K20me1_N2_Mxemb_Input_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX331362	SRA096652	seq-ab9051_H4K20me1_N2_Mxemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab9051_H4K20me1_N2_Mxemb_Input_Rep2;_Caenor...	seq-ab9051_H4K20me1_N2_Mxemb_Input_Rep2	seq-ab9051_H4K20me1_N2...	N2|seq-ab9051_H4K20me1_N2_Mxemb_Input_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX331363	SRA096652	seq-ab9051_H4K20me1_N2_Mxemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab9051_H4K20me1_N2_Mxemb_ChIP_Rep1;_Caenorh...	seq-ab9051_H4K20me1_N2_Mxemb_ChIP_Rep1	seq-ab9051_H4K20me1_N2...	N2|seq-ab9051_H4K20me1_N2_Mxemb_ChIP_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX331364	SRA096652	seq-ab9051_H4K20me1_N2_Mxemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab9051_H4K20me1_N2_Mxemb_ChIP_Rep2;_Caenorh...	seq-ab9051_H4K20me1_N2_Mxemb_ChIP_Rep2	seq-ab9051_H4K20me1_N2...	N2|seq-ab9051_H4K20me1_N2_Mxemb_ChIP_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX335101	SRA097910	CFP-1::GFP_RC03__ChIP_seq;_Caenorhabditis_elegans;_ChIP-Seq	CFP-1::GFP_RC03__ChIP_seq;_Caenorhabditis_elega...	anti-GFP|late embryos_CFP-1::GFP ChIP seq	anti-GFP	JA1597|late embryos_CFP-1::GFP ChIP seq|whole embryo|Late embryo	JA1597	ChIP-Seq
SRX335102	SRA097910	CFP-1::GFP_RC04_ChIP_seq;_Caenorhabditis_elegans;_ChIP-Seq	CFP-1::GFP_RC04_ChIP_seq;_Caenorhabditis_elegan...	anti-GFP|late embryos_CFP-1::GFP ChIP seq	anti-GFP	JA1597|late embryos_CFP-1::GFP ChIP seq|whole embryo|Late embryo	JA1597	ChIP-Seq
SRX335103	SRA097910	H3K4me3_RC03_ChIP_seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_RC03_ChIP_seq;_Caenorhabditis_elegans;_...	anti-H3K4me3|late embryos_H3K4me3 ChIP seq	anti-H3K4me3	JA1597|late embryos_H3K4me3 ChIP seq|whole embryo|Late embryo	JA1597	ChIP-Seq
SRX335104	SRA097910	H3K4me3_RC04_ChIP_seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_RC04_ChIP_seq;_Caenorhabditis_elegans;_...	anti-H3K4me3|late embryos_H3K4me3 ChIP seq	anti-H3K4me3	JA1597|late embryos_H3K4me3 ChIP seq|whole embryo|Late embryo	JA1597	ChIP-Seq
SRX3411419	SRA632561	OEF-1_ChIP_in_staged_YA_rep_1;_Caenorhabditis_elegans;_ChIP-Seq	OEF-1_ChIP_in_staged_YA_rep_1;_Caenorhabditis_e...	GFP|staged young adult (YA) from OP383 (OEF-1:GFP transgenic strain)	GFP	OP383|staged young adult (YA) from OP383 (OEF-1:GFP transgenic strain)|whole animal|YA	OP383	ChIP-Seq
SRX3411420	SRA632561	OEF-1_ChIP_in_staged_YA_rep_2;_Caenorhabditis_elegans;_ChIP-Seq	OEF-1_ChIP_in_staged_YA_rep_2;_Caenorhabditis_e...	GFP|staged young adult (YA) from OP383 (OEF-1:GFP transgenic strain)	GFP	OP383|staged young adult (YA) from OP383 (OEF-1:GFP transgenic strain)|whole animal|YA	OP383	ChIP-Seq
SRX3411421	SRA632561	Input_DNA_control_in_staged_YA_#2;_Caenorhabditis_elegans;_ChIP-Seq	Input_DNA_control_in_staged_YA_#2;_Caenorhabdit...	staged young adult (YA) from OP383 (OEF-1:GFP transgenic strain)	staged young adult (YA...	OP383|staged young adult (YA) from OP383 (OEF-1:GFP transgenic strain)|whole animal|YA	OP383	ChIP-Seq
SRX341784	SRA099512	BC175_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	BC175_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	SDQ2357_AMA1 Novus Biologicals, catalog# 38520002, lot# G3048-029, Animal SDQ2357|Mixed-stage embryos	SDQ2357_AMA1 Novus Bio...	N2|Mixed-stage embryos	N2	ChIP-Seq
SRX341785	SRA099512	BC215_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	BC215_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	SDQ2358_AMA1 Novus Biologicals, catalog# 38520002, lot# G3048-029, Animal SDQ2358|Mixed-stage embryos	SDQ2358_AMA1 Novus Bio...	N2|Mixed-stage embryos	N2	ChIP-Seq
SRX341786	SRA099512	BC176_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	BC176_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	SDQ2357_AMA1 Novus Biologicals, catalog# 38520002, lot# G3048-029, Animal SDQ2357|Mixed-stage embryos	SDQ2357_AMA1 Novus Bio...	N2|Mixed-stage embryos	N2	ChIP-Seq
SRX341787	SRA099512	BC216_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	BC216_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	SDQ2358_AMA1 Novus Biologicals, catalog# 38520002, lot# G3048-029, Animal SDQ2358|Mixed-stage embryos	SDQ2358_AMA1 Novus Bio...	N2|Mixed-stage embryos	N2	ChIP-Seq
SRX341788	SRA099512	BC181_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	BC181_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	Wako_H3K4me3_305-34819 Wako, catalog# 305-34819, lot# 8002|Mixed-stage embryos	Wako_H3K4me3_305-34819...	N2|Mixed-stage embryos	N2	ChIP-Seq
SRX341789	SRA099512	BC182_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	BC182_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	Wako_H3K4me3_305-34819 Wako, catalog# 305-34819, lot# 8002|Mixed-stage embryos	Wako_H3K4me3_305-34819...	N2|Mixed-stage embryos	N2	ChIP-Seq
SRX3583334	SRA649872	wt_rep1_H3K4me3ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	wt_rep1_H3K4me3ChIPseq;_Caenorhabditis_elegans;...	H3K4me3 (Millipore, Billerica, MA 17-614, lot:2756917)|N2_whole_worm	H3K4me3 (Millipore, Bi...	N2_whole_worm|L4	N2_whole_worm	ChIP-Seq
SRX3583335	SRA649872	wt_rep2_H3K4me3ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	wt_rep2_H3K4me3ChIPseq;_Caenorhabditis_elegans;...	H3K4me3 (Millipore, Billerica, MA 17-614, lot:2756917)|N2_whole_worm	H3K4me3 (Millipore, Bi...	N2_whole_worm|L4	N2_whole_worm	ChIP-Seq
SRX3583336	SRA649872	F1set9set26_rep1_H3K4me3ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	F1set9set26_rep1_H3K4me3ChIPseq;_Caenorhabditis...	H3K4me3 (Millipore, Billerica, MA 17-614, lot:2756917)|F1set9set26_whole_worm	H3K4me3 (Millipore, Bi...	F1set9set26_whole_worm|L4	F1set9set26_whole_worm	ChIP-Seq
SRX3583337	SRA649872	F1set9set26_rep2_H3K4me3ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	F1set9set26_rep2_H3K4me3ChIPseq;_Caenorhabditis...	H3K4me3 (Millipore, Billerica, MA 17-614, lot:2756917)|F1set9set26_whole_worm	H3K4me3 (Millipore, Bi...	F1set9set26_whole_worm|L4	F1set9set26_whole_worm	ChIP-Seq
SRX3583338	SRA649872	F3set9set26_rep1_H3K4me3ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	F3set9set26_rep1_H3K4me3ChIPseq;_Caenorhabditis...	H3K4me3 (Millipore, Billerica, MA 17-614, lot:2756917)|F3set9set26_whole_worm	H3K4me3 (Millipore, Bi...	F3set9set26_whole_worm|L4	F3set9set26_whole_worm	ChIP-Seq
SRX3583339	SRA649872	F3set9set26_rep2_H3K4me3ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	F3set9set26_rep2_H3K4me3ChIPseq;_Caenorhabditis...	H3K4me3 (Millipore, Billerica, MA 17-614, lot:2756917)|F3set9set26_whole_worm	H3K4me3 (Millipore, Bi...	F3set9set26_whole_worm|L4	F3set9set26_whole_worm	ChIP-Seq
SRX3583340	SRA649872	glp-1_rep1_H3K4me3ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	glp-1_rep1_H3K4me3ChIPseq;_Caenorhabditis_elega...	H3K4me3 (Millipore, Billerica, MA 17-614, lot:2756917)|glp-1_whole_worm	H3K4me3 (Millipore, Bi...	glp-1_whole_worm|L4	glp-1_whole_worm	ChIP-Seq
SRX3583341	SRA649872	glp-1_rep2_H3K4me3ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	glp-1_rep2_H3K4me3ChIPseq;_Caenorhabditis_elega...	H3K4me3 (Millipore, Billerica, MA 17-614, lot:2756917)|glp-1_whole_worm	H3K4me3 (Millipore, Bi...	glp-1_whole_worm|L4	glp-1_whole_worm	ChIP-Seq
SRX3583342	SRA649872	set-26glp-1_rep1_H3K4me3ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	set-26glp-1_rep1_H3K4me3ChIPseq;_Caenorhabditis...	H3K4me3 (Millipore, Billerica, MA 17-614, lot:2756917)|glp-1; set-26_whole_worm	H3K4me3 (Millipore, Bi...	glp-1; set-26_whole_worm|L4	glp-1; set-26_whole_worm	ChIP-Seq
SRX3583343	SRA649872	set-26glp-1_rep2_H3K4me3ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	set-26glp-1_rep2_H3K4me3ChIPseq;_Caenorhabditis...	H3K4me3 (Millipore, Billerica, MA 17-614, lot:2756917)|glp-1; set-26_whole_worm	H3K4me3 (Millipore, Bi...	glp-1; set-26_whole_worm|L4	glp-1; set-26_whole_worm	ChIP-Seq
SRX3583344	SRA649872	wt_rep1_H3ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	wt_rep1_H3ChIPseq;_Caenorhabditis_elegans;_ChIP...	anti-H3 (abcam, United Kingdom ab1791)|N2_whole_worm	anti-H3 (abcam, United...	N2_whole_worm|L4	N2_whole_worm	ChIP-Seq
SRX3583345	SRA649872	wt_rep2_H3ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	wt_rep2_H3ChIPseq;_Caenorhabditis_elegans;_ChIP...	anti-H3 (abcam, United Kingdom ab1791)|N2_whole_worm	anti-H3 (abcam, United...	N2_whole_worm|L4	N2_whole_worm	ChIP-Seq
SRX3583346	SRA649872	F1set9set26_rep1_H3ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	F1set9set26_rep1_H3ChIPseq;_Caenorhabditis_eleg...	anti-H3 (abcam, United Kingdom ab1791)|F1set9set26_whole_worm	anti-H3 (abcam, United...	F1set9set26_whole_worm|L4	F1set9set26_whole_worm	ChIP-Seq
SRX3583347	SRA649872	F1set9set26_rep2_H3ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	F1set9set26_rep2_H3ChIPseq;_Caenorhabditis_eleg...	anti-H3 (abcam, United Kingdom ab1791)|F1set9set26_whole_worm	anti-H3 (abcam, United...	F1set9set26_whole_worm|L4	F1set9set26_whole_worm	ChIP-Seq
SRX3583348	SRA649872	F3set9set26_rep1_H3ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	F3set9set26_rep1_H3ChIPseq;_Caenorhabditis_eleg...	anti-H3 (abcam, United Kingdom ab1791)|F3set9set26_whole_worm	anti-H3 (abcam, United...	F3set9set26_whole_worm|L4	F3set9set26_whole_worm	ChIP-Seq
SRX3583349	SRA649872	F3set9set26_rep2_H3ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	F3set9set26_rep2_H3ChIPseq;_Caenorhabditis_eleg...	anti-H3 (abcam, United Kingdom ab1791)|F3set9set26_whole_worm	anti-H3 (abcam, United...	F3set9set26_whole_worm|L4	F3set9set26_whole_worm	ChIP-Seq
SRX3583350	SRA649872	glp-1_rep1_H3ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	glp-1_rep1_H3ChIPseq;_Caenorhabditis_elegans;_C...	anti-H3 (abcam, United Kingdom ab1791)|glp-1_whole_worm	anti-H3 (abcam, United...	glp-1_whole_worm|L4	glp-1_whole_worm	ChIP-Seq
SRX3583351	SRA649872	glp-1_rep2_H3ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	glp-1_rep2_H3ChIPseq;_Caenorhabditis_elegans;_C...	anti-H3 (abcam, United Kingdom ab1791)|glp-1_whole_worm	anti-H3 (abcam, United...	glp-1_whole_worm|L4	glp-1_whole_worm	ChIP-Seq
SRX3583352	SRA649872	set-26glp-1_rep1_H3ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	set-26glp-1_rep1_H3ChIPseq;_Caenorhabditis_eleg...	anti-H3 (abcam, United Kingdom ab1791)|glp-1; set-26_whole_worm	anti-H3 (abcam, United...	glp-1; set-26_whole_worm|L4	glp-1; set-26_whole_worm	ChIP-Seq
SRX3583353	SRA649872	set-26glp-1_rep2_H3ChIPseq;_Caenorhabditis_elegans;_ChIP-Seq	set-26glp-1_rep2_H3ChIPseq;_Caenorhabditis_eleg...	anti-H3 (abcam, United Kingdom ab1791)|glp-1; set-26_whole_worm	anti-H3 (abcam, United...	glp-1; set-26_whole_worm|L4	glp-1; set-26_whole_worm	ChIP-Seq
SRX373265	SRA110044	WT_rep1;_Caenorhabditis_elegans;_ChIP-Seq	WT_rep1;_Caenorhabditis_elegans;_ChIP-Seq	EAP-1 antibody|whole young adult worm lysates	EAP-1 antibody	whole young adult worm lysates|young adult	whole young adult worm...	ChIP-Seq
SRX373266	SRA110044	WT_rep2_#1;_Caenorhabditis_elegans;_ChIP-Seq	WT_rep2_#1;_Caenorhabditis_elegans;_ChIP-Seq	EAP-1 antibody|whole young adult worm lysates	EAP-1 antibody	whole young adult worm lysates|young adult	whole young adult worm...	ChIP-Seq
SRX373267	SRA110044	WT_rep2_#2;_Caenorhabditis_elegans;_ChIP-Seq	WT_rep2_#2;_Caenorhabditis_elegans;_ChIP-Seq	EAP-1 antibody|whole young adult worm lysates	EAP-1 antibody	whole young adult worm lysates|young adult	whole young adult worm...	ChIP-Seq
SRX373268	SRA110044	spr-5_G10;_Caenorhabditis_elegans;_ChIP-Seq	spr-5_G10;_Caenorhabditis_elegans;_ChIP-Seq	EAP-1 antibody|whole young adult worm lysates	EAP-1 antibody	whole young adult worm lysates|young adult	whole young adult worm...	ChIP-Seq
SRX373269	SRA110044	spr-5_G20_rep1;_Caenorhabditis_elegans;_ChIP-Seq	spr-5_G20_rep1;_Caenorhabditis_elegans;_ChIP-Seq	EAP-1 antibody|whole young adult worm lysates	EAP-1 antibody	whole young adult worm lysates|young adult	whole young adult worm...	ChIP-Seq
SRX373270	SRA110044	spr-5_G20_rep2_#1;_Caenorhabditis_elegans;_ChIP-Seq	spr-5_G20_rep2_#1;_Caenorhabditis_elegans;_ChIP...	EAP-1 antibody|whole young adult worm lysates	EAP-1 antibody	whole young adult worm lysates|young adult	whole young adult worm...	ChIP-Seq
SRX373271	SRA110044	spr-5_G20_rep2_#2;_Caenorhabditis_elegans;_ChIP-Seq	spr-5_G20_rep2_#2;_Caenorhabditis_elegans;_ChIP...	EAP-1 antibody|whole young adult worm lysates	EAP-1 antibody	whole young adult worm lysates|young adult	whole young adult worm...	ChIP-Seq
SRX373272	SRA110044	WT_input_rep1;_Caenorhabditis_elegans;_ChIP-Seq	WT_input_rep1;_Caenorhabditis_elegans;_ChIP-Seq	input|whole young adult worm lysates	input	whole young adult worm lysates|young adult	whole young adult worm...	ChIP-Seq
SRX373273	SRA110044	WT_input_rep2;_Caenorhabditis_elegans;_ChIP-Seq	WT_input_rep2;_Caenorhabditis_elegans;_ChIP-Seq	input|whole young adult worm lysates	input	whole young adult worm lysates|young adult	whole young adult worm...	ChIP-Seq
SRX373274	SRA110044	spr-5_G10_input;_Caenorhabditis_elegans;_ChIP-Seq	spr-5_G10_input;_Caenorhabditis_elegans;_ChIP-Seq	input|whole young adult worm lysates	input	whole young adult worm lysates|young adult	whole young adult worm...	ChIP-Seq
SRX373275	SRA110044	spr-5_G20_input_rep1;_Caenorhabditis_elegans;_ChIP-Seq	spr-5_G20_input_rep1;_Caenorhabditis_elegans;_C...	input|whole young adult worm lysates	input	whole young adult worm lysates|young adult	whole young adult worm...	ChIP-Seq
SRX373276	SRA110044	spr-5_G20_input_rep2;_Caenorhabditis_elegans;_ChIP-Seq	spr-5_G20_input_rep2;_Caenorhabditis_elegans;_C...	input|whole young adult worm lysates	input	whole young adult worm lysates|young adult	whole young adult worm...	ChIP-Seq
SRX373277	SRA110044	EAP1-null;_Caenorhabditis_elegans;_ChIP-Seq	EAP1-null;_Caenorhabditis_elegans;_ChIP-Seq	EAP-1 antibody|whole young adult worm lysates	EAP-1 antibody	whole young adult worm lysates|young adult	whole young adult worm...	ChIP-Seq
SRX373278	SRA110044	EAP1-null_input;_Caenorhabditis_elegans;_ChIP-Seq	EAP1-null_input;_Caenorhabditis_elegans;_ChIP-Seq	input|whole young adult worm lysates	input	whole young adult worm lysates|young adult	whole young adult worm...	ChIP-Seq
SRX3733151	SRA660945	glp-4_rep1;_Caenorhabditis_elegans;_ChIP-Seq	glp-4_rep1;_Caenorhabditis_elegans;_ChIP-Seq	MRG-1 antibody (Novus bio)|whole worm	MRG-1 antibody (Novus ...	SS104 glp-4(bn2) I.|whole worm|L4	SS104 glp-4(bn2) I.	ChIP-Seq
SRX3733152	SRA660945	glp-4_rep2;_Caenorhabditis_elegans;_ChIP-Seq	glp-4_rep2;_Caenorhabditis_elegans;_ChIP-Seq	MRG-1 antibody (Novus bio)|whole worm	MRG-1 antibody (Novus ...	SS104 glp-4(bn2) I.|whole worm|L4	SS104 glp-4(bn2) I.	ChIP-Seq
SRX3733153	SRA660945	glp-4_rep3;_Caenorhabditis_elegans;_ChIP-Seq	glp-4_rep3;_Caenorhabditis_elegans;_ChIP-Seq	MRG-1 antibody (Novus bio)|whole worm	MRG-1 antibody (Novus ...	SS104 glp-4(bn2) I.|whole worm|L4	SS104 glp-4(bn2) I.	ChIP-Seq
SRX3733154	SRA660945	glp-4_input_rep1;_Caenorhabditis_elegans;_ChIP-Seq	glp-4_input_rep1;_Caenorhabditis_elegans;_ChIP-Seq	MRG-1 antibody (Novus bio)|whole worm	MRG-1 antibody (Novus ...	SS104 glp-4(bn2) I.|whole worm|L4	SS104 glp-4(bn2) I.	ChIP-Seq
SRX3733155	SRA660945	glp-4_input_rep2;_Caenorhabditis_elegans;_ChIP-Seq	glp-4_input_rep2;_Caenorhabditis_elegans;_ChIP-Seq	MRG-1 antibody (Novus bio)|whole worm	MRG-1 antibody (Novus ...	SS104 glp-4(bn2) I.|whole worm|L4	SS104 glp-4(bn2) I.	ChIP-Seq
SRX3733156	SRA660945	glp-4_input_rep3;_Caenorhabditis_elegans;_ChIP-Seq	glp-4_input_rep3;_Caenorhabditis_elegans;_ChIP-Seq	MRG-1 antibody (Novus bio)|whole worm	MRG-1 antibody (Novus ...	SS104 glp-4(bn2) I.|whole worm|L4	SS104 glp-4(bn2) I.	ChIP-Seq
SRX3733157	SRA660945	N2_rep1;_Caenorhabditis_elegans;_ChIP-Seq	N2_rep1;_Caenorhabditis_elegans;_ChIP-Seq	MRG-1 antibody (Novus bio)|whole worm	MRG-1 antibody (Novus ...	N2|whole worm|L4	N2	ChIP-Seq
SRX3733158	SRA660945	N2_rep2;_Caenorhabditis_elegans;_ChIP-Seq	N2_rep2;_Caenorhabditis_elegans;_ChIP-Seq	MRG-1 antibody (Novus bio)|whole worm	MRG-1 antibody (Novus ...	N2|whole worm|L4	N2	ChIP-Seq
SRX3733159	SRA660945	N2_rep3;_Caenorhabditis_elegans;_ChIP-Seq	N2_rep3;_Caenorhabditis_elegans;_ChIP-Seq	MRG-1 antibody (Novus bio)|whole worm	MRG-1 antibody (Novus ...	N2|whole worm|L4	N2	ChIP-Seq
SRX3733160	SRA660945	N2_input_rep1;_Caenorhabditis_elegans;_ChIP-Seq	N2_input_rep1;_Caenorhabditis_elegans;_ChIP-Seq	MRG-1 antibody (Novus bio)|whole worm	MRG-1 antibody (Novus ...	N2|whole worm|L4	N2	ChIP-Seq
SRX3733161	SRA660945	N2_input_rep2;_Caenorhabditis_elegans;_ChIP-Seq	N2_input_rep2;_Caenorhabditis_elegans;_ChIP-Seq	MRG-1 antibody (Novus bio)|whole worm	MRG-1 antibody (Novus ...	N2|whole worm|L4	N2	ChIP-Seq
SRX3733162	SRA660945	N2_input_rep3;_Caenorhabditis_elegans;_ChIP-Seq	N2_input_rep3;_Caenorhabditis_elegans;_ChIP-Seq	MRG-1 antibody (Novus bio)|whole worm	MRG-1 antibody (Novus ...	N2|whole worm|L4	N2	ChIP-Seq
SRX3862408	SRA676260	n2_L4_input;_Caenorhabditis_elegans;_ChIP-Seq	n2_L4_input;_Caenorhabditis_elegans;_ChIP-Seq	Whole worm	Whole worm	Whole worm|L4	Whole worm	ChIP-Seq
SRX3862409	SRA676260	nmad_L4_input;_Caenorhabditis_elegans;_ChIP-Seq	nmad_L4_input;_Caenorhabditis_elegans;_ChIP-Seq	Whole worm	Whole worm	Whole worm|L4	Whole worm	ChIP-Seq
SRX3862410	SRA676260	top-2_L4_input;_Caenorhabditis_elegans;_ChIP-Seq	top-2_L4_input;_Caenorhabditis_elegans;_ChIP-Seq	Whole worm	Whole worm	Whole worm|L4	Whole worm	ChIP-Seq
SRX3862411	SRA676260	top-2-flag_nmad-1_deletion_L4_input;_Caenorhabditis_elegans;_ChIP-Seq	top-2-flag_nmad-1_deletion_L4_input;_Caenorhabd...	Whole worm	Whole worm	Whole worm|L4	Whole worm	ChIP-Seq
SRX3862412	SRA676260	n2_L4_flag_IP;_Caenorhabditis_elegans;_ChIP-Seq	n2_L4_flag_IP;_Caenorhabditis_elegans;_ChIP-Seq	Whole worm	Whole worm	Whole worm|L4	Whole worm	ChIP-Seq
SRX3862413	SRA676260	nmad-1_flag_L4_IP__rep1;_Caenorhabditis_elegans;_ChIP-Seq	nmad-1_flag_L4_IP__rep1;_Caenorhabditis_elegans...	Whole worm	Whole worm	Whole worm|L4	Whole worm	ChIP-Seq
SRX3862414	SRA676260	nmad-1_flag_L4_IP__rep2;_Caenorhabditis_elegans;_ChIP-Seq	nmad-1_flag_L4_IP__rep2;_Caenorhabditis_elegans...	Whole worm	Whole worm	Whole worm|L4	Whole worm	ChIP-Seq
SRX3862415	SRA676260	top-2__flag_L4_IP_rep1;_Caenorhabditis_elegans;_ChIP-Seq	top-2__flag_L4_IP_rep1;_Caenorhabditis_elegans;...	Whole worm	Whole worm	Whole worm|L4	Whole worm	ChIP-Seq
SRX3862416	SRA676260	top-2__flag_L4_IP_rep2;_Caenorhabditis_elegans;_ChIP-Seq	top-2__flag_L4_IP_rep2;_Caenorhabditis_elegans;...	Whole worm	Whole worm	Whole worm|L4	Whole worm	ChIP-Seq
SRX3862417	SRA676260	top-2_nmad-1_deletion_flag_L4_IP_rep1;_Caenorhabditis_elegans;_ChIP-Seq	top-2_nmad-1_deletion_flag_L4_IP_rep1;_Caenorha...	Whole worm	Whole worm	Whole worm|L4	Whole worm	ChIP-Seq
SRX3862418	SRA676260	top-2_nmad-1_deletion_flag_L4_IP_rep2;_Caenorhabditis_elegans;_ChIP-Seq	top-2_nmad-1_deletion_flag_L4_IP_rep2;_Caenorha...	Whole worm	Whole worm	Whole worm|L4	Whole worm	ChIP-Seq
SRX3883435	SRA681396	PRDE-1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	PRDE-1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	Young adults	Young adults	Young adults|whole animal extract|Young adults	Young adults	ChIP-Seq
SRX3883436	SRA681396	SNPC-4_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SNPC-4_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	Young adults	Young adults	Young adults|whole animal extract|Young adults	Young adults	ChIP-Seq
SRX3883437	SRA681396	TOFU-4_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	TOFU-4_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	Young adults	Young adults	Young adults|whole animal extract|Young adults	Young adults	ChIP-Seq
SRX3883438	SRA681396	TOFU-5_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	TOFU-5_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	Young adults	Young adults	Young adults|whole animal extract|Young adults	Young adults	ChIP-Seq
SRX3883439	SRA681396	Combined_input;_Caenorhabditis_elegans;_ChIP-Seq	Combined_input;_Caenorhabditis_elegans;_ChIP-Seq	Young adults	Young adults	Young adults|whole animal extract|Young adults	Young adults	ChIP-Seq
SRX3923758	SRA687155	DLS395_input;_Caenorhabditis_elegans;_ChIP-Seq	DLS395_input;_Caenorhabditis_elegans;_ChIP-Seq	none|Whole animals	none	DLS395|Whole animals|Day 1 adults	DLS395	ChIP-Seq
SRX3923759	SRA687155	DLS395_CEH-60_3F10_IP;_Caenorhabditis_elegans;_ChIP-Seq	DLS395_CEH-60_3F10_IP;_Caenorhabditis_elegans;_...	anti-HA (3F10, Sigma-Aldrich, 11867423001)|Whole animals	anti-HA (3F10, Sigma-A...	DLS395|Whole animals|Day 1 adults	DLS395	ChIP-Seq
SRX3923760	SRA687155	DLS395_CEH-60_mIgG1_IP;_Caenorhabditis_elegans;_ChIP-Seq	DLS395_CEH-60_mIgG1_IP;_Caenorhabditis_elegans;...	anti-HA (mIgG1, Pierce, 26181)|Whole animals	anti-HA (mIgG1, Pierce...	DLS395|Whole animals|Day 1 adults	DLS395	ChIP-Seq
SRX3923761	SRA687155	DLS396_CEH-60_3F10_IP;_Caenorhabditis_elegans;_ChIP-Seq	DLS396_CEH-60_3F10_IP;_Caenorhabditis_elegans;_...	anti-HA (3F10, Sigma-Aldrich, 11867423001)|Whole animals	anti-HA (3F10, Sigma-A...	DLS396|Whole animals|Day 1 adults	DLS396	ChIP-Seq
SRX3923762	SRA687155	DLS396_UNC-62_3E6_IP;_Caenorhabditis_elegans;_ChIP-Seq	DLS396_UNC-62_3E6_IP;_Caenorhabditis_elegans;_C...	anti-GFP (3E6, Thermo Fisher, A-11120)|Whole animals	anti-GFP (3E6, Thermo ...	DLS396|Whole animals|Day 1 adults	DLS396	ChIP-Seq
SRX3942553	SRA691344	F3_water_H3K9me3;_Caenorhabditis_elegans;_ChIP-Seq	F3_water_H3K9me3;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3|Whole body adult stage	H3K9me3	Whole body adult stage	Whole body adult stage	ChIP-Seq
SRX3942554	SRA691344	F3_DMSO_H3K9me3;_Caenorhabditis_elegans;_ChIP-Seq	F3_DMSO_H3K9me3;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3|Whole body adult stage	H3K9me3	Whole body adult stage	Whole body adult stage	ChIP-Seq
SRX3942555	SRA691344	F3_BPA_H3K9me3;_Caenorhabditis_elegans;_ChIP-Seq	F3_BPA_H3K9me3;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3|Whole body adult stage	H3K9me3	Whole body adult stage	Whole body adult stage	ChIP-Seq
SRX3942556	SRA691344	F3_water_H3K27me3;_Caenorhabditis_elegans;_ChIP-Seq	F3_water_H3K27me3;_Caenorhabditis_elegans;_ChIP...	H3K27me3|Whole body adult stage	H3K27me3	Whole body adult stage	Whole body adult stage	ChIP-Seq
SRX3942557	SRA691344	F3_DMSO_H3K27me3;_Caenorhabditis_elegans;_ChIP-Seq	F3_DMSO_H3K27me3;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me3|Whole body adult stage	H3K27me3	Whole body adult stage	Whole body adult stage	ChIP-Seq
SRX3942558	SRA691344	F3_BPA_H3K27me3;_Caenorhabditis_elegans;_ChIP-Seq	F3_BPA_H3K27me3;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me3|Whole body adult stage	H3K27me3	Whole body adult stage	Whole body adult stage	ChIP-Seq
SRX3942559	SRA691344	input;_Caenorhabditis_elegans;_ChIP-Seq	input;_Caenorhabditis_elegans;_ChIP-Seq	none|Whole body adult stage	none	Whole body adult stage	Whole body adult stage	ChIP-Seq
SRX395521	SRA121976	SNPC-4_ChIP_in_staged_L4s_(5%);_Caenorhabditis_elegans;_ChIP-Seq	SNPC-4_ChIP_in_staged_L4s_(5%);_Caenorhabditis_...	anti-GFP antibody (gift from Anthony Hyman)|staged L4 larvae from OP179 (SNPC-4-GFP transgenic strain)	anti-GFP antibody (gif...	OP179|staged L4 larvae from OP179 (SNPC-4-GFP transgenic strain)|whole animal|L4	OP179	ChIP-Seq
SRX395522	SRA121976	SNPC-4_input_in_staged_L4s_(5%);_Caenorhabditis_elegans;_ChIP-Seq	SNPC-4_input_in_staged_L4s_(5%);_Caenorhabditis...	anti-GFP antibody (gift from Anthony Hyman)|staged L4 larvae from OP179 (SNPC-4-GFP transgenic strain)	anti-GFP antibody (gif...	OP179|staged L4 larvae from OP179 (SNPC-4-GFP transgenic strain)|whole animal|L4	OP179	ChIP-Seq
SRX395523	SRA121976	SNPC-4_ChIP_in_staged_young_adults_(5%);_Caenorhabditis_elegans;_ChIP-Seq	SNPC-4_ChIP_in_staged_young_adults_(5%);_Caenor...	anti-GFP antibody (gift from Anthony Hyman)|staged young adults from OP179 (SNPC-4-GFP transgenic strain)	anti-GFP antibody (gif...	OP179|staged young adults from OP179 (SNPC-4-GFP transgenic strain)|whole animal|YA	OP179	ChIP-Seq
SRX395524	SRA121976	SNPC-4_input_in_staged_young_adults_(5%);_Caenorhabditis_elegans;_ChIP-Seq	SNPC-4_input_in_staged_young_adults_(5%);_Caeno...	anti-GFP antibody (gift from Anthony Hyman)|staged young adults from OP179 (SNPC-4-GFP transgenic strain)	anti-GFP antibody (gif...	OP179|staged young adults from OP179 (SNPC-4-GFP transgenic strain)|whole animal|YA	OP179	ChIP-Seq
SRX395525	SRA121976	SNPC-4_ChIP_in_staged_young_adults_(1%);_Caenorhabditis_elegans;_ChIP-Seq	SNPC-4_ChIP_in_staged_young_adults_(1%);_Caenor...	anti-GFP antibody (gift from Anthony Hyman)|staged young adults from OP179 (SNPC-4-GFP transgenic strain)	anti-GFP antibody (gif...	OP179|staged young adults from OP179 (SNPC-4-GFP transgenic strain)|whole animal|YA	OP179	ChIP-Seq
SRX395526	SRA121976	SNPC-4_input_in_staged_young_adults_(1%);_Caenorhabditis_elegans;_ChIP-Seq	SNPC-4_input_in_staged_young_adults_(1%);_Caeno...	anti-GFP antibody (gift from Anthony Hyman)|staged young adults from OP179 (SNPC-4-GFP transgenic strain)	anti-GFP antibody (gif...	OP179|staged young adults from OP179 (SNPC-4-GFP transgenic strain)|whole animal|YA	OP179	ChIP-Seq
SRX395527	SRA121976	SNPC-4_ChIP_from_germ_cells_of_staged_young_adults_(1%);_Caenorhabditis_elegans;_ChIP-Seq	SNPC-4_ChIP_from_germ_cells_of_staged_young_adu...	anti-GFP antibody (gift from Anthony Hyman)|staged young adults from YL457 (germline-specific SNPC-4-GFP transgenic strain)	anti-GFP antibody (gif...	YL457|staged young adults from YL457 (germline-specific SNPC-4-GFP transgenic strain)|germline|YA	YL457	ChIP-Seq
SRX395528	SRA121976	SNPC-4_input_from_germ_cells_of_staged_young_adults_(1%);_Caenorhabditis_elegans;_ChIP-Seq	SNPC-4_input_from_germ_cells_of_staged_young_ad...	anti-GFP antibody (gift from Anthony Hyman)|staged young adults from YL457 (germline-specific SNPC-4-GFP transgenic strain)	anti-GFP antibody (gif...	YL457|staged young adults from YL457 (germline-specific SNPC-4-GFP transgenic strain)|germline|YA	YL457	ChIP-Seq
SRX395529	SRA121976	SNPC-4_ChIP_from_somatic_cells_of_staged_young_adults_(1%);_Caenorhabditis_elegans;_ChIP-Seq	SNPC-4_ChIP_from_somatic_cells_of_staged_young_...	anti-GFP antibody (gift from Anthony Hyman)|staged young adults from YL524 glp-1;OP179 (germ cell-deficient SNPC-4-GFP transgenic strain)	anti-GFP antibody (gif...	YL524|staged young adults from YL524 glp-1;OP179 (germ cell-deficient SNPC-4-GFP transgenic strain)|soma|YA	YL524	ChIP-Seq
SRX395530	SRA121976	SNPC-4_input_from_somatic_cells_of_staged_young_adults_(1%);_Caenorhabditis_elegans;_ChIP-Seq	SNPC-4_input_from_somatic_cells_of_staged_young...	anti-GFP antibody (gift from Anthony Hyman)|staged young adults from YL524 glp-1;OP179 (germ cell-deficient SNPC-4-GFP transgenic strain)	anti-GFP antibody (gif...	YL524|staged young adults from YL524 glp-1;OP179 (germ cell-deficient SNPC-4-GFP transgenic strain)|soma|YA	YL524	ChIP-Seq
SRX395531	SRA121976	RPC-1_ChIP_in_staged,_intact_young_adults_(1%);_Caenorhabditis_elegans;_ChIP-Seq	RPC-1_ChIP_in_staged,_intact_young_adults_(1%);...	anti-Pol III antibody (gift from Jason Lieb)|staged young adults (N2)	anti-Pol III antibody ...	N2|staged young adults (N2)|whole animal|YA	N2	ChIP-Seq
SRX395532	SRA121976	RPC-1_input_in_staged,_intact_young_adults_(1%);_Caenorhabditis_elegans;_ChIP-Seq	RPC-1_input_in_staged,_intact_young_adults_(1%)...	anti-Pol III antibody (gift from Jason Lieb)|staged young adults (N2)	anti-Pol III antibody ...	N2|staged young adults (N2)|whole animal|YA	N2	ChIP-Seq
SRX4012473	SRA697654	N2_Input_rep1;_Caenorhabditis_elegans;_ChIP-Seq	N2_Input_rep1;_Caenorhabditis_elegans;_ChIP-Seq	none|embryonic lysate	none	embryonic lysate	embryonic lysate	ChIP-Seq
SRX4012474	SRA697654	N2_ChIP_rep1;_Caenorhabditis_elegans;_ChIP-Seq	N2_ChIP_rep1;_Caenorhabditis_elegans;_ChIP-Seq	anti-H3K9me2 (MABI0307)|embryonic lysate	anti-H3K9me2 (MABI0307)	embryonic lysate	embryonic lysate	ChIP-Seq
SRX4012475	SRA697654	N2_Input_rep2;_Caenorhabditis_elegans;_ChIP-Seq	N2_Input_rep2;_Caenorhabditis_elegans;_ChIP-Seq	none|embryonic lysate	none	embryonic lysate	embryonic lysate	ChIP-Seq
SRX4012476	SRA697654	N2_ChIP_rep2;_Caenorhabditis_elegans;_ChIP-Seq	N2_ChIP_rep2;_Caenorhabditis_elegans;_ChIP-Seq	anti-H3K9me2 (MABI0307)|embryonic lysate	anti-H3K9me2 (MABI0307)	embryonic lysate	embryonic lysate	ChIP-Seq
SRX4012477	SRA697654	arle-14_Input_rep1;_Caenorhabditis_elegans;_ChIP-Seq	arle-14_Input_rep1;_Caenorhabditis_elegans;_ChI...	none|embryonic lysate	none	embryonic lysate	embryonic lysate	ChIP-Seq
SRX4012478	SRA697654	arle-14_ChIP_rep1;_Caenorhabditis_elegans;_ChIP-Seq	arle-14_ChIP_rep1;_Caenorhabditis_elegans;_ChIP...	anti-H3K9me2 (MABI0307)|embryonic lysate	anti-H3K9me2 (MABI0307)	embryonic lysate	embryonic lysate	ChIP-Seq
SRX4012479	SRA697654	arle-14_Input_rep2;_Caenorhabditis_elegans;_ChIP-Seq	arle-14_Input_rep2;_Caenorhabditis_elegans;_ChI...	none|embryonic lysate	none	embryonic lysate	embryonic lysate	ChIP-Seq
SRX4012480	SRA697654	arle-14_ChIP_rep2;_Caenorhabditis_elegans;_ChIP-Seq	arle-14_ChIP_rep2;_Caenorhabditis_elegans;_ChIP...	anti-H3K9me2 (MABI0307)|embryonic lysate	anti-H3K9me2 (MABI0307)	embryonic lysate	embryonic lysate	ChIP-Seq
SRX4029333	SRA560919	wormChIPInput:_Hmg3-HA_input;_Caenorhabditis_elegans;_ChIP-Seq	wormChIPInput:_Hmg3-HA_input;_Caenorhabditis_el...	whole worms	whole worms	whole worms|whole worms	whole worms	ChIP-Seq
SRX4029334	SRA560919	hmg3haChIP1:_Hmg3-HA_ChIP-seq_rep1;_Caenorhabditis_elegans;_ChIP-Seq	hmg3haChIP1:_Hmg3-HA_ChIP-seq_rep1;_Caenorhabdi...	whole worms	whole worms	whole worms|whole worms	whole worms	ChIP-Seq
SRX4029335	SRA560919	hmg3haChIP2:_Hmg3-HA_ChIP-seq_rep2;_Caenorhabditis_elegans;_ChIP-Seq	hmg3haChIP2:_Hmg3-HA_ChIP-seq_rep2;_Caenorhabdi...	whole worms	whole worms	whole worms|whole worms	whole worms	ChIP-Seq
SRX4029336	SRA560919	gAtac_rluc1:_gonad_ATAC-seq_rep1;_Caenorhabditis_elegans;_ATAC-seq	gAtac_rluc1:_gonad_ATAC-seq_rep1;_Caenorhabditi...	ATAC-seq	ATAC-seq	worm gonads|worm gonads	worm gonads	ATAC-seq
SRX4029337	SRA560919	gAtac_rluc2:_gonad_ATAC-seq_rep1;_Caenorhabditis_elegans;_ATAC-seq	gAtac_rluc2:_gonad_ATAC-seq_rep1;_Caenorhabditi...	ATAC-seq	ATAC-seq	worm gonads|worm gonads	worm gonads	ATAC-seq
SRX4029338	SRA560919	gAtac_rluc3:_gonad_ATAC-seq_rep1;_Caenorhabditis_elegans;_ATAC-seq	gAtac_rluc3:_gonad_ATAC-seq_rep1;_Caenorhabditi...	ATAC-seq	ATAC-seq	worm gonads|worm gonads	worm gonads	ATAC-seq
SRX4082334	SRA703806	H3K4me3_wt_emb_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_wt_emb_rep1;_Caenorhabditis_elegans;_Ch...	H3K4me3|mixed embryos	H3K4me3	N2|mixed embryos	N2	ChIP-Seq
SRX4082335	SRA703806	H3K4me3_wt_emb_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_wt_emb_rep2;_Caenorhabditis_elegans;_Ch...	H3K4me3|mixed embryos	H3K4me3	N2|mixed embryos	N2	ChIP-Seq
SRX4082336	SRA703806	H3K4me3_wt_l1_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_wt_l1_rep1;_Caenorhabditis_elegans;_ChI...	H3K4me3|L1 larvae	H3K4me3	N2|L1 larvae	N2	ChIP-Seq
SRX4082337	SRA703806	H3K4me3_wt_l1_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_wt_l1_rep2;_Caenorhabditis_elegans;_ChI...	H3K4me3|L1 larvae	H3K4me3	N2|L1 larvae	N2	ChIP-Seq
SRX4082338	SRA703806	H3K4me3_wt_l2_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_wt_l2_rep1;_Caenorhabditis_elegans;_ChI...	H3K4me3|L2 larvae	H3K4me3	N2|L2 larvae	N2	ChIP-Seq
SRX4082339	SRA703806	H3K4me3_wt_l2_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_wt_l2_rep2;_Caenorhabditis_elegans;_ChI...	H3K4me3|L2 larvae	H3K4me3	N2|L2 larvae	N2	ChIP-Seq
SRX4082340	SRA703806	H3K4me3_wt_l3_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_wt_l3_rep1;_Caenorhabditis_elegans;_ChI...	H3K4me3|L3 larvae	H3K4me3	N2|L3 larvae	N2	ChIP-Seq
SRX4082341	SRA703806	H3K4me3_wt_l3_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_wt_l3_rep2;_Caenorhabditis_elegans;_ChI...	H3K4me3|L3 larvae	H3K4me3	N2|L3 larvae	N2	ChIP-Seq
SRX4082342	SRA703806	H3K4me3_wt_l4_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_wt_l4_rep1;_Caenorhabditis_elegans;_ChI...	H3K4me3|L4 larvae	H3K4me3	N2|L4 larvae	N2	ChIP-Seq
SRX4082343	SRA703806	H3K4me3_wt_l4_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_wt_l4_rep2;_Caenorhabditis_elegans;_ChI...	H3K4me3|L4 larvae	H3K4me3	N2|L4 larvae	N2	ChIP-Seq
SRX4082344	SRA703806	H3K4me3_wt_ya_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_wt_ya_rep1;_Caenorhabditis_elegans;_ChI...	H3K4me3|young adults	H3K4me3	N2|young adults	N2	ChIP-Seq
SRX4082345	SRA703806	H3K4me3_wt_ya_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_wt_ya_rep2;_Caenorhabditis_elegans;_ChI...	H3K4me3|young adults	H3K4me3	N2|young adults	N2	ChIP-Seq
SRX4082346	SRA703806	H3K4me1_wt_emb_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me1_wt_emb_rep1;_Caenorhabditis_elegans;_Ch...	H3K4me1|mixed embryos	H3K4me1	N2|mixed embryos	N2	ChIP-Seq
SRX4082347	SRA703806	H3K4me1_wt_emb_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me1_wt_emb_rep2;_Caenorhabditis_elegans;_Ch...	H3K4me1|mixed embryos	H3K4me1	N2|mixed embryos	N2	ChIP-Seq
SRX4082348	SRA703806	H3K4me1_wt_l1_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me1_wt_l1_rep1;_Caenorhabditis_elegans;_ChI...	H3K4me1|L1 larvae	H3K4me1	N2|L1 larvae	N2	ChIP-Seq
SRX4082349	SRA703806	H3K4me1_wt_l1_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me1_wt_l1_rep2;_Caenorhabditis_elegans;_ChI...	H3K4me1|L1 larvae	H3K4me1	N2|L1 larvae	N2	ChIP-Seq
SRX4082350	SRA703806	H3K4me1_wt_l2_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me1_wt_l2_rep1;_Caenorhabditis_elegans;_ChI...	H3K4me1|L2 larvae	H3K4me1	N2|L2 larvae	N2	ChIP-Seq
SRX4082351	SRA703806	H3K4me1_wt_l2_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me1_wt_l2_rep2;_Caenorhabditis_elegans;_ChI...	H3K4me1|L2 larvae	H3K4me1	N2|L2 larvae	N2	ChIP-Seq
SRX4082352	SRA703806	H3K4me1_wt_l3_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me1_wt_l3_rep1;_Caenorhabditis_elegans;_ChI...	H3K4me1|L3 larvae	H3K4me1	N2|L3 larvae	N2	ChIP-Seq
SRX4082353	SRA703806	H3K4me1_wt_l3_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me1_wt_l3_rep2;_Caenorhabditis_elegans;_ChI...	H3K4me1|L3 larvae	H3K4me1	N2|L3 larvae	N2	ChIP-Seq
SRX4082354	SRA703806	H3K4me1_wt_l4_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me1_wt_l4_rep1;_Caenorhabditis_elegans;_ChI...	H3K4me1|L4 larvae	H3K4me1	N2|L4 larvae	N2	ChIP-Seq
SRX4082355	SRA703806	H3K4me1_wt_l4_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me1_wt_l4_rep2;_Caenorhabditis_elegans;_ChI...	H3K4me1|L4 larvae	H3K4me1	N2|L4 larvae	N2	ChIP-Seq
SRX4082356	SRA703806	H3K4me1_wt_ya_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me1_wt_ya_rep1;_Caenorhabditis_elegans;_ChI...	H3K4me1|young adults	H3K4me1	N2|young adults	N2	ChIP-Seq
SRX4082357	SRA703806	H3K4me1_wt_ya_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me1_wt_ya_rep2;_Caenorhabditis_elegans;_ChI...	H3K4me1|young adults	H3K4me1	N2|young adults	N2	ChIP-Seq
SRX4082358	SRA703806	H3K36me3_wt_emb_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_wt_emb_rep1;_Caenorhabditis_elegans;_C...	H3K36me3|mixed embryos	H3K36me3	N2|mixed embryos	N2	ChIP-Seq
SRX4082359	SRA703806	H3K36me3_wt_emb_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_wt_emb_rep2;_Caenorhabditis_elegans;_C...	H3K36me3|mixed embryos	H3K36me3	N2|mixed embryos	N2	ChIP-Seq
SRX4082360	SRA703806	H3K36me3_wt_l1_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_wt_l1_rep1;_Caenorhabditis_elegans;_Ch...	H3K36me3|L1 larvae	H3K36me3	N2|L1 larvae	N2	ChIP-Seq
SRX4082361	SRA703806	H3K36me3_wt_l1_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_wt_l1_rep2;_Caenorhabditis_elegans;_Ch...	H3K36me3|L1 larvae	H3K36me3	N2|L1 larvae	N2	ChIP-Seq
SRX4082362	SRA703806	H3K36me3_wt_l2_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_wt_l2_rep1;_Caenorhabditis_elegans;_Ch...	H3K36me3|L2 larvae	H3K36me3	N2|L2 larvae	N2	ChIP-Seq
SRX4082363	SRA703806	H3K36me3_wt_l2_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_wt_l2_rep2;_Caenorhabditis_elegans;_Ch...	H3K36me3|L2 larvae	H3K36me3	N2|L2 larvae	N2	ChIP-Seq
SRX4082364	SRA703806	H3K36me3_wt_l3_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_wt_l3_rep1;_Caenorhabditis_elegans;_Ch...	H3K36me3|L3 larvae	H3K36me3	N2|L3 larvae	N2	ChIP-Seq
SRX4082365	SRA703806	H3K36me3_wt_l3_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_wt_l3_rep2;_Caenorhabditis_elegans;_Ch...	H3K36me3|L3 larvae	H3K36me3	N2|L3 larvae	N2	ChIP-Seq
SRX4082366	SRA703806	H3K36me3_wt_l4_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_wt_l4_rep1;_Caenorhabditis_elegans;_Ch...	H3K36me3|L4 larvae	H3K36me3	N2|L4 larvae	N2	ChIP-Seq
SRX4082367	SRA703806	H3K36me3_wt_l4_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_wt_l4_rep2;_Caenorhabditis_elegans;_Ch...	H3K36me3|L4 larvae	H3K36me3	N2|L4 larvae	N2	ChIP-Seq
SRX4082368	SRA703806	H3K36me3_wt_ya_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_wt_ya_rep1;_Caenorhabditis_elegans;_Ch...	H3K36me3|young adults	H3K36me3	N2|young adults	N2	ChIP-Seq
SRX4082369	SRA703806	H3K36me3_wt_ya_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_wt_ya_rep2;_Caenorhabditis_elegans;_Ch...	H3K36me3|young adults	H3K36me3	N2|young adults	N2	ChIP-Seq
SRX4082370	SRA703806	H3K27me3_wt_emb_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me3_wt_emb_rep1;_Caenorhabditis_elegans;_C...	H3K27me3|mixed embryos	H3K27me3	N2|mixed embryos	N2	ChIP-Seq
SRX4082371	SRA703806	H3K27me3_wt_emb_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me3_wt_emb_rep2;_Caenorhabditis_elegans;_C...	H3K27me3|mixed embryos	H3K27me3	N2|mixed embryos	N2	ChIP-Seq
SRX4082372	SRA703806	H3K27me3_wt_l1_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me3_wt_l1_rep1;_Caenorhabditis_elegans;_Ch...	H3K27me3|L1 larvae	H3K27me3	N2|L1 larvae	N2	ChIP-Seq
SRX4082373	SRA703806	H3K27me3_wt_l1_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me3_wt_l1_rep2;_Caenorhabditis_elegans;_Ch...	H3K27me3|L1 larvae	H3K27me3	N2|L1 larvae	N2	ChIP-Seq
SRX4082374	SRA703806	H3K27me3_wt_l2_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me3_wt_l2_rep1;_Caenorhabditis_elegans;_Ch...	H3K27me3|L2 larvae	H3K27me3	N2|L2 larvae	N2	ChIP-Seq
SRX4082375	SRA703806	H3K27me3_wt_l2_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me3_wt_l2_rep2;_Caenorhabditis_elegans;_Ch...	H3K27me3|L2 larvae	H3K27me3	N2|L2 larvae	N2	ChIP-Seq
SRX4082376	SRA703806	H3K27me3_wt_l3_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me3_wt_l3_rep1;_Caenorhabditis_elegans;_Ch...	H3K27me3|L3 larvae	H3K27me3	N2|L3 larvae	N2	ChIP-Seq
SRX4082377	SRA703806	H3K27me3_wt_l3_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me3_wt_l3_rep2;_Caenorhabditis_elegans;_Ch...	H3K27me3|L3 larvae	H3K27me3	N2|L3 larvae	N2	ChIP-Seq
SRX4082378	SRA703806	H3K27me3_wt_l4_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me3_wt_l4_rep1;_Caenorhabditis_elegans;_Ch...	H3K27me3|L4 larvae	H3K27me3	N2|L4 larvae	N2	ChIP-Seq
SRX4082379	SRA703806	H3K27me3_wt_l4_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me3_wt_l4_rep2;_Caenorhabditis_elegans;_Ch...	H3K27me3|L4 larvae	H3K27me3	N2|L4 larvae	N2	ChIP-Seq
SRX4082380	SRA703806	H3K27me3_wt_ya_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me3_wt_ya_rep1;_Caenorhabditis_elegans;_Ch...	H3K27me3|young adults	H3K27me3	N2|young adults	N2	ChIP-Seq
SRX4082381	SRA703806	H3K27me3_wt_ya_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me3_wt_ya_rep2;_Caenorhabditis_elegans;_Ch...	H3K27me3|young adults	H3K27me3	N2|young adults	N2	ChIP-Seq
SRX4082382	SRA703807	wt_emb_ATAC-seq_rep1;_Caenorhabditis_elegans;_ATAC-seq	wt_emb_ATAC-seq_rep1;_Caenorhabditis_elegans;_A...	ATAC-seq	ATAC-seq	wild-type N2|mixed embryos	wild-type N2	ATAC-seq
SRX4082383	SRA703807	wt_emb_ATAC-seq_rep2;_Caenorhabditis_elegans;_ATAC-seq	wt_emb_ATAC-seq_rep2;_Caenorhabditis_elegans;_A...	ATAC-seq	ATAC-seq	wild-type N2|mixed embryos	wild-type N2	ATAC-seq
SRX4082384	SRA703807	wt_L1_ATAC-seq_rep1;_Caenorhabditis_elegans;_ATAC-seq	wt_L1_ATAC-seq_rep1;_Caenorhabditis_elegans;_AT...	ATAC-seq	ATAC-seq	wild-type N2|L1 larvae	wild-type N2	ATAC-seq
SRX4082385	SRA703807	wt_L1_ATAC-seq_rep2;_Caenorhabditis_elegans;_ATAC-seq	wt_L1_ATAC-seq_rep2;_Caenorhabditis_elegans;_AT...	ATAC-seq	ATAC-seq	wild-type N2|L1 larvae	wild-type N2	ATAC-seq
SRX4082386	SRA703807	wt_L2_ATAC-seq_rep1;_Caenorhabditis_elegans;_ATAC-seq	wt_L2_ATAC-seq_rep1;_Caenorhabditis_elegans;_AT...	ATAC-seq	ATAC-seq	wild-type N2|L2 larvae	wild-type N2	ATAC-seq
SRX4082387	SRA703807	wt_L2_ATAC-seq_rep2;_Caenorhabditis_elegans;_ATAC-seq	wt_L2_ATAC-seq_rep2;_Caenorhabditis_elegans;_AT...	ATAC-seq	ATAC-seq	wild-type N2|L2 larvae	wild-type N2	ATAC-seq
SRX4082388	SRA703807	wt_L3_ATAC-seq_rep1;_Caenorhabditis_elegans;_ATAC-seq	wt_L3_ATAC-seq_rep1;_Caenorhabditis_elegans;_AT...	ATAC-seq	ATAC-seq	wild-type N2|L3 larvae	wild-type N2	ATAC-seq
SRX4082389	SRA703807	wt_L3_ATAC-seq_rep2;_Caenorhabditis_elegans;_ATAC-seq	wt_L3_ATAC-seq_rep2;_Caenorhabditis_elegans;_AT...	ATAC-seq	ATAC-seq	wild-type N2|L3 larvae	wild-type N2	ATAC-seq
SRX4082390	SRA703807	wt_L4_ATAC-seq_rep1;_Caenorhabditis_elegans;_ATAC-seq	wt_L4_ATAC-seq_rep1;_Caenorhabditis_elegans;_AT...	ATAC-seq	ATAC-seq	wild-type N2|L4 larvae	wild-type N2	ATAC-seq
SRX4082391	SRA703807	wt_L4_ATAC-seq_rep2;_Caenorhabditis_elegans;_ATAC-seq	wt_L4_ATAC-seq_rep2;_Caenorhabditis_elegans;_AT...	ATAC-seq	ATAC-seq	wild-type N2|L4 larvae	wild-type N2	ATAC-seq
SRX4082392	SRA703807	wt_YA_ATAC-seq_rep1;_Caenorhabditis_elegans;_ATAC-seq	wt_YA_ATAC-seq_rep1;_Caenorhabditis_elegans;_AT...	ATAC-seq	ATAC-seq	wild-type N2|young adults	wild-type N2	ATAC-seq
SRX4082393	SRA703807	wt_YA_ATAC-seq_rep2;_Caenorhabditis_elegans;_ATAC-seq	wt_YA_ATAC-seq_rep2;_Caenorhabditis_elegans;_AT...	ATAC-seq	ATAC-seq	wild-type N2|young adults	wild-type N2	ATAC-seq
SRX4082394	SRA703807	glp-1_YA_ATAC-seq_rep1;_Caenorhabditis_elegans;_ATAC-seq	glp-1_YA_ATAC-seq_rep1;_Caenorhabditis_elegans;...	ATAC-seq	ATAC-seq	glp-1(e2144)|day 1 / young adults	glp-1(e2144)	ATAC-seq
SRX4082395	SRA703807	glp-1_YA_ATAC-seq_rep2;_Caenorhabditis_elegans;_ATAC-seq	glp-1_YA_ATAC-seq_rep2;_Caenorhabditis_elegans;...	ATAC-seq	ATAC-seq	glp-1(e2144)|day 1 / young adults	glp-1(e2144)	ATAC-seq
SRX4082396	SRA703807	glp-1_day2adult_ATAC-seq_rep1;_Caenorhabditis_elegans;_ATAC-seq	glp-1_day2adult_ATAC-seq_rep1;_Caenorhabditis_e...	ATAC-seq	ATAC-seq	glp-1(e2144)|day 2 adults	glp-1(e2144)	ATAC-seq
SRX4082397	SRA703807	glp-1_day2adult_ATAC-seq_rep2;_Caenorhabditis_elegans;_ATAC-seq	glp-1_day2adult_ATAC-seq_rep2;_Caenorhabditis_e...	ATAC-seq	ATAC-seq	glp-1(e2144)|day 2 adults	glp-1(e2144)	ATAC-seq
SRX4082398	SRA703807	glp-1_day6adult_ATAC-seq_rep1;_Caenorhabditis_elegans;_ATAC-seq	glp-1_day6adult_ATAC-seq_rep1;_Caenorhabditis_e...	ATAC-seq	ATAC-seq	glp-1(e2144)|day 6 adults	glp-1(e2144)	ATAC-seq
SRX4082399	SRA703807	glp-1_day6adult_ATAC-seq_rep2;_Caenorhabditis_elegans;_ATAC-seq	glp-1_day6adult_ATAC-seq_rep2;_Caenorhabditis_e...	ATAC-seq	ATAC-seq	glp-1(e2144)|day 6 adults	glp-1(e2144)	ATAC-seq
SRX4082400	SRA703807	glp-1_day9adult_ATAC-seq_rep1;_Caenorhabditis_elegans;_ATAC-seq	glp-1_day9adult_ATAC-seq_rep1;_Caenorhabditis_e...	ATAC-seq	ATAC-seq	glp-1(e2144)|day 9 adults	glp-1(e2144)	ATAC-seq
SRX4082401	SRA703807	glp-1_day9adult_ATAC-seq_rep2;_Caenorhabditis_elegans;_ATAC-seq	glp-1_day9adult_ATAC-seq_rep2;_Caenorhabditis_e...	ATAC-seq	ATAC-seq	glp-1(e2144)|day 9 adults	glp-1(e2144)	ATAC-seq
SRX4082402	SRA703807	glp-1_day13adult_ATAC-seq_rep1;_Caenorhabditis_elegans;_ATAC-seq	glp-1_day13adult_ATAC-seq_rep1;_Caenorhabditis_...	ATAC-seq	ATAC-seq	glp-1(e2144)|day 13 adults	glp-1(e2144)	ATAC-seq
SRX4082403	SRA703807	glp-1_day13adult_ATAC-seq_rep2;_Caenorhabditis_elegans;_ATAC-seq	glp-1_day13adult_ATAC-seq_rep2;_Caenorhabditis_...	ATAC-seq	ATAC-seq	glp-1(e2144)|day 13 adults	glp-1(e2144)	ATAC-seq
SRX4085338	SRA704563	wt_emb_DNase-seq_rep1_2.5U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_emb_DNase-seq_rep1_2.5U_ml;_Caenorhabditis_e...	DNase-seq	DNase-seq	wild-type N2|mixed embryos	wild-type N2	DNase-Hypersensitivity
SRX4085339	SRA704563	wt_emb_DNase-seq_rep1_5U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_emb_DNase-seq_rep1_5U_ml;_Caenorhabditis_ele...	DNase-seq	DNase-seq	wild-type N2|mixed embryos	wild-type N2	DNase-Hypersensitivity
SRX4085340	SRA704563	wt_emb_DNase-seq_rep1_10U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_emb_DNase-seq_rep1_10U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|mixed embryos	wild-type N2	DNase-Hypersensitivity
SRX4085341	SRA704563	wt_emb_DNase-seq_rep1_25U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_emb_DNase-seq_rep1_25U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|mixed embryos	wild-type N2	DNase-Hypersensitivity
SRX4085342	SRA704563	wt_emb_DNase-seq_rep1_50U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_emb_DNase-seq_rep1_50U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|mixed embryos	wild-type N2	DNase-Hypersensitivity
SRX4085343	SRA704563	wt_emb_DNase-seq_rep1_100U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_emb_DNase-seq_rep1_100U_ml;_Caenorhabditis_e...	DNase-seq	DNase-seq	wild-type N2|mixed embryos	wild-type N2	DNase-Hypersensitivity
SRX4085344	SRA704563	wt_emb_DNase-seq_rep1_200U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_emb_DNase-seq_rep1_200U_ml;_Caenorhabditis_e...	DNase-seq	DNase-seq	wild-type N2|mixed embryos	wild-type N2	DNase-Hypersensitivity
SRX4085345	SRA704563	wt_emb_DNase-seq_rep1_400U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_emb_DNase-seq_rep1_400U_ml;_Caenorhabditis_e...	DNase-seq	DNase-seq	wild-type N2|mixed embryos	wild-type N2	DNase-Hypersensitivity
SRX4085346	SRA704563	wt_emb_DNase-seq_rep1_800U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_emb_DNase-seq_rep1_800U_ml;_Caenorhabditis_e...	DNase-seq	DNase-seq	wild-type N2|mixed embryos	wild-type N2	DNase-Hypersensitivity
SRX4085347	SRA704563	wt_emb_DNase-seq_rep2_2.5U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_emb_DNase-seq_rep2_2.5U_ml;_Caenorhabditis_e...	DNase-seq	DNase-seq	wild-type N2|mixed embryos	wild-type N2	DNase-Hypersensitivity
SRX4085348	SRA704563	wt_emb_DNase-seq_rep2_5U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_emb_DNase-seq_rep2_5U_ml;_Caenorhabditis_ele...	DNase-seq	DNase-seq	wild-type N2|mixed embryos	wild-type N2	DNase-Hypersensitivity
SRX4085349	SRA704563	wt_emb_DNase-seq_rep2_10U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_emb_DNase-seq_rep2_10U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|mixed embryos	wild-type N2	DNase-Hypersensitivity
SRX4085350	SRA704563	wt_emb_DNase-seq_rep2_25U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_emb_DNase-seq_rep2_25U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|mixed embryos	wild-type N2	DNase-Hypersensitivity
SRX4085351	SRA704563	wt_emb_DNase-seq_rep2_50U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_emb_DNase-seq_rep2_50U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|mixed embryos	wild-type N2	DNase-Hypersensitivity
SRX4085352	SRA704563	wt_emb_DNase-seq_rep2_100U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_emb_DNase-seq_rep2_100U_ml;_Caenorhabditis_e...	DNase-seq	DNase-seq	wild-type N2|mixed embryos	wild-type N2	DNase-Hypersensitivity
SRX4085353	SRA704563	wt_emb_DNase-seq_rep2_200U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_emb_DNase-seq_rep2_200U_ml;_Caenorhabditis_e...	DNase-seq	DNase-seq	wild-type N2|mixed embryos	wild-type N2	DNase-Hypersensitivity
SRX4085354	SRA704563	wt_emb_DNase-seq_rep2_400U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_emb_DNase-seq_rep2_400U_ml;_Caenorhabditis_e...	DNase-seq	DNase-seq	wild-type N2|mixed embryos	wild-type N2	DNase-Hypersensitivity
SRX4085355	SRA704563	wt_emb_DNase-seq_rep2_800U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_emb_DNase-seq_rep2_800U_ml;_Caenorhabditis_e...	DNase-seq	DNase-seq	wild-type N2|mixed embryos	wild-type N2	DNase-Hypersensitivity
SRX4085356	SRA704563	wt_L1_DNase-seq_rep1_2.5U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L1_DNase-seq_rep1_2.5U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L1 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085357	SRA704563	wt_L1_DNase-seq_rep1_5U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L1_DNase-seq_rep1_5U_ml;_Caenorhabditis_eleg...	DNase-seq	DNase-seq	wild-type N2|L1 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085358	SRA704563	wt_L1_DNase-seq_rep1_10U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L1_DNase-seq_rep1_10U_ml;_Caenorhabditis_ele...	DNase-seq	DNase-seq	wild-type N2|L1 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085359	SRA704563	wt_L1_DNase-seq_rep1_25U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L1_DNase-seq_rep1_25U_ml;_Caenorhabditis_ele...	DNase-seq	DNase-seq	wild-type N2|L1 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085360	SRA704563	wt_L1_DNase-seq_rep1_50U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L1_DNase-seq_rep1_50U_ml;_Caenorhabditis_ele...	DNase-seq	DNase-seq	wild-type N2|L1 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085361	SRA704563	wt_L1_DNase-seq_rep1_100U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L1_DNase-seq_rep1_100U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L1 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085362	SRA704563	wt_L1_DNase-seq_rep1_200U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L1_DNase-seq_rep1_200U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L1 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085363	SRA704563	wt_L1_DNase-seq_rep1_400U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L1_DNase-seq_rep1_400U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L1 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085364	SRA704563	wt_L1_DNase-seq_rep1_800U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L1_DNase-seq_rep1_800U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L1 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085365	SRA704563	wt_L1_DNase-seq_rep2_2.5U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L1_DNase-seq_rep2_2.5U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L1 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085366	SRA704563	wt_L1_DNase-seq_rep2_5U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L1_DNase-seq_rep2_5U_ml;_Caenorhabditis_eleg...	DNase-seq	DNase-seq	wild-type N2|L1 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085367	SRA704563	wt_L1_DNase-seq_rep2_10U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L1_DNase-seq_rep2_10U_ml;_Caenorhabditis_ele...	DNase-seq	DNase-seq	wild-type N2|L1 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085368	SRA704563	wt_L1_DNase-seq_rep2_25U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L1_DNase-seq_rep2_25U_ml;_Caenorhabditis_ele...	DNase-seq	DNase-seq	wild-type N2|L1 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085369	SRA704563	wt_L1_DNase-seq_rep2_50U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L1_DNase-seq_rep2_50U_ml;_Caenorhabditis_ele...	DNase-seq	DNase-seq	wild-type N2|L1 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085370	SRA704563	wt_L1_DNase-seq_rep2_100U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L1_DNase-seq_rep2_100U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L1 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085371	SRA704563	wt_L1_DNase-seq_rep2_200U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L1_DNase-seq_rep2_200U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L1 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085372	SRA704563	wt_L1_DNase-seq_rep2_400U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L1_DNase-seq_rep2_400U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L1 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085373	SRA704563	wt_L1_DNase-seq_rep2_800U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L1_DNase-seq_rep2_800U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L1 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085374	SRA704563	wt_L2_DNase-seq_rep1_2.5U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L2_DNase-seq_rep1_2.5U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L2 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085375	SRA704563	wt_L2_DNase-seq_rep1_5U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L2_DNase-seq_rep1_5U_ml;_Caenorhabditis_eleg...	DNase-seq	DNase-seq	wild-type N2|L2 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085376	SRA704563	wt_L2_DNase-seq_rep1_10U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L2_DNase-seq_rep1_10U_ml;_Caenorhabditis_ele...	DNase-seq	DNase-seq	wild-type N2|L2 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085377	SRA704563	wt_L2_DNase-seq_rep1_25U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L2_DNase-seq_rep1_25U_ml;_Caenorhabditis_ele...	DNase-seq	DNase-seq	wild-type N2|L2 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085378	SRA704563	wt_L2_DNase-seq_rep1_50U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L2_DNase-seq_rep1_50U_ml;_Caenorhabditis_ele...	DNase-seq	DNase-seq	wild-type N2|L2 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085379	SRA704563	wt_L2_DNase-seq_rep1_100U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L2_DNase-seq_rep1_100U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L2 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085380	SRA704563	wt_L2_DNase-seq_rep1_200U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L2_DNase-seq_rep1_200U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L2 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085381	SRA704563	wt_L2_DNase-seq_rep1_400U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L2_DNase-seq_rep1_400U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L2 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085382	SRA704563	wt_L2_DNase-seq_rep1_800U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L2_DNase-seq_rep1_800U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L2 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085383	SRA704563	wt_L2_DNase-seq_rep2_2.5U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L2_DNase-seq_rep2_2.5U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L2 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085384	SRA704563	wt_L2_DNase-seq_rep2_5U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L2_DNase-seq_rep2_5U_ml;_Caenorhabditis_eleg...	DNase-seq	DNase-seq	wild-type N2|L2 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085385	SRA704563	wt_L2_DNase-seq_rep2_10U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L2_DNase-seq_rep2_10U_ml;_Caenorhabditis_ele...	DNase-seq	DNase-seq	wild-type N2|L2 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085386	SRA704563	wt_L2_DNase-seq_rep2_25U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L2_DNase-seq_rep2_25U_ml;_Caenorhabditis_ele...	DNase-seq	DNase-seq	wild-type N2|L2 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085387	SRA704563	wt_L2_DNase-seq_rep2_50U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L2_DNase-seq_rep2_50U_ml;_Caenorhabditis_ele...	DNase-seq	DNase-seq	wild-type N2|L2 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085388	SRA704563	wt_L2_DNase-seq_rep2_100U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L2_DNase-seq_rep2_100U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L2 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085389	SRA704563	wt_L2_DNase-seq_rep2_200U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L2_DNase-seq_rep2_200U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L2 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085390	SRA704563	wt_L2_DNase-seq_rep2_400U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L2_DNase-seq_rep2_400U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L2 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085391	SRA704563	wt_L2_DNase-seq_rep2_800U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L2_DNase-seq_rep2_800U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L2 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085392	SRA704563	wt_L3_DNase-seq_rep1_2.5U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L3_DNase-seq_rep1_2.5U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L3 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085393	SRA704563	wt_L3_DNase-seq_rep1_10U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L3_DNase-seq_rep1_10U_ml;_Caenorhabditis_ele...	DNase-seq	DNase-seq	wild-type N2|L3 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085394	SRA704563	wt_L3_DNase-seq_rep1_25U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L3_DNase-seq_rep1_25U_ml;_Caenorhabditis_ele...	DNase-seq	DNase-seq	wild-type N2|L3 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085395	SRA704563	wt_L3_DNase-seq_rep1_50U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L3_DNase-seq_rep1_50U_ml;_Caenorhabditis_ele...	DNase-seq	DNase-seq	wild-type N2|L3 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085396	SRA704563	wt_L3_DNase-seq_rep1_100U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L3_DNase-seq_rep1_100U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L3 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085397	SRA704563	wt_L3_DNase-seq_rep1_200U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L3_DNase-seq_rep1_200U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L3 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085398	SRA704563	wt_L3_DNase-seq_rep1_400U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L3_DNase-seq_rep1_400U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L3 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085399	SRA704563	wt_L3_DNase-seq_rep1_800U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L3_DNase-seq_rep1_800U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L3 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085400	SRA704563	wt_L3_DNase-seq_rep2_2.5U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L3_DNase-seq_rep2_2.5U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L3 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085401	SRA704563	wt_L3_DNase-seq_rep2_5U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L3_DNase-seq_rep2_5U_ml;_Caenorhabditis_eleg...	DNase-seq	DNase-seq	wild-type N2|L3 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085402	SRA704563	wt_L3_DNase-seq_rep2_10U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L3_DNase-seq_rep2_10U_ml;_Caenorhabditis_ele...	DNase-seq	DNase-seq	wild-type N2|L3 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085403	SRA704563	wt_L3_DNase-seq_rep2_25U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L3_DNase-seq_rep2_25U_ml;_Caenorhabditis_ele...	DNase-seq	DNase-seq	wild-type N2|L3 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085404	SRA704563	wt_L3_DNase-seq_rep2_50U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L3_DNase-seq_rep2_50U_ml;_Caenorhabditis_ele...	DNase-seq	DNase-seq	wild-type N2|L3 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085405	SRA704563	wt_L3_DNase-seq_rep2_100U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L3_DNase-seq_rep2_100U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L3 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085406	SRA704563	wt_L3_DNase-seq_rep2_200U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L3_DNase-seq_rep2_200U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L3 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085407	SRA704563	wt_L3_DNase-seq_rep2_400U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L3_DNase-seq_rep2_400U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L3 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085408	SRA704563	wt_L3_DNase-seq_rep2_800U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L3_DNase-seq_rep2_800U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L3 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085409	SRA704563	wt_L4_DNase-seq_rep1_2.5U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L4_DNase-seq_rep1_2.5U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L4 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085410	SRA704563	wt_L4_DNase-seq_rep1_5U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L4_DNase-seq_rep1_5U_ml;_Caenorhabditis_eleg...	DNase-seq	DNase-seq	wild-type N2|L4 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085411	SRA704563	wt_L4_DNase-seq_rep1_10U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L4_DNase-seq_rep1_10U_ml;_Caenorhabditis_ele...	DNase-seq	DNase-seq	wild-type N2|L4 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085412	SRA704563	wt_L4_DNase-seq_rep1_25U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L4_DNase-seq_rep1_25U_ml;_Caenorhabditis_ele...	DNase-seq	DNase-seq	wild-type N2|L4 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085413	SRA704563	wt_L4_DNase-seq_rep1_50U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L4_DNase-seq_rep1_50U_ml;_Caenorhabditis_ele...	DNase-seq	DNase-seq	wild-type N2|L4 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085414	SRA704563	wt_L4_DNase-seq_rep1_100U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L4_DNase-seq_rep1_100U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L4 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085415	SRA704563	wt_L4_DNase-seq_rep1_200U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L4_DNase-seq_rep1_200U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L4 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085416	SRA704563	wt_L4_DNase-seq_rep1_400U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L4_DNase-seq_rep1_400U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L4 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085417	SRA704563	wt_L4_DNase-seq_rep1_800U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L4_DNase-seq_rep1_800U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L4 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085418	SRA704563	wt_L4_DNase-seq_rep2_2.5U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L4_DNase-seq_rep2_2.5U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L4 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085419	SRA704563	wt_L4_DNase-seq_rep2_5U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L4_DNase-seq_rep2_5U_ml;_Caenorhabditis_eleg...	DNase-seq	DNase-seq	wild-type N2|L4 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085420	SRA704563	wt_L4_DNase-seq_rep2_10U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L4_DNase-seq_rep2_10U_ml;_Caenorhabditis_ele...	DNase-seq	DNase-seq	wild-type N2|L4 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085421	SRA704563	wt_L4_DNase-seq_rep2_25U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L4_DNase-seq_rep2_25U_ml;_Caenorhabditis_ele...	DNase-seq	DNase-seq	wild-type N2|L4 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085422	SRA704563	wt_L4_DNase-seq_rep2_50U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L4_DNase-seq_rep2_50U_ml;_Caenorhabditis_ele...	DNase-seq	DNase-seq	wild-type N2|L4 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085423	SRA704563	wt_L4_DNase-seq_rep2_100U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L4_DNase-seq_rep2_100U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L4 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085424	SRA704563	wt_L4_DNase-seq_rep2_200U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L4_DNase-seq_rep2_200U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L4 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085425	SRA704563	wt_L4_DNase-seq_rep2_400U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L4_DNase-seq_rep2_400U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L4 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085426	SRA704563	wt_L4_DNase-seq_rep2_800U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_L4_DNase-seq_rep2_800U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|L4 larvae	wild-type N2	DNase-Hypersensitivity
SRX4085427	SRA704563	wt_YA_DNase-seq_rep1_2.5U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_YA_DNase-seq_rep1_2.5U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|young adults	wild-type N2	DNase-Hypersensitivity
SRX4085428	SRA704563	wt_YA_DNase-seq_rep1_10U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_YA_DNase-seq_rep1_10U_ml;_Caenorhabditis_ele...	DNase-seq	DNase-seq	wild-type N2|young adults	wild-type N2	DNase-Hypersensitivity
SRX4085429	SRA704563	wt_YA_DNase-seq_rep1_25U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_YA_DNase-seq_rep1_25U_ml;_Caenorhabditis_ele...	DNase-seq	DNase-seq	wild-type N2|young adults	wild-type N2	DNase-Hypersensitivity
SRX4085430	SRA704563	wt_YA_DNase-seq_rep1_50U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_YA_DNase-seq_rep1_50U_ml;_Caenorhabditis_ele...	DNase-seq	DNase-seq	wild-type N2|young adults	wild-type N2	DNase-Hypersensitivity
SRX4085431	SRA704563	wt_YA_DNase-seq_rep1_100U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_YA_DNase-seq_rep1_100U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|young adults	wild-type N2	DNase-Hypersensitivity
SRX4085432	SRA704563	wt_YA_DNase-seq_rep1_200U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_YA_DNase-seq_rep1_200U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|young adults	wild-type N2	DNase-Hypersensitivity
SRX4085433	SRA704563	wt_YA_DNase-seq_rep1_400U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_YA_DNase-seq_rep1_400U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|young adults	wild-type N2	DNase-Hypersensitivity
SRX4085434	SRA704563	wt_YA_DNase-seq_rep1_800U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_YA_DNase-seq_rep1_800U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|young adults	wild-type N2	DNase-Hypersensitivity
SRX4085435	SRA704563	wt_YA_DNase-seq_rep2_2.5U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_YA_DNase-seq_rep2_2.5U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|young adults	wild-type N2	DNase-Hypersensitivity
SRX4085436	SRA704563	wt_YA_DNase-seq_rep2_5U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_YA_DNase-seq_rep2_5U_ml;_Caenorhabditis_eleg...	DNase-seq	DNase-seq	wild-type N2|young adults	wild-type N2	DNase-Hypersensitivity
SRX4085437	SRA704563	wt_YA_DNase-seq_rep2_10U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_YA_DNase-seq_rep2_10U_ml;_Caenorhabditis_ele...	DNase-seq	DNase-seq	wild-type N2|young adults	wild-type N2	DNase-Hypersensitivity
SRX4085438	SRA704563	wt_YA_DNase-seq_rep2_25U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_YA_DNase-seq_rep2_25U_ml;_Caenorhabditis_ele...	DNase-seq	DNase-seq	wild-type N2|young adults	wild-type N2	DNase-Hypersensitivity
SRX4085439	SRA704563	wt_YA_DNase-seq_rep2_50U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_YA_DNase-seq_rep2_50U_ml;_Caenorhabditis_ele...	DNase-seq	DNase-seq	wild-type N2|young adults	wild-type N2	DNase-Hypersensitivity
SRX4085440	SRA704563	wt_YA_DNase-seq_rep2_100U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_YA_DNase-seq_rep2_100U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|young adults	wild-type N2	DNase-Hypersensitivity
SRX4085441	SRA704563	wt_YA_DNase-seq_rep2_200U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_YA_DNase-seq_rep2_200U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|young adults	wild-type N2	DNase-Hypersensitivity
SRX4085442	SRA704563	wt_YA_DNase-seq_rep2_400U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_YA_DNase-seq_rep2_400U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|young adults	wild-type N2	DNase-Hypersensitivity
SRX4085443	SRA704563	wt_YA_DNase-seq_rep2_800U_ml;_Caenorhabditis_elegans;_DNase-Hypersensitivity	wt_YA_DNase-seq_rep2_800U_ml;_Caenorhabditis_el...	DNase-seq	DNase-seq	wild-type N2|young adults	wild-type N2	DNase-Hypersensitivity
SRX4107862	SRA708121	ChIP-seq_of_H3K4me3_in_wild-type,_replicate_1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_H3K4me3_in_wild-type,_replicate_1;_...	anti-H3K4me3|Mixed Embryos	anti-H3K4me3	N2|Mixed Embryos|whole larvae|MxE	N2	ChIP-Seq
SRX4107863	SRA708121	ChIP-seq_of_H3K4me3_in_wild-type,_replicate_2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_H3K4me3_in_wild-type,_replicate_2;_...	anti-H3K4me3|Mixed Embryos	anti-H3K4me3	N2|Mixed Embryos|whole larvae|MxE	N2	ChIP-Seq
SRX4107864	SRA708121	ChIP-seq_of_H3K4me3_in_cfp-1,_replicate_1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_H3K4me3_in_cfp-1,_replicate_1;_Caen...	anti-H3K4me3|Mixed Embryos	anti-H3K4me3	cfp-1(tm6369)|Mixed Embryos|whole larvae|MxE	cfp-1(tm6369)	ChIP-Seq
SRX4107865	SRA708121	ChIP-seq_of_H3K4me3_in_cfp-1,_replicate_2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_H3K4me3_in_cfp-1,_replicate_2;_Caen...	anti-H3K4me3|Mixed Embryos	anti-H3K4me3	cfp-1(tm6369)|Mixed Embryos|whole larvae|MxE	cfp-1(tm6369)	ChIP-Seq
SRX4107866	SRA708121	ChIP-seq_of_H3K4me3_in_set-2,_replicate_1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_H3K4me3_in_set-2,_replicate_1;_Caen...	anti-H3K4me3|Mixed Embryos	anti-H3K4me3	set-2(bn129)|Mixed Embryos|whole larvae|MxE	set-2(bn129)	ChIP-Seq
SRX4107867	SRA708121	ChIP-seq_of_H3K4me3_in_set-2,_replicate_2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_H3K4me3_in_set-2,_replicate_2;_Caen...	anti-H3K4me3|Mixed Embryos	anti-H3K4me3	set-2(bn129)|Mixed Embryos|whole larvae|MxE	set-2(bn129)	ChIP-Seq
SRX4107868	SRA708121	ChIP-seq_of_SIN-3_in_wild-type,_replicate_1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_SIN-3_in_wild-type,_replicate_1;_Ca...	anti-SIN3|Mixed Embryos	anti-SIN3	N2|Mixed Embryos|whole larvae|MxE	N2	ChIP-Seq
SRX4107869	SRA708121	ChIP-seq_of_SIN-3_in_wild-type,_replicate_2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_SIN-3_in_wild-type,_replicate_2;_Ca...	anti-SIN3|Mixed Embryos	anti-SIN3	N2|Mixed Embryos|whole larvae|MxE	N2	ChIP-Seq
SRX4107870	SRA708121	ChIP-seq_of_SIN-3_in_cfp-1,_replicate_1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_SIN-3_in_cfp-1,_replicate_1;_Caenor...	anti-SIN3|Mixed Embryos	anti-SIN3	cfp-1(tm6369)|Mixed Embryos|whole larvae|MxE	cfp-1(tm6369)	ChIP-Seq
SRX4107871	SRA708121	ChIP-seq_of_SIN-3_in_cfp-1,_replicate_2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_SIN-3_in_cfp-1,_replicate_2;_Caenor...	anti-SIN3|Mixed Embryos	anti-SIN3	cfp-1(tm6369)|Mixed Embryos|whole larvae|MxE	cfp-1(tm6369)	ChIP-Seq
SRX4107872	SRA708121	ChIP-seq_of_HDA-1_in_wild-type,_replicate_1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_HDA-1_in_wild-type,_replicate_1;_Ca...	anti-HDA1|Mixed Embryos	anti-HDA1	N2|Mixed Embryos|whole larvae|MxE	N2	ChIP-Seq
SRX4107873	SRA708121	ChIP-seq_of_HDA-1_in_wild-type,_replicate_2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_HDA-1_in_wild-type,_replicate_2;_Ca...	anti-HDA1|Mixed Embryos	anti-HDA1	N2|Mixed Embryos|whole larvae|MxE	N2	ChIP-Seq
SRX4107874	SRA708121	ChIP-seq_of_HDA-1_in_cfp-1,_replicate_1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_HDA-1_in_cfp-1,_replicate_1;_Caenor...	anti-HDA1|Mixed Embryos	anti-HDA1	cfp-1(tm6369)|Mixed Embryos|whole larvae|MxE	cfp-1(tm6369)	ChIP-Seq
SRX4107875	SRA708121	ChIP-seq_of_HDA-1_in_cfp-1,_replicate_2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_HDA-1_in_cfp-1,_replicate_2;_Caenor...	anti-HDA1|Mixed Embryos	anti-HDA1	cfp-1(tm6369)|Mixed Embryos|whole larvae|MxE	cfp-1(tm6369)	ChIP-Seq
SRX4107876	SRA708121	ChIP-seq_of_SIN-3_in_wild-type,_replicate_1_1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_SIN-3_in_wild-type,_replicate_1_1;_...	anti-SIN3|Mixed Embryos	anti-SIN3	N2|Mixed Embryos|whole larvae|MxE	N2	ChIP-Seq
SRX4107877	SRA708121	ChIP-seq_of_SIN-3_in_wild-type,_replicate_2_1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_SIN-3_in_wild-type,_replicate_2_1;_...	anti-SIN3|Mixed Embryos	anti-SIN3	N2|Mixed Embryos|whole larvae|MxE	N2	ChIP-Seq
SRX4194184	SRA719392	N2_H3K9me3_ChIPseq_rep_1;_Caenorhabditis_elegans;_ChIP-Seq	N2_H3K9me3_ChIPseq_rep_1;_Caenorhabditis_elegan...	H3K9me3(Abcam, ab8898)|L3 larvae	H3K9me3(Abcam, ab8898)	N2 (Bristol)|L3 larvae	N2 (Bristol)	ChIP-Seq
SRX4194185	SRA719392	N2_H3K9me3_ChIPseq_rep_2;_Caenorhabditis_elegans;_ChIP-Seq	N2_H3K9me3_ChIPseq_rep_2;_Caenorhabditis_elegan...	H3K9me3(Abcam, ab8898)|L3 larvae	H3K9me3(Abcam, ab8898)	N2 (Bristol)|L3 larvae	N2 (Bristol)	ChIP-Seq
SRX4194186	SRA719392	WM193_H3K9me3_ChIPseq_rep_1;_Caenorhabditis_elegans;_ChIP-Seq	WM193_H3K9me3_ChIPseq_rep_1;_Caenorhabditis_ele...	H3K9me3(Abcam, ab8898)|L3 larvae	H3K9me3(Abcam, ab8898)	WM193 (csr-1, partial lof)|L3 larvae	WM193 (csr-1, partial ...	ChIP-Seq
SRX4194188	SRA719392	WM193_H3K9me3_ChIPseq_rep_2;_Caenorhabditis_elegans;_ChIP-Seq	WM193_H3K9me3_ChIPseq_rep_2;_Caenorhabditis_ele...	H3K9me3(Abcam, ab8898)|L3 larvae	H3K9me3(Abcam, ab8898)	WM193 (csr-1, partial lof)|L3 larvae	WM193 (csr-1, partial ...	ChIP-Seq
SRX4194190	SRA719392	drh-3_H3K9me3_ChIPseq_rep_1;_Caenorhabditis_elegans;_ChIP-Seq	drh-3_H3K9me3_ChIPseq_rep_1;_Caenorhabditis_ele...	H3K9me3(Abcam, ab8898)|L3 larvae	H3K9me3(Abcam, ab8898)	drh-3(ne4253)|L3 larvae	drh-3(ne4253)	ChIP-Seq
SRX4194191	SRA719392	drh-3_H3K9me3_ChIPseq_rep_2;_Caenorhabditis_elegans;_ChIP-Seq	drh-3_H3K9me3_ChIPseq_rep_2;_Caenorhabditis_ele...	H3K9me3(Abcam, ab8898)|L3 larvae	H3K9me3(Abcam, ab8898)	drh-3(ne4253)|L3 larvae	drh-3(ne4253)	ChIP-Seq
SRX4194193	SRA719392	N2_H3K27me3_ChIPseq_rep_1;_Caenorhabditis_elegans;_ChIP-Seq	N2_H3K27me3_ChIPseq_rep_1;_Caenorhabditis_elega...	H3K27me3 (Diagenode,195-050)|L3 larvae	H3K27me3 (Diagenode,19...	N2 (Bristol)|L3 larvae	N2 (Bristol)	ChIP-Seq
SRX4194194	SRA719392	N2_H3K27me3_ChIPseq_rep_2;_Caenorhabditis_elegans;_ChIP-Seq	N2_H3K27me3_ChIPseq_rep_2;_Caenorhabditis_elega...	H3K27me3 (Diagenode,195-050)|L3 larvae	H3K27me3 (Diagenode,19...	N2 (Bristol)|L3 larvae	N2 (Bristol)	ChIP-Seq
SRX4194196	SRA719392	WM193_H3K27me3_ChIPseq_rep_1;_Caenorhabditis_elegans;_ChIP-Seq	WM193_H3K27me3_ChIPseq_rep_1;_Caenorhabditis_el...	H3K27me3 (Diagenode,195-050)|L3 larvae	H3K27me3 (Diagenode,19...	WM193 (csr-1, partial lof)|L3 larvae	WM193 (csr-1, partial ...	ChIP-Seq
SRX4194197	SRA719392	WM193_H3K27me3_ChIPseq_rep_2;_Caenorhabditis_elegans;_ChIP-Seq	WM193_H3K27me3_ChIPseq_rep_2;_Caenorhabditis_el...	H3K27me3 (Diagenode,195-050)|L3 larvae	H3K27me3 (Diagenode,19...	WM193 (csr-1, partial lof)|L3 larvae	WM193 (csr-1, partial ...	ChIP-Seq
SRX4194198	SRA719392	drh-3_H3K27me3_ChIPseq_rep_1;_Caenorhabditis_elegans;_ChIP-Seq	drh-3_H3K27me3_ChIPseq_rep_1;_Caenorhabditis_el...	H3K27me3 (Diagenode,195-050)|L3 larvae	H3K27me3 (Diagenode,19...	drh-3(ne4253)|L3 larvae	drh-3(ne4253)	ChIP-Seq
SRX4194199	SRA719392	drh-3_H3K27me3_ChIPseq_rep_2;_Caenorhabditis_elegans;_ChIP-Seq	drh-3_H3K27me3_ChIPseq_rep_2;_Caenorhabditis_el...	H3K27me3 (Diagenode,195-050)|L3 larvae	H3K27me3 (Diagenode,19...	drh-3(ne4253)|L3 larvae	drh-3(ne4253)	ChIP-Seq
SRX4194200	SRA719392	N2_H3K36me3_ChIPseq_rep_1;_Caenorhabditis_elegans;_ChIP-Seq	N2_H3K36me3_ChIPseq_rep_1;_Caenorhabditis_elega...	H3K36me3 (Abcam, ab9050)|L3 larvae	H3K36me3 (Abcam, ab9050)	N2 (Bristol)|L3 larvae	N2 (Bristol)	ChIP-Seq
SRX4194201	SRA719392	N2_H3K36me3_ChIPseq_rep_2;_Caenorhabditis_elegans;_ChIP-Seq	N2_H3K36me3_ChIPseq_rep_2;_Caenorhabditis_elega...	H3K36me3 (Abcam, ab9050)|L3 larvae	H3K36me3 (Abcam, ab9050)	N2 (Bristol)|L3 larvae	N2 (Bristol)	ChIP-Seq
SRX4194202	SRA719392	WM193_H3K36me3_ChIPseq_rep_1;_Caenorhabditis_elegans;_ChIP-Seq	WM193_H3K36me3_ChIPseq_rep_1;_Caenorhabditis_el...	H3K36me3 (Abcam, ab9050)|L3 larvae	H3K36me3 (Abcam, ab9050)	WM193 (csr-1, partial lof)|L3 larvae	WM193 (csr-1, partial ...	ChIP-Seq
SRX4194203	SRA719392	WM193_H3K36me3_ChIPseq_rep_2;_Caenorhabditis_elegans;_ChIP-Seq	WM193_H3K36me3_ChIPseq_rep_2;_Caenorhabditis_el...	H3K36me3 (Abcam, ab9050)|L3 larvae	H3K36me3 (Abcam, ab9050)	WM193 (csr-1, partial lof)|L3 larvae	WM193 (csr-1, partial ...	ChIP-Seq
SRX4194204	SRA719392	drh-3_H3K36me3_ChIPseq_rep_1;_Caenorhabditis_elegans;_ChIP-Seq	drh-3_H3K36me3_ChIPseq_rep_1;_Caenorhabditis_el...	H3K36me3 (Abcam, ab9050)|L3 larvae	H3K36me3 (Abcam, ab9050)	drh-3(ne4253)|L3 larvae	drh-3(ne4253)	ChIP-Seq
SRX4194205	SRA719392	drh-3_H3K36me3_ChIPseq_rep_2;_Caenorhabditis_elegans;_ChIP-Seq	drh-3_H3K36me3_ChIPseq_rep_2;_Caenorhabditis_el...	H3K36me3 (Abcam, ab9050)|L3 larvae	H3K36me3 (Abcam, ab9050)	drh-3(ne4253)|L3 larvae	drh-3(ne4253)	ChIP-Seq
SRX4194207	SRA719392	N2_input_rep_1;_Caenorhabditis_elegans;_ChIP-Seq	N2_input_rep_1;_Caenorhabditis_elegans;_ChIP-Seq	no antibody|L3 larvae	no antibody	N2 (Bristol)|L3 larvae	N2 (Bristol)	ChIP-Seq
SRX4194208	SRA719392	N2_input_rep_2;_Caenorhabditis_elegans;_ChIP-Seq	N2_input_rep_2;_Caenorhabditis_elegans;_ChIP-Seq	no antibody|L3 larvae	no antibody	N2 (Bristol)|L3 larvae	N2 (Bristol)	ChIP-Seq
SRX4194209	SRA719392	WM193_input_rep_1;_Caenorhabditis_elegans;_ChIP-Seq	WM193_input_rep_1;_Caenorhabditis_elegans;_ChIP...	no antibody|L3 larvae	no antibody	WM193 (csr-1, partial lof)|L3 larvae	WM193 (csr-1, partial ...	ChIP-Seq
SRX4194210	SRA719392	WM193_input_rep_2;_Caenorhabditis_elegans;_ChIP-Seq	WM193_input_rep_2;_Caenorhabditis_elegans;_ChIP...	no antibody|L3 larvae	no antibody	WM193 (csr-1, partial lof)|L3 larvae	WM193 (csr-1, partial ...	ChIP-Seq
SRX4194211	SRA719392	drh-3_input_rep_1;_Caenorhabditis_elegans;_ChIP-Seq	drh-3_input_rep_1;_Caenorhabditis_elegans;_ChIP...	no antibody|L3 larvae	no antibody	drh-3(ne4253)|L3 larvae	drh-3(ne4253)	ChIP-Seq
SRX4194212	SRA719392	drh-3_input_rep_2;_Caenorhabditis_elegans;_ChIP-Seq	drh-3_input_rep_2;_Caenorhabditis_elegans;_ChIP...	no antibody|L3 larvae	no antibody	drh-3(ne4253)|L3 larvae	drh-3(ne4253)	ChIP-Seq
SRX4200528	SRA720731	H3K27me3_oocyte_ChIP,_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me3_oocyte_ChIP,_rep1;_Caenorhabditis_eleg...	H3K27me3 (Kimura MAB 1E7/CMA323, now marketed as Wako MABI0323 #309-95259)|Ovulated but unfertilized oocytes collected from feminized worms	H3K27me3 (Kimura MAB 1...	Ovulated but unfertilized oocytes collected from feminized worms	Ovulated but unfertili...	ChIP-Seq
SRX4200529	SRA720731	H3K27me3_oocyte_ChIP,_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me3_oocyte_ChIP,_rep2;_Caenorhabditis_eleg...	H3K27me3 (Kimura MAB 1E7/CMA323, now marketed as Wako MABI0323 #309-95259)|Ovulated but unfertilized oocytes collected from feminized worms	H3K27me3 (Kimura MAB 1...	Ovulated but unfertilized oocytes collected from feminized worms	Ovulated but unfertili...	ChIP-Seq
SRX4200530	SRA720731	H3K27me3_sperm_ChIP,_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me3_sperm_ChIP,_rep1;_Caenorhabditis_elega...	H3K27me3 (Kimura MAB 1E7/CMA323, now marketed as Wako MABI0323 #309-95259)|Mature sperm isolated from adult males	H3K27me3 (Kimura MAB 1...	Mature sperm isolated from adult males	Mature sperm isolated ...	ChIP-Seq
SRX4200531	SRA720731	H3K27me3_sperm_ChIP,_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me3_sperm_ChIP,_rep2;_Caenorhabditis_elega...	H3K27me3 (Kimura MAB 1E7/CMA323, now marketed as Wako MABI0323 #309-95259)|Mature sperm isolated from adult males	H3K27me3 (Kimura MAB 1...	Mature sperm isolated from adult males	Mature sperm isolated ...	ChIP-Seq
SRX4200532	SRA720731	H3K36me3_oocyte_ChIP,_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_oocyte_ChIP,_rep1;_Caenorhabditis_eleg...	H3K36me3 (Kimura MAB 13C9/CMA333, now marketed as Wako MABI0333 #300-95289)|Ovulated but unfertilized oocytes collected from feminized worms	H3K36me3 (Kimura MAB 1...	Ovulated but unfertilized oocytes collected from feminized worms	Ovulated but unfertili...	ChIP-Seq
SRX4200533	SRA720731	H3K36me3_oocyte_ChIP,_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_oocyte_ChIP,_rep2;_Caenorhabditis_eleg...	H3K36me3 (Kimura MAB 13C9/CMA333, now marketed as Wako MABI0333 #300-95289)|Ovulated but unfertilized oocytes collected from feminized worms	H3K36me3 (Kimura MAB 1...	Ovulated but unfertilized oocytes collected from feminized worms	Ovulated but unfertili...	ChIP-Seq
SRX4200534	SRA720731	H3K36me3_sperm_ChIP,_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_sperm_ChIP,_rep1;_Caenorhabditis_elega...	H3K36me3 (Kimura MAB 13C9/CMA333, now marketed as Wako MABI0333 #300-95289)|Mature sperm isolated from adult males	H3K36me3 (Kimura MAB 1...	Mature sperm isolated from adult males	Mature sperm isolated ...	ChIP-Seq
SRX4200535	SRA720731	H3K36me3_sperm_ChIP,_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_sperm_ChIP,_rep2;_Caenorhabditis_elega...	H3K36me3 (Kimura MAB 13C9/CMA333, now marketed as Wako MABI0333 #300-95289)|Mature sperm isolated from adult males	H3K36me3 (Kimura MAB 1...	Mature sperm isolated from adult males	Mature sperm isolated ...	ChIP-Seq
SRX4200536	SRA720731	H3K4me3_early_embryo_ChIP,_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_early_embryo_ChIP,_rep2;_Caenorhabditis...	H3K4me3 (Wako, MABI0304, #305-34819)|Mixed stage early embryos	H3K4me3 (Wako, MABI030...	Mixed stage early embryos	Mixed stage early embryos	ChIP-Seq
SRX4200537	SRA720731	H3K4me3_oocyte_ChIP,_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_oocyte_ChIP,_rep1;_Caenorhabditis_elega...	H3K4me3 (Wako, MABI0304, #305-34819)|Ovulated but unfertilized oocytes collected from feminized worms	H3K4me3 (Wako, MABI030...	Ovulated but unfertilized oocytes collected from feminized worms	Ovulated but unfertili...	ChIP-Seq
SRX4200538	SRA720731	H3K4me3_oocyte_ChIP,_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_oocyte_ChIP,_rep2;_Caenorhabditis_elega...	H3K4me3 (Wako, MABI0304, #305-34819)|Ovulated but unfertilized oocytes collected from feminized worms	H3K4me3 (Wako, MABI030...	Ovulated but unfertilized oocytes collected from feminized worms	Ovulated but unfertili...	ChIP-Seq
SRX4200539	SRA720731	H3K4me3_sperm_ChIP,_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_sperm_ChIP,_rep1;_Caenorhabditis_elegan...	H3K4me3 (Wako, MABI0304, #305-34819)|Mature sperm isolated from adult males	H3K4me3 (Wako, MABI030...	Mature sperm isolated from adult males	Mature sperm isolated ...	ChIP-Seq
SRX4200540	SRA720731	H3K4me3_sperm_ChIP,_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_sperm_ChIP,_rep2;_Caenorhabditis_elegan...	H3K4me3 (Wako, MABI0304, #305-34819)|Mature sperm isolated from adult males	H3K4me3 (Wako, MABI030...	Mature sperm isolated from adult males	Mature sperm isolated ...	ChIP-Seq
SRX4200541	SRA720731	Early_embryo_input,_rep1;_Caenorhabditis_elegans;_ChIP-Seq	Early_embryo_input,_rep1;_Caenorhabditis_elegan...	none|Mixed stage early embryos	none	Mixed stage early embryos	Mixed stage early embryos	ChIP-Seq
SRX4200542	SRA720731	Early_embryo_input,_rep2;_Caenorhabditis_elegans;_ChIP-Seq	Early_embryo_input,_rep2;_Caenorhabditis_elegan...	none|Mixed stage early embryos	none	Mixed stage early embryos	Mixed stage early embryos	ChIP-Seq
SRX4200543	SRA720731	Oocyte_input,_rep1;_Caenorhabditis_elegans;_ChIP-Seq	Oocyte_input,_rep1;_Caenorhabditis_elegans;_ChI...	none|Ovulated but unfertilized oocytes collected from feminized worms	none	Ovulated but unfertilized oocytes collected from feminized worms	Ovulated but unfertili...	ChIP-Seq
SRX4200544	SRA720731	Oocyte_input,_rep2;_Caenorhabditis_elegans;_ChIP-Seq	Oocyte_input,_rep2;_Caenorhabditis_elegans;_ChI...	none|Ovulated but unfertilized oocytes collected from feminized worms	none	Ovulated but unfertilized oocytes collected from feminized worms	Ovulated but unfertili...	ChIP-Seq
SRX4200545	SRA720731	Sperm_input,_rep1;_Caenorhabditis_elegans;_ChIP-Seq	Sperm_input,_rep1;_Caenorhabditis_elegans;_ChIP...	none|Mature sperm isolated from adult males	none	Mature sperm isolated from adult males	Mature sperm isolated ...	ChIP-Seq
SRX4200546	SRA720731	Sperm_input,_rep2;_Caenorhabditis_elegans;_ChIP-Seq	Sperm_input,_rep2;_Caenorhabditis_elegans;_ChIP...	none|Mature sperm isolated from adult males	none	Mature sperm isolated from adult males	Mature sperm isolated ...	ChIP-Seq
SRX4344417	SRA734017	daf-2;_DAF-16::GFP_ChIP-SEQ_replicate_IP_2	daf-2;_DAF-16::GFP_ChIP-SEQ_replicate_IP_2	NoAb	ND	RIE470_4|whole animal	RIE470_4	ChIP-Seq
SRX4344426	SRA734017	daf-2;_DAF-16::GFP_ChIP-SEQ_replicate_IP_1	daf-2;_DAF-16::GFP_ChIP-SEQ_replicate_IP_1	NoAb	ND	RIE470_2|whole animal	RIE470_2	ChIP-Seq
SRX4344456	SRA734017	daf-2;_HLH-30::GFP_ChIP-SEQ_replicate_IP_1	daf-2;_HLH-30::GFP_ChIP-SEQ_replicate_IP_1	NoAb	ND	RIE328_2|whole animal	RIE328_2	ChIP-Seq
SRX4344458	SRA734017	daf-2;_HLH-30::GFP_ChIP-SEQ_replicate_IP_2	daf-2;_HLH-30::GFP_ChIP-SEQ_replicate_IP_2	NoAb	ND	RIE328_4|whole animal	RIE328_4	ChIP-Seq
SRX4344460	SRA734017	daf-2;_hlh-30;_DAF-16::GFP_ChIP-SEQ_IP	daf-2;_hlh-30;_DAF-16::GFP_ChIP-SEQ_IP	NoAb	ND	RIE531_2|whole animal	RIE531_2	ChIP-Seq
SRX4419807	SRA743893	N2_H3K27me3_ChIP_input;_Caenorhabditis_elegans;_ChIP-Seq	N2_H3K27me3_ChIP_input;_Caenorhabditis_elegans;...	none|Adult total nuclei (enriched for germ cell nuclei)	none	N2|Adult total nuclei (enriched for germ cell nuclei)|adult	N2	ChIP-Seq
SRX4419808	SRA743893	N2_H3K27me3_ChIP_IP_rep1;_Caenorhabditis_elegans;_ChIP-Seq	N2_H3K27me3_ChIP_IP_rep1;_Caenorhabditis_elegan...	H3K27me3me3 (Active Motif #39535)|Adult total nuclei (enriched for germ cell nuclei)	H3K27me3me3 (Active Mo...	N2|Adult total nuclei (enriched for germ cell nuclei)|adult	N2	ChIP-Seq
SRX4419809	SRA743893	FAS58_H3K27me3_ChIP_input;_Caenorhabditis_elegans;_ChIP-Seq	FAS58_H3K27me3_ChIP_input;_Caenorhabditis_elega...	none|Adult total nuclei (enriched for germ cell nuclei)	none	FAS58|Adult total nuclei (enriched for germ cell nuclei)|adult	FAS58	ChIP-Seq
SRX4419810	SRA743893	FAS58_H3K27me3_ChIP_IP;_Caenorhabditis_elegans;_ChIP-Seq	FAS58_H3K27me3_ChIP_IP;_Caenorhabditis_elegans;...	H3K27me3me3 (Active Motif #39535)|Adult total nuclei (enriched for germ cell nuclei)	H3K27me3me3 (Active Mo...	FAS58|Adult total nuclei (enriched for germ cell nuclei)|adult	FAS58	ChIP-Seq
SRX4419811	SRA743893	FAS107_H3.3_OLLAS_ChIP_input;_Caenorhabditis_elegans;_ChIP-Seq	FAS107_H3.3_OLLAS_ChIP_input;_Caenorhabditis_el...	none|Adult total nuclei (enriched for germ cell nuclei)	none	FAS107|Adult total nuclei (enriched for germ cell nuclei)|adult	FAS107	ChIP-Seq
SRX4419812	SRA743893	FAS107_H3.3_OLLAS_ChIP_IP;_Caenorhabditis_elegans;_ChIP-Seq	FAS107_H3.3_OLLAS_ChIP_IP;_Caenorhabditis_elega...	OLLAS (Novus Biologicals #NBP1-06713B)|Adult total nuclei (enriched for germ cell nuclei)	OLLAS (Novus Biologica...	FAS107|Adult total nuclei (enriched for germ cell nuclei)|adult	FAS107	ChIP-Seq
SRX4419813	SRA743893	FAS119_H3.3K27M_OLLAS_ChIP_input;_Caenorhabditis_elegans;_ChIP-Seq	FAS119_H3.3K27M_OLLAS_ChIP_input;_Caenorhabditi...	none|Adult total nuclei (enriched for germ cell nuclei)	none	FAS119|Adult total nuclei (enriched for germ cell nuclei)|adult	FAS119	ChIP-Seq
SRX4419814	SRA743893	FAS119_H3.3K27M_OLLAS_ChIP_IP;_Caenorhabditis_elegans;_ChIP-Seq	FAS119_H3.3K27M_OLLAS_ChIP_IP;_Caenorhabditis_e...	OLLAS (Novus Biologicals #NBP1-06713B)|Adult total nuclei (enriched for germ cell nuclei)	OLLAS (Novus Biologica...	FAS119|Adult total nuclei (enriched for germ cell nuclei)|adult	FAS119	ChIP-Seq
SRX4419817	SRA743893	N2_H3K36me3_ChIP_input;_Caenorhabditis_elegans;_ChIP-Seq	N2_H3K36me3_ChIP_input;_Caenorhabditis_elegans;...	none|Adult total nuclei (enriched for germ cell nuclei)	none	N2|Adult total nuclei (enriched for germ cell nuclei)|adult	N2	ChIP-Seq
SRX4419818	SRA743893	N2_H3K36me3_ChIP_IP;_Caenorhabditis_elegans;_ChIP-Seq	N2_H3K36me3_ChIP_IP;_Caenorhabditis_elegans;_Ch...	H3K36me3 (Abcam #ab9050)|Adult total nuclei (enriched for germ cell nuclei)	H3K36me3 (Abcam #ab9050)	N2|Adult total nuclei (enriched for germ cell nuclei)|adult	N2	ChIP-Seq
SRX4419819	SRA743893	FAS58_H3K36me3_ChIP_input;_Caenorhabditis_elegans;_ChIP-Seq	FAS58_H3K36me3_ChIP_input;_Caenorhabditis_elega...	none|Adult total nuclei (enriched for germ cell nuclei)	none	FAS58|Adult total nuclei (enriched for germ cell nuclei)|adult	FAS58	ChIP-Seq
SRX4419820	SRA743893	FAS58_H3K36me3_ChIP_IP;_Caenorhabditis_elegans;_ChIP-Seq	FAS58_H3K36me3_ChIP_IP;_Caenorhabditis_elegans;...	H3K36me3 (Abcam #ab9050)|Adult total nuclei (enriched for germ cell nuclei)	H3K36me3 (Abcam #ab9050)	FAS58|Adult total nuclei (enriched for germ cell nuclei)|adult	FAS58	ChIP-Seq
SRX4419821	SRA743893	FAS100_H3K27me3_ChIP_input;_Caenorhabditis_elegans;_ChIP-Seq	FAS100_H3K27me3_ChIP_input;_Caenorhabditis_eleg...	none|Adult total nuclei (enriched for germ cell nuclei)	none	FAS100|Adult total nuclei (enriched for germ cell nuclei)|adult	FAS100	ChIP-Seq
SRX4419822	SRA743893	FAS100_H3K27me3_ChIP_IP;_Caenorhabditis_elegans;_ChIP-Seq	FAS100_H3K27me3_ChIP_IP;_Caenorhabditis_elegans...	H3K27me3me3 (Active Motif #39535)|Adult total nuclei (enriched for germ cell nuclei)	H3K27me3me3 (Active Mo...	FAS100|Adult total nuclei (enriched for germ cell nuclei)|adult	FAS100	ChIP-Seq
SRX4419823	SRA743893	FAS104_H3K27me3_ChIP_input;_Caenorhabditis_elegans;_ChIP-Seq	FAS104_H3K27me3_ChIP_input;_Caenorhabditis_eleg...	none|Adult total nuclei (enriched for germ cell nuclei)	none	FAS104|Adult total nuclei (enriched for germ cell nuclei)|adult	FAS104	ChIP-Seq
SRX4419824	SRA743893	FAS104_H3K27me3_ChIP_IP;_Caenorhabditis_elegans;_ChIP-Seq	FAS104_H3K27me3_ChIP_IP;_Caenorhabditis_elegans...	H3K27me3me3 (Active Motif #39535)|Adult total nuclei (enriched for germ cell nuclei)	H3K27me3me3 (Active Mo...	FAS104|Adult total nuclei (enriched for germ cell nuclei)|adult	FAS104	ChIP-Seq
SRX4419827	SRA743893	CGC42_H3K27me3_ChIP_input;_Caenorhabditis_elegans;_ChIP-Seq	CGC42_H3K27me3_ChIP_input;_Caenorhabditis_elega...	none|Adult total nuclei (enriched for germ cell nuclei)	none	CGC42|Adult total nuclei (enriched for germ cell nuclei)|adult	CGC42	ChIP-Seq
SRX4419828	SRA743893	CGC42_H3K27me3_ChIP_IP;_Caenorhabditis_elegans;_ChIP-Seq	CGC42_H3K27me3_ChIP_IP;_Caenorhabditis_elegans;...	H3K27me3me3 (Active Motif #39535)|Adult total nuclei (enriched for germ cell nuclei)	H3K27me3me3 (Active Mo...	CGC42|Adult total nuclei (enriched for germ cell nuclei)|adult	CGC42	ChIP-Seq
SRX4419829	SRA743893	FAS93_H3K27me3_ChIP_input;_Caenorhabditis_elegans;_ChIP-Seq	FAS93_H3K27me3_ChIP_input;_Caenorhabditis_elega...	none|Adult total nuclei (enriched for germ cell nuclei)	none	FAS93|Adult total nuclei (enriched for germ cell nuclei)|adult	FAS93	ChIP-Seq
SRX4419830	SRA743893	FAS93_H3K27me3_ChIP_IP;_Caenorhabditis_elegans;_ChIP-Seq	FAS93_H3K27me3_ChIP_IP;_Caenorhabditis_elegans;...	H3K27me3me3 (Active Motif #39535)|Adult total nuclei (enriched for germ cell nuclei)	H3K27me3me3 (Active Mo...	FAS93|Adult total nuclei (enriched for germ cell nuclei)|adult	FAS93	ChIP-Seq
SRX4456922	SRA744715	N2_ChIP-Seq_1;_Caenorhabditis_elegans;_ChIP-Seq	N2_ChIP-Seq_1;_Caenorhabditis_elegans;_ChIP-Seq	C. elegans young adults	C. elegans young adults	C. elegans young adults|young adult	C. elegans young adults	ChIP-Seq
SRX4456923	SRA744715	hrde-1_(tm1200)_mutant_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	hrde-1_(tm1200)_mutant_ChIP-Seq;_Caenorhabditis...	C. elegans young adults	C. elegans young adults	C. elegans young adults|young adult	C. elegans young adults	ChIP-Seq
SRX4456924	SRA744715	set-32(red11)_mutant_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	set-32(red11)_mutant_ChIP-Seq;_Caenorhabditis_e...	C. elegans young adults	C. elegans young adults	C. elegans young adults|young adult	C. elegans young adults	ChIP-Seq
SRX4456925	SRA744715	met-2(n4256)_set-25(n5021)_mutant_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	met-2(n4256)_set-25(n5021)_mutant_ChIP-Seq;_Cae...	C. elegans young adults	C. elegans young adults	C. elegans young adults|young adult	C. elegans young adults	ChIP-Seq
SRX4456926	SRA744715	set-32(red11);_met-2(n4256)_set-25(n5021)_mutant_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	set-32(red11);_met-2(n4256)_set-25(n5021)_mutan...	C. elegans young adults	C. elegans young adults	C. elegans young adults|young adult	C. elegans young adults	ChIP-Seq
SRX4456927	SRA744715	set-32(red11);_hrde-1(tm1200)_mutant_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	set-32(red11);_hrde-1(tm1200)_mutant_ChIP-Seq;_...	C. elegans young adults	C. elegans young adults	C. elegans young adults|young adult	C. elegans young adults	ChIP-Seq
SRX4456928	SRA744715	met-2(n4256)_set-25(n5021)_hrde-1(tm1200)_mutant_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	met-2(n4256)_set-25(n5021)_hrde-1(tm1200)_mutan...	C. elegans young adults	C. elegans young adults	C. elegans young adults|young adult	C. elegans young adults	ChIP-Seq
SRX4456929	SRA744715	set-32(red11);__met-2(n4256)_set-25(n5021)_hrde-1(tm1200)_mutant__ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	set-32(red11);__met-2(n4256)_set-25(n5021)_hrde...	C. elegans young adults	C. elegans young adults	C. elegans young adults|young adult	C. elegans young adults	ChIP-Seq
SRX4456930	SRA744715	N2_ChIP-Seq_2;_Caenorhabditis_elegans;_ChIP-Seq	N2_ChIP-Seq_2;_Caenorhabditis_elegans;_ChIP-Seq	C. elegans young adults	C. elegans young adults	C. elegans young adults|young adult	C. elegans young adults	ChIP-Seq
SRX4456931	SRA744715	N2,_oma-1_RNAi_for_one_generation_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	N2,_oma-1_RNAi_for_one_generation_ChIP-Seq;_Cae...	C. elegans young adults	C. elegans young adults	C. elegans young adults|young adult	C. elegans young adults	ChIP-Seq
SRX4456932	SRA744715	N2,_oma-1_RNAi_for_two_generations_ChIP-Seq;_Caenorhabditis_elegans;_ChIP-Seq	N2,_oma-1_RNAi_for_two_generations_ChIP-Seq;_Ca...	C. elegans young adults	C. elegans young adults	C. elegans young adults|young adult	C. elegans young adults	ChIP-Seq
SRX4626826	SRA764883	N2_PA14_1;_Caenorhabditis_elegans;_ChIP-Seq	N2_PA14_1;_Caenorhabditis_elegans;_ChIP-Seq	Ab290 (ChIP-grade polyclonal antibody from Abcam)|whole animal	Ab290 (ChIP-grade poly...	whole animal|whole animal	whole animal	ChIP-Seq
SRX4626827	SRA764883	N2_PA14_2;_Caenorhabditis_elegans;_ChIP-Seq	N2_PA14_2;_Caenorhabditis_elegans;_ChIP-Seq	Ab290 (ChIP-grade polyclonal antibody from Abcam)|whole animal	Ab290 (ChIP-grade poly...	whole animal|whole animal	whole animal	ChIP-Seq
SRX4626828	SRA764883	N2_PA14_3;_Caenorhabditis_elegans;_ChIP-Seq	N2_PA14_3;_Caenorhabditis_elegans;_ChIP-Seq	Ab290 (ChIP-grade polyclonal antibody from Abcam)|whole animal	Ab290 (ChIP-grade poly...	whole animal|whole animal	whole animal	ChIP-Seq
SRX4626829	SRA764883	qd328_OP50_1;_Caenorhabditis_elegans;_ChIP-Seq	qd328_OP50_1;_Caenorhabditis_elegans;_ChIP-Seq	Ab290 (ChIP-grade polyclonal antibody from Abcam)|whole animal	Ab290 (ChIP-grade poly...	whole animal|whole animal	whole animal	ChIP-Seq
SRX4626830	SRA764883	qd328_OP50_2;_Caenorhabditis_elegans;_ChIP-Seq	qd328_OP50_2;_Caenorhabditis_elegans;_ChIP-Seq	Ab290 (ChIP-grade polyclonal antibody from Abcam)|whole animal	Ab290 (ChIP-grade poly...	whole animal|whole animal	whole animal	ChIP-Seq
SRX4626831	SRA764883	qd328_OP50_3;_Caenorhabditis_elegans;_ChIP-Seq	qd328_OP50_3;_Caenorhabditis_elegans;_ChIP-Seq	Ab290 (ChIP-grade polyclonal antibody from Abcam)|whole animal	Ab290 (ChIP-grade poly...	whole animal|whole animal	whole animal	ChIP-Seq
SRX4626832	SRA764883	qd328_PA14_1;_Caenorhabditis_elegans;_ChIP-Seq	qd328_PA14_1;_Caenorhabditis_elegans;_ChIP-Seq	Ab290 (ChIP-grade polyclonal antibody from Abcam)|whole animal	Ab290 (ChIP-grade poly...	whole animal|whole animal	whole animal	ChIP-Seq
SRX4626833	SRA764883	qd328_PA14_2;_Caenorhabditis_elegans;_ChIP-Seq	qd328_PA14_2;_Caenorhabditis_elegans;_ChIP-Seq	Ab290 (ChIP-grade polyclonal antibody from Abcam)|whole animal	Ab290 (ChIP-grade poly...	whole animal|whole animal	whole animal	ChIP-Seq
SRX4626834	SRA764883	qd328_pmk1_OP50_1;_Caenorhabditis_elegans;_ChIP-Seq	qd328_pmk1_OP50_1;_Caenorhabditis_elegans;_ChIP...	Ab290 (ChIP-grade polyclonal antibody from Abcam)|whole animal	Ab290 (ChIP-grade poly...	whole animal|whole animal	whole animal	ChIP-Seq
SRX4626835	SRA764883	qd328_pmk1_OP50_2;_Caenorhabditis_elegans;_ChIP-Seq	qd328_pmk1_OP50_2;_Caenorhabditis_elegans;_ChIP...	Ab290 (ChIP-grade polyclonal antibody from Abcam)|whole animal	Ab290 (ChIP-grade poly...	whole animal|whole animal	whole animal	ChIP-Seq
SRX4626836	SRA764883	qd328_pmk1_OP50_3;_Caenorhabditis_elegans;_ChIP-Seq	qd328_pmk1_OP50_3;_Caenorhabditis_elegans;_ChIP...	Ab290 (ChIP-grade polyclonal antibody from Abcam)|whole animal	Ab290 (ChIP-grade poly...	whole animal|whole animal	whole animal	ChIP-Seq
SRX4626837	SRA764883	qd328_pmk1_PA14_1;_Caenorhabditis_elegans;_ChIP-Seq	qd328_pmk1_PA14_1;_Caenorhabditis_elegans;_ChIP...	Ab290 (ChIP-grade polyclonal antibody from Abcam)|whole animal	Ab290 (ChIP-grade poly...	whole animal|whole animal	whole animal	ChIP-Seq
SRX4626838	SRA764883	qd328_pmk1_PA14_2;_Caenorhabditis_elegans;_ChIP-Seq	qd328_pmk1_PA14_2;_Caenorhabditis_elegans;_ChIP...	Ab290 (ChIP-grade polyclonal antibody from Abcam)|whole animal	Ab290 (ChIP-grade poly...	whole animal|whole animal	whole animal	ChIP-Seq
SRX4626839	SRA764883	qd328_pmk1_PA14_3;_Caenorhabditis_elegans;_ChIP-Seq	qd328_pmk1_PA14_3;_Caenorhabditis_elegans;_ChIP...	Ab290 (ChIP-grade polyclonal antibody from Abcam)|whole animal	Ab290 (ChIP-grade poly...	whole animal|whole animal	whole animal	ChIP-Seq
SRX463080	SRA135921	seq-JA00001_HTZ1_N2_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-JA00001_HTZ1_N2_L3_Input_Rep1;_Caenorhabdit...	seq-JA00001_HTZ1_N2_L3_Input_Rep1	seq-JA00001_HTZ1_N2_L3...	N2|seq-JA00001_HTZ1_N2_L3_Input_Rep1|L3 Larva	N2	ChIP-Seq
SRX463081	SRA135921	seq-JA00001_HTZ1_N2_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-JA00001_HTZ1_N2_L3_Input_Rep2;_Caenorhabdit...	seq-JA00001_HTZ1_N2_L3_Input_Rep2	seq-JA00001_HTZ1_N2_L3...	N2|seq-JA00001_HTZ1_N2_L3_Input_Rep2|L3 Larva	N2	ChIP-Seq
SRX463082	SRA135921	seq-JA00001_HTZ1_N2_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-JA00001_HTZ1_N2_L3_ChIP_Rep1;_Caenorhabditi...	seq-JA00001_HTZ1_N2_L3_ChIP_Rep1	seq-JA00001_HTZ1_N2_L3...	N2|seq-JA00001_HTZ1_N2_L3_ChIP_Rep1|L3 Larva	N2	ChIP-Seq
SRX463083	SRA135921	seq-JA00001_HTZ1_N2_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-JA00001_HTZ1_N2_L3_ChIP_Rep2;_Caenorhabditi...	seq-JA00001_HTZ1_N2_L3_ChIP_Rep2	seq-JA00001_HTZ1_N2_L3...	N2|seq-JA00001_HTZ1_N2_L3_ChIP_Rep2|L3 Larva	N2	ChIP-Seq
SRX466455	SRA137491	seq-AB2621_H3K79me3:361576_N2_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-AB2621_H3K79me3:361576_N2_L3_Input_Rep1;_Ca...	seq-AB2621_H3K79me3:361576_N2_L3_Input_Rep1	seq-AB2621_H3K79me3:36...	N2|seq-AB2621_H3K79me3:361576_N2_L3_Input_Rep1|L3 Larva	N2	ChIP-Seq
SRX466456	SRA137491	seq-AB2621_H3K79me3:361576_N2_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-AB2621_H3K79me3:361576_N2_L3_Input_Rep2;_Ca...	seq-AB2621_H3K79me3:361576_N2_L3_Input_Rep2	seq-AB2621_H3K79me3:36...	N2|seq-AB2621_H3K79me3:361576_N2_L3_Input_Rep2|L3 Larva	N2	ChIP-Seq
SRX466457	SRA137491	seq-AB2621_H3K79me3:361576_N2_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-AB2621_H3K79me3:361576_N2_L3_ChIP_Rep1;_Cae...	seq-AB2621_H3K79me3:361576_N2_L3_ChIP_Rep1	seq-AB2621_H3K79me3:36...	N2|seq-AB2621_H3K79me3:361576_N2_L3_ChIP_Rep1|L3 Larva	N2	ChIP-Seq
SRX466458	SRA137491	seq-AB2621_H3K79me3:361576_N2_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-AB2621_H3K79me3:361576_N2_L3_ChIP_Rep2;_Cae...	seq-AB2621_H3K79me3:361576_N2_L3_ChIP_Rep2	seq-AB2621_H3K79me3:36...	N2|seq-AB2621_H3K79me3:361576_N2_L3_ChIP_Rep2|L3 Larva	N2	ChIP-Seq
SRX466459	SRA137492	seq-AB8898_H3K9me3:33990_N2_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-AB8898_H3K9me3:33990_N2_L3_Input_Rep1;_Caen...	seq-AB8898_H3K9me3:33990_N2_L3_Input_Rep1	seq-AB8898_H3K9me3:339...	N2|seq-AB8898_H3K9me3:33990_N2_L3_Input_Rep1|L3 Larva	N2	ChIP-Seq
SRX466460	SRA137492	seq-AB8898_H3K9me3:33990_N2_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-AB8898_H3K9me3:33990_N2_L3_Input_Rep2;_Caen...	seq-AB8898_H3K9me3:33990_N2_L3_Input_Rep2	seq-AB8898_H3K9me3:339...	N2|seq-AB8898_H3K9me3:33990_N2_L3_Input_Rep2|L3 Larva	N2	ChIP-Seq
SRX466461	SRA137492	seq-AB8898_H3K9me3:33990_N2_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-AB8898_H3K9me3:33990_N2_L3_ChIP_Rep1;_Caeno...	seq-AB8898_H3K9me3:33990_N2_L3_ChIP_Rep1	seq-AB8898_H3K9me3:339...	N2|seq-AB8898_H3K9me3:33990_N2_L3_ChIP_Rep1|L3 Larva	N2	ChIP-Seq
SRX466462	SRA137492	seq-AB8898_H3K9me3:33990_N2_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-AB8898_H3K9me3:33990_N2_L3_ChIP_Rep2;_Caeno...	seq-AB8898_H3K9me3:33990_N2_L3_ChIP_Rep2	seq-AB8898_H3K9me3:339...	N2|seq-AB8898_H3K9me3:33990_N2_L3_ChIP_Rep2|L3 Larva	N2	ChIP-Seq
SRX466463	SRA137493	seq-HK00009_H3K9me3:2F3_N2_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00009_H3K9me3:2F3_N2_L3_Input_Rep1;_Caeno...	seq-HK00009_H3K9me3:2F3_N2_L3_Input_Rep1	seq-HK00009_H3K9me3:2F...	N2|seq-HK00009_H3K9me3:2F3_N2_L3_Input_Rep1|L3 Larva	N2	ChIP-Seq
SRX466464	SRA137493	seq-HK00009_H3K9me3:2F3_N2_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00009_H3K9me3:2F3_N2_L3_Input_Rep2;_Caeno...	seq-HK00009_H3K9me3:2F3_N2_L3_Input_Rep2	seq-HK00009_H3K9me3:2F...	N2|seq-HK00009_H3K9me3:2F3_N2_L3_Input_Rep2|L3 Larva	N2	ChIP-Seq
SRX466465	SRA137493	seq-HK00009_H3K9me3:2F3_N2_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00009_H3K9me3:2F3_N2_L3_ChIP_Rep1;_Caenor...	seq-HK00009_H3K9me3:2F3_N2_L3_ChIP_Rep1	seq-HK00009_H3K9me3:2F...	N2|seq-HK00009_H3K9me3:2F3_N2_L3_ChIP_Rep1|L3 Larva	N2	ChIP-Seq
SRX466466	SRA137493	seq-HK00009_H3K9me3:2F3_N2_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00009_H3K9me3:2F3_N2_L3_ChIP_Rep2;_Caenor...	seq-HK00009_H3K9me3:2F3_N2_L3_ChIP_Rep2	seq-HK00009_H3K9me3:2F...	N2|seq-HK00009_H3K9me3:2F3_N2_L3_ChIP_Rep2|L3 Larva	N2	ChIP-Seq
SRX466467	SRA137494	seq-HK00012_H3K36me2:2C3_N2_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00012_H3K36me2:2C3_N2_L3_Input_Rep1;_Caen...	seq-HK00012_H3K36me2:2C3_N2_L3_Input_Rep1	seq-HK00012_H3K36me2:2...	N2|seq-HK00012_H3K36me2:2C3_N2_L3_Input_Rep1|L3 Larva	N2	ChIP-Seq
SRX466468	SRA137494	seq-HK00012_H3K36me2:2C3_N2_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00012_H3K36me2:2C3_N2_L3_Input_Rep2;_Caen...	seq-HK00012_H3K36me2:2C3_N2_L3_Input_Rep2	seq-HK00012_H3K36me2:2...	N2|seq-HK00012_H3K36me2:2C3_N2_L3_Input_Rep2|L3 Larva	N2	ChIP-Seq
SRX466469	SRA137494	seq-HK00012_H3K36me2:2C3_N2_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00012_H3K36me2:2C3_N2_L3_ChIP_Rep1;_Caeno...	seq-HK00012_H3K36me2:2C3_N2_L3_ChIP_Rep1	seq-HK00012_H3K36me2:2...	N2|seq-HK00012_H3K36me2:2C3_N2_L3_ChIP_Rep1|L3 Larva	N2	ChIP-Seq
SRX466470	SRA137494	seq-HK00012_H3K36me2:2C3_N2_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00012_H3K36me2:2C3_N2_L3_ChIP_Rep2;_Caeno...	seq-HK00012_H3K36me2:2C3_N2_L3_ChIP_Rep2	seq-HK00012_H3K36me2:2...	N2|seq-HK00012_H3K36me2:2C3_N2_L3_ChIP_Rep2|L3 Larva	N2	ChIP-Seq
SRX466471	SRA137495	seq-NB211254_H3K36ac_N2_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-NB211254_H3K36ac_N2_L3_Input_Rep1;_Caenorha...	seq-NB211254_H3K36ac_N2_L3_Input_Rep1	seq-NB211254_H3K36ac_N...	N2|seq-NB211254_H3K36ac_N2_L3_Input_Rep1|L3 Larva	N2	ChIP-Seq
SRX466472	SRA137495	seq-NB211254_H3K36ac_N2_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-NB211254_H3K36ac_N2_L3_Input_Rep2;_Caenorha...	seq-NB211254_H3K36ac_N2_L3_Input_Rep2	seq-NB211254_H3K36ac_N...	N2|seq-NB211254_H3K36ac_N2_L3_Input_Rep2|L3 Larva	N2	ChIP-Seq
SRX466473	SRA137495	seq-NB211254_H3K36ac_N2_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-NB211254_H3K36ac_N2_L3_ChIP_Rep1;_Caenorhab...	seq-NB211254_H3K36ac_N2_L3_ChIP_Rep1	seq-NB211254_H3K36ac_N...	N2|seq-NB211254_H3K36ac_N2_L3_ChIP_Rep1|L3 Larva	N2	ChIP-Seq
SRX466474	SRA137495	seq-NB211254_H3K36ac_N2_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-NB211254_H3K36ac_N2_L3_ChIP_Rep2;_Caenorhab...	seq-NB211254_H3K36ac_N2_L3_ChIP_Rep2	seq-NB211254_H3K36ac_N...	N2|seq-NB211254_H3K36ac_N2_L3_ChIP_Rep2|L3 Larva	N2	ChIP-Seq
SRX466475	SRA137496	seq-UP07448_H3K27me1:24439_N2_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-UP07448_H3K27me1:24439_N2_L3_Input_Rep1;_Ca...	seq-UP07448_H3K27me1:24439_N2_L3_Input_Rep1	seq-UP07448_H3K27me1:2...	N2|seq-UP07448_H3K27me1:24439_N2_L3_Input_Rep1|L3 Larva	N2	ChIP-Seq
SRX466476	SRA137496	seq-UP07448_H3K27me1:24439_N2_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-UP07448_H3K27me1:24439_N2_L3_Input_Rep2;_Ca...	seq-UP07448_H3K27me1:24439_N2_L3_Input_Rep2	seq-UP07448_H3K27me1:2...	N2|seq-UP07448_H3K27me1:24439_N2_L3_Input_Rep2|L3 Larva	N2	ChIP-Seq
SRX466477	SRA137496	seq-UP07448_H3K27me1:24439_N2_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-UP07448_H3K27me1:24439_N2_L3_ChIP_Rep1;_Cae...	seq-UP07448_H3K27me1:24439_N2_L3_ChIP_Rep1	seq-UP07448_H3K27me1:2...	N2|seq-UP07448_H3K27me1:24439_N2_L3_ChIP_Rep1|L3 Larva	N2	ChIP-Seq
SRX466478	SRA137496	seq-UP07448_H3K27me1:24439_N2_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-UP07448_H3K27me1:24439_N2_L3_ChIP_Rep2;_Cae...	seq-UP07448_H3K27me1:24439_N2_L3_ChIP_Rep2	seq-UP07448_H3K27me1:2...	N2|seq-UP07448_H3K27me1:24439_N2_L3_ChIP_Rep2|L3 Larva	N2	ChIP-Seq
SRX466479	SRA137497	seq-UP07449_H3K27me3:24440_N2_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-UP07449_H3K27me3:24440_N2_L3_Input_Rep1;_Ca...	seq-UP07449_H3K27me3:24440_N2_L3_Input_Rep1	seq-UP07449_H3K27me3:2...	N2|seq-UP07449_H3K27me3:24440_N2_L3_Input_Rep1|L3 Larva	N2	ChIP-Seq
SRX466480	SRA137497	seq-UP07449_H3K27me3:24440_N2_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-UP07449_H3K27me3:24440_N2_L3_Input_Rep2;_Ca...	seq-UP07449_H3K27me3:24440_N2_L3_Input_Rep2	seq-UP07449_H3K27me3:2...	N2|seq-UP07449_H3K27me3:24440_N2_L3_Input_Rep2|L3 Larva	N2	ChIP-Seq
SRX466481	SRA137497	seq-UP07449_H3K27me3:24440_N2_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-UP07449_H3K27me3:24440_N2_L3_ChIP_Rep1;_Cae...	seq-UP07449_H3K27me3:24440_N2_L3_ChIP_Rep1	seq-UP07449_H3K27me3:2...	N2|seq-UP07449_H3K27me3:24440_N2_L3_ChIP_Rep1|L3 Larva	N2	ChIP-Seq
SRX466482	SRA137497	seq-UP07449_H3K27me3:24440_N2_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-UP07449_H3K27me3:24440_N2_L3_ChIP_Rep2;_Cae...	seq-UP07449_H3K27me3:24440_N2_L3_ChIP_Rep2	seq-UP07449_H3K27me3:2...	N2|seq-UP07449_H3K27me3:24440_N2_L3_ChIP_Rep2|L3 Larva	N2	ChIP-Seq
SRX466483	SRA137498	seq-AB1191_H3K18ac_GR311521_N2_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-AB1191_H3K18ac_GR311521_N2_L3_Input_Rep1;_C...	seq-AB1191_H3K18ac_GR311521_N2_L3_Input_Rep1	seq-AB1191_H3K18ac_GR3...	N2|seq-AB1191_H3K18ac_GR311521_N2_L3_Input_Rep1|L3 Larva	N2	ChIP-Seq
SRX466484	SRA137498	seq-AB1191_H3K18ac_GR311521_N2_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-AB1191_H3K18ac_GR311521_N2_L3_Input_Rep2;_C...	seq-AB1191_H3K18ac_GR311521_N2_L3_Input_Rep2	seq-AB1191_H3K18ac_GR3...	N2|seq-AB1191_H3K18ac_GR311521_N2_L3_Input_Rep2|L3 Larva	N2	ChIP-Seq
SRX466485	SRA137498	seq-AB1191_H3K18ac_GR311521_N2_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-AB1191_H3K18ac_GR311521_N2_L3_ChIP_Rep1;_Ca...	seq-AB1191_H3K18ac_GR311521_N2_L3_ChIP_Rep1	seq-AB1191_H3K18ac_GR3...	N2|seq-AB1191_H3K18ac_GR311521_N2_L3_ChIP_Rep1|L3 Larva	N2	ChIP-Seq
SRX466486	SRA137498	seq-AB1191_H3K18ac_GR311521_N2_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-AB1191_H3K18ac_GR311521_N2_L3_ChIP_Rep2;_Ca...	seq-AB1191_H3K18ac_GR311521_N2_L3_ChIP_Rep2	seq-AB1191_H3K18ac_GR3...	N2|seq-AB1191_H3K18ac_GR311521_N2_L3_ChIP_Rep2|L3 Larva	N2	ChIP-Seq
SRX466487	SRA137499	seq-AB3594_H3K79me2:346021_N2_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-AB3594_H3K79me2:346021_N2_L3_Input_Rep1;_Ca...	seq-AB3594_H3K79me2:346021_N2_L3_Input_Rep1	seq-AB3594_H3K79me2:34...	N2|seq-AB3594_H3K79me2:346021_N2_L3_Input_Rep1|L3 Larva	N2	ChIP-Seq
SRX466488	SRA137499	seq-AB3594_H3K79me2:346021_N2_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-AB3594_H3K79me2:346021_N2_L3_Input_Rep2;_Ca...	seq-AB3594_H3K79me2:346021_N2_L3_Input_Rep2	seq-AB3594_H3K79me2:34...	N2|seq-AB3594_H3K79me2:346021_N2_L3_Input_Rep2|L3 Larva	N2	ChIP-Seq
SRX466489	SRA137499	seq-AB3594_H3K79me2:346021_N2_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-AB3594_H3K79me2:346021_N2_L3_ChIP_Rep1;_Cae...	seq-AB3594_H3K79me2:346021_N2_L3_ChIP_Rep1	seq-AB3594_H3K79me2:34...	N2|seq-AB3594_H3K79me2:346021_N2_L3_ChIP_Rep1|L3 Larva	N2	ChIP-Seq
SRX466490	SRA137499	seq-AB3594_H3K79me2:346021_N2_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-AB3594_H3K79me2:346021_N2_L3_ChIP_Rep2;_Cae...	seq-AB3594_H3K79me2:346021_N2_L3_ChIP_Rep2	seq-AB3594_H3K79me2:34...	N2|seq-AB3594_H3K79me2:346021_N2_L3_ChIP_Rep2|L3 Larva	N2	ChIP-Seq
SRX466491	SRA137500	seq-ab9048_H3K36me1:206009_N2_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab9048_H3K36me1:206009_N2_L3_Input_Rep1;_Ca...	seq-ab9048_H3K36me1:206009_N2_L3_Input_Rep1	seq-ab9048_H3K36me1:20...	N2|seq-ab9048_H3K36me1:206009_N2_L3_Input_Rep1|L3 Larva	N2	ChIP-Seq
SRX466492	SRA137500	seq-ab9048_H3K36me1:206009_N2_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab9048_H3K36me1:206009_N2_L3_Input_Rep2;_Ca...	seq-ab9048_H3K36me1:206009_N2_L3_Input_Rep2	seq-ab9048_H3K36me1:20...	N2|seq-ab9048_H3K36me1:206009_N2_L3_Input_Rep2|L3 Larva	N2	ChIP-Seq
SRX466493	SRA137500	seq-ab9048_H3K36me1:206009_N2_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab9048_H3K36me1:206009_N2_L3_ChIP_Rep1;_Cae...	seq-ab9048_H3K36me1:206009_N2_L3_ChIP_Rep1	seq-ab9048_H3K36me1:20...	N2|seq-ab9048_H3K36me1:206009_N2_L3_ChIP_Rep1|L3 Larva	N2	ChIP-Seq
SRX466494	SRA137500	seq-ab9048_H3K36me1:206009_N2_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab9048_H3K36me1:206009_N2_L3_ChIP_Rep2;_Cae...	seq-ab9048_H3K36me1:206009_N2_L3_ChIP_Rep2	seq-ab9048_H3K36me1:20...	N2|seq-ab9048_H3K36me1:206009_N2_L3_ChIP_Rep2|L3 Larva	N2	ChIP-Seq
SRX466495	SRA137501	seq-HK00008_H3K9me2:6D11_N2_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00008_H3K9me2:6D11_N2_L3_Input_Rep1;_Caen...	seq-HK00008_H3K9me2:6D11_N2_L3_Input_Rep1	seq-HK00008_H3K9me2:6D...	N2|seq-HK00008_H3K9me2:6D11_N2_L3_Input_Rep1|L3 Larva	N2	ChIP-Seq
SRX466496	SRA137501	seq-HK00008_H3K9me2:6D11_N2_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00008_H3K9me2:6D11_N2_L3_Input_Rep2;_Caen...	seq-HK00008_H3K9me2:6D11_N2_L3_Input_Rep2	seq-HK00008_H3K9me2:6D...	N2|seq-HK00008_H3K9me2:6D11_N2_L3_Input_Rep2|L3 Larva	N2	ChIP-Seq
SRX466497	SRA137501	seq-HK00008_H3K9me2:6D11_N2_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00008_H3K9me2:6D11_N2_L3_ChIP_Rep1;_Caeno...	seq-HK00008_H3K9me2:6D11_N2_L3_ChIP_Rep1	seq-HK00008_H3K9me2:6D...	N2|seq-HK00008_H3K9me2:6D11_N2_L3_ChIP_Rep1|L3 Larva	N2	ChIP-Seq
SRX466498	SRA137501	seq-HK00008_H3K9me2:6D11_N2_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00008_H3K9me2:6D11_N2_L3_ChIP_Rep2;_Caeno...	seq-HK00008_H3K9me2:6D11_N2_L3_ChIP_Rep2	seq-HK00008_H3K9me2:6D...	N2|seq-HK00008_H3K9me2:6D11_N2_L3_ChIP_Rep2|L3 Larva	N2	ChIP-Seq
SRX466499	SRA137502	seq-ab12181_H3K9acS10ph_873968_N2_Eemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab12181_H3K9acS10ph_873968_N2_Eemb_Input_Re...	seq-ab12181_H3K9acS10ph_873968_N2_Eemb_Input_Rep1	seq-ab12181_H3K9acS10p...	N2|seq-ab12181_H3K9acS10ph_873968_N2_Eemb_Input_Rep1|Early Embryo	N2	ChIP-Seq
SRX466500	SRA137502	seq-ab12181_H3K9acS10ph_873968_N2_Eemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab12181_H3K9acS10ph_873968_N2_Eemb_Input_Re...	seq-ab12181_H3K9acS10ph_873968_N2_Eemb_Input_Rep2	seq-ab12181_H3K9acS10p...	N2|seq-ab12181_H3K9acS10ph_873968_N2_Eemb_Input_Rep2|Early Embryo	N2	ChIP-Seq
SRX466501	SRA137502	seq-ab12181_H3K9acS10ph_873968_N2_Eemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab12181_H3K9acS10ph_873968_N2_Eemb_ChIP_Rep...	seq-ab12181_H3K9acS10ph_873968_N2_Eemb_ChIP_Rep1	seq-ab12181_H3K9acS10p...	N2|seq-ab12181_H3K9acS10ph_873968_N2_Eemb_ChIP_Rep1|Early Embryo	N2	ChIP-Seq
SRX466502	SRA137502	seq-ab12181_H3K9acS10ph_873968_N2_Eemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab12181_H3K9acS10ph_873968_N2_Eemb_ChIP_Rep...	seq-ab12181_H3K9acS10ph_873968_N2_Eemb_ChIP_Rep2	seq-ab12181_H3K9acS10p...	N2|seq-ab12181_H3K9acS10ph_873968_N2_Eemb_ChIP_Rep2|Early Embryo	N2	ChIP-Seq
SRX466503	SRA137503	seq-MP07355_H3K23ac_27133_N2_Eemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-MP07355_H3K23ac_27133_N2_Eemb_Input_Rep1;_C...	seq-MP07355_H3K23ac_27133_N2_Eemb_Input_Rep1	seq-MP07355_H3K23ac_27...	N2|seq-MP07355_H3K23ac_27133_N2_Eemb_Input_Rep1|Early Embryo	N2	ChIP-Seq
SRX466504	SRA137503	seq-MP07355_H3K23ac_27133_N2_Eemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-MP07355_H3K23ac_27133_N2_Eemb_Input_Rep2;_C...	seq-MP07355_H3K23ac_27133_N2_Eemb_Input_Rep2	seq-MP07355_H3K23ac_27...	N2|seq-MP07355_H3K23ac_27133_N2_Eemb_Input_Rep2|Early Embryo	N2	ChIP-Seq
SRX466505	SRA137503	seq-MP07355_H3K23ac_27133_N2_Eemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-MP07355_H3K23ac_27133_N2_Eemb_ChIP_Rep1;_Ca...	seq-MP07355_H3K23ac_27133_N2_Eemb_ChIP_Rep1	seq-MP07355_H3K23ac_27...	N2|seq-MP07355_H3K23ac_27133_N2_Eemb_ChIP_Rep1|Early Embryo	N2	ChIP-Seq
SRX466516	SRA137506	seq-WA30834809_H3K4me2_8002_N2_Eemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-WA30834809_H3K4me2_8002_N2_Eemb_Input_Rep2;...	seq-WA30834809_H3K4me2_8002_N2_Eemb_Input_Rep2	seq-WA30834809_H3K4me2...	N2|seq-WA30834809_H3K4me2_8002_N2_Eemb_Input_Rep2|Early Embryo	N2	ChIP-Seq
SRX466517	SRA137506	seq-WA30834809_H3K4me2_8002_N2_Eemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-WA30834809_H3K4me2_8002_N2_Eemb_ChIP_Rep1;_...	seq-WA30834809_H3K4me2_8002_N2_Eemb_ChIP_Rep1	seq-WA30834809_H3K4me2...	N2|seq-WA30834809_H3K4me2_8002_N2_Eemb_ChIP_Rep1|Early Embryo	N2	ChIP-Seq
SRX466518	SRA137506	seq-WA30834809_H3K4me2_8002_N2_Eemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-WA30834809_H3K4me2_8002_N2_Eemb_ChIP_Rep2;_...	seq-WA30834809_H3K4me2_8002_N2_Eemb_ChIP_Rep2	seq-WA30834809_H3K4me2...	N2|seq-WA30834809_H3K4me2_8002_N2_Eemb_ChIP_Rep2|Early Embryo	N2	ChIP-Seq
SRX466519	SRA137507	seq-WA30634849_H3K27ac_8002_N2_Eemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-WA30634849_H3K27ac_8002_N2_Eemb_Input_Rep1;...	seq-WA30634849_H3K27ac_8002_N2_Eemb_Input_Rep1	seq-WA30634849_H3K27ac...	N2|seq-WA30634849_H3K27ac_8002_N2_Eemb_Input_Rep1|Early Embryo	N2	ChIP-Seq
SRX466520	SRA137507	seq-WA30634849_H3K27ac_8002_N2_Eemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-WA30634849_H3K27ac_8002_N2_Eemb_Input_Rep2;...	seq-WA30634849_H3K27ac_8002_N2_Eemb_Input_Rep2	seq-WA30634849_H3K27ac...	N2|seq-WA30634849_H3K27ac_8002_N2_Eemb_Input_Rep2|Early Embryo	N2	ChIP-Seq
SRX466521	SRA137507	seq-WA30634849_H3K27ac_8002_N2_Eemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-WA30634849_H3K27ac_8002_N2_Eemb_ChIP_Rep1;_...	seq-WA30634849_H3K27ac_8002_N2_Eemb_ChIP_Rep1	seq-WA30634849_H3K27ac...	N2|seq-WA30634849_H3K27ac_8002_N2_Eemb_ChIP_Rep1|Early Embryo	N2	ChIP-Seq
SRX466522	SRA137507	seq-WA30634849_H3K27ac_8002_N2_Eemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-WA30634849_H3K27ac_8002_N2_Eemb_ChIP_Rep2;_...	seq-WA30634849_H3K27ac_8002_N2_Eemb_ChIP_Rep2	seq-WA30634849_H3K27ac...	N2|seq-WA30634849_H3K27ac_8002_N2_Eemb_ChIP_Rep2|Early Embryo	N2	ChIP-Seq
SRX466523	SRA137508	seq-UP07448_H3K27me1_24439_N2_Eemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-UP07448_H3K27me1_24439_N2_Eemb_Input_Rep1;_...	seq-UP07448_H3K27me1_24439_N2_Eemb_Input_Rep1	seq-UP07448_H3K27me1_2...	N2|seq-UP07448_H3K27me1_24439_N2_Eemb_Input_Rep1|Early Embryo	N2	ChIP-Seq
SRX466524	SRA137508	seq-UP07448_H3K27me1_24439_N2_Eemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-UP07448_H3K27me1_24439_N2_Eemb_Input_Rep2;_...	seq-UP07448_H3K27me1_24439_N2_Eemb_Input_Rep2	seq-UP07448_H3K27me1_2...	N2|seq-UP07448_H3K27me1_24439_N2_Eemb_Input_Rep2|Early Embryo	N2	ChIP-Seq
SRX466525	SRA137508	seq-UP07448_H3K27me1_24439_N2_Eemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-UP07448_H3K27me1_24439_N2_Eemb_ChIP_Rep1;_C...	seq-UP07448_H3K27me1_24439_N2_Eemb_ChIP_Rep1	seq-UP07448_H3K27me1_2...	N2|seq-UP07448_H3K27me1_24439_N2_Eemb_ChIP_Rep1|Early Embryo	N2	ChIP-Seq
SRX466526	SRA137508	seq-UP07448_H3K27me1_24439_N2_Eemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-UP07448_H3K27me1_24439_N2_Eemb_ChIP_Rep2;_C...	seq-UP07448_H3K27me1_24439_N2_Eemb_ChIP_Rep2	seq-UP07448_H3K27me1_2...	N2|seq-UP07448_H3K27me1_24439_N2_Eemb_ChIP_Rep2|Early Embryo	N2	ChIP-Seq
SRX466527	SRA137509	seq-HK00008_H3K9me2_6D11_N2_Eemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00008_H3K9me2_6D11_N2_Eemb_Input_Rep1;_Ca...	seq-HK00008_H3K9me2_6D11_N2_Eemb_Input_Rep1	seq-HK00008_H3K9me2_6D...	N2|seq-HK00008_H3K9me2_6D11_N2_Eemb_Input_Rep1|Early Embryo	N2	ChIP-Seq
SRX466528	SRA137509	seq-HK00008_H3K9me2_6D11_N2_Eemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00008_H3K9me2_6D11_N2_Eemb_Input_Rep2;_Ca...	seq-HK00008_H3K9me2_6D11_N2_Eemb_Input_Rep2	seq-HK00008_H3K9me2_6D...	N2|seq-HK00008_H3K9me2_6D11_N2_Eemb_Input_Rep2|Early Embryo	N2	ChIP-Seq
SRX466529	SRA137509	seq-HK00008_H3K9me2_6D11_N2_Eemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00008_H3K9me2_6D11_N2_Eemb_ChIP_Rep1;_Cae...	seq-HK00008_H3K9me2_6D11_N2_Eemb_ChIP_Rep1	seq-HK00008_H3K9me2_6D...	N2|seq-HK00008_H3K9me2_6D11_N2_Eemb_ChIP_Rep1|Early Embryo	N2	ChIP-Seq
SRX466530	SRA137509	seq-HK00008_H3K9me2_6D11_N2_Eemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00008_H3K9me2_6D11_N2_Eemb_ChIP_Rep2;_Cae...	seq-HK00008_H3K9me2_6D11_N2_Eemb_ChIP_Rep2	seq-HK00008_H3K9me2_6D...	N2|seq-HK00008_H3K9me2_6D11_N2_Eemb_ChIP_Rep2|Early Embryo	N2	ChIP-Seq
SRX466531	SRA137510	seq-ab15823_H4K8ac_487128_N2_Eemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab15823_H4K8ac_487128_N2_Eemb_Input_Rep1;_C...	seq-ab15823_H4K8ac_487128_N2_Eemb_Input_Rep1	seq-ab15823_H4K8ac_487...	N2|seq-ab15823_H4K8ac_487128_N2_Eemb_Input_Rep1|Early Embryo	N2	ChIP-Seq
SRX466532	SRA137510	seq-ab15823_H4K8ac_487128_N2_Eemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab15823_H4K8ac_487128_N2_Eemb_Input_Rep2;_C...	seq-ab15823_H4K8ac_487128_N2_Eemb_Input_Rep2	seq-ab15823_H4K8ac_487...	N2|seq-ab15823_H4K8ac_487128_N2_Eemb_Input_Rep2|Early Embryo	N2	ChIP-Seq
SRX466533	SRA137510	seq-ab15823_H4K8ac_487128_N2_Eemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab15823_H4K8ac_487128_N2_Eemb_ChIP_Rep1;_Ca...	seq-ab15823_H4K8ac_487128_N2_Eemb_ChIP_Rep1	seq-ab15823_H4K8ac_487...	N2|seq-ab15823_H4K8ac_487128_N2_Eemb_ChIP_Rep1|Early Embryo	N2	ChIP-Seq
SRX466534	SRA137510	seq-ab15823_H4K8ac_487128_N2_Eemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab15823_H4K8ac_487128_N2_Eemb_ChIP_Rep2;_Ca...	seq-ab15823_H4K8ac_487128_N2_Eemb_ChIP_Rep2	seq-ab15823_H4K8ac_487...	N2|seq-ab15823_H4K8ac_487128_N2_Eemb_ChIP_Rep2|Early Embryo	N2	ChIP-Seq
SRX466535	SRA137511	seq-HK00013_H3K27me3_1E7_N2_Eemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00013_H3K27me3_1E7_N2_Eemb_Input_Rep1;_Ca...	seq-HK00013_H3K27me3_1E7_N2_Eemb_Input_Rep1	seq-HK00013_H3K27me3_1...	N2|seq-HK00013_H3K27me3_1E7_N2_Eemb_Input_Rep1|Early Embryo	N2	ChIP-Seq
SRX466536	SRA137511	seq-HK00013_H3K27me3_1E7_N2_Eemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00013_H3K27me3_1E7_N2_Eemb_Input_Rep2;_Ca...	seq-HK00013_H3K27me3_1E7_N2_Eemb_Input_Rep2	seq-HK00013_H3K27me3_1...	N2|seq-HK00013_H3K27me3_1E7_N2_Eemb_Input_Rep2|Early Embryo	N2	ChIP-Seq
SRX466537	SRA137511	seq-HK00013_H3K27me3_1E7_N2_Eemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00013_H3K27me3_1E7_N2_Eemb_ChIP_Rep1;_Cae...	seq-HK00013_H3K27me3_1E7_N2_Eemb_ChIP_Rep1	seq-HK00013_H3K27me3_1...	N2|seq-HK00013_H3K27me3_1E7_N2_Eemb_ChIP_Rep1|Early Embryo	N2	ChIP-Seq
SRX466538	SRA137511	seq-HK00013_H3K27me3_1E7_N2_Eemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00013_H3K27me3_1E7_N2_Eemb_ChIP_Rep2;_Cae...	seq-HK00013_H3K27me3_1E7_N2_Eemb_ChIP_Rep2	seq-HK00013_H3K27me3_1...	N2|seq-HK00013_H3K27me3_1E7_N2_Eemb_ChIP_Rep2|Early Embryo	N2	ChIP-Seq
SRX466539	SRA137512	seq-WA30532379_H3K4me3_10001_N2_Eemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-WA30532379_H3K4me3_10001_N2_Eemb_Input_Rep1...	seq-WA30532379_H3K4me3_10001_N2_Eemb_Input_Rep1	seq-WA30532379_H3K4me3...	N2|seq-WA30532379_H3K4me3_10001_N2_Eemb_Input_Rep1|Early Embryo	N2	ChIP-Seq
SRX466540	SRA137512	seq-WA30532379_H3K4me3_10001_N2_Eemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-WA30532379_H3K4me3_10001_N2_Eemb_Input_Rep2...	seq-WA30532379_H3K4me3_10001_N2_Eemb_Input_Rep2	seq-WA30532379_H3K4me3...	N2|seq-WA30532379_H3K4me3_10001_N2_Eemb_Input_Rep2|Early Embryo	N2	ChIP-Seq
SRX466541	SRA137512	seq-WA30532379_H3K4me3_10001_N2_Eemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-WA30532379_H3K4me3_10001_N2_Eemb_ChIP_Rep1;...	seq-WA30532379_H3K4me3_10001_N2_Eemb_ChIP_Rep1	seq-WA30532379_H3K4me3...	N2|seq-WA30532379_H3K4me3_10001_N2_Eemb_ChIP_Rep1|Early Embryo	N2	ChIP-Seq
SRX466542	SRA137512	seq-WA30532379_H3K4me3_10001_N2_Eemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-WA30532379_H3K4me3_10001_N2_Eemb_ChIP_Rep2;...	seq-WA30532379_H3K4me3_10001_N2_Eemb_ChIP_Rep2	seq-WA30532379_H3K4me3...	N2|seq-WA30532379_H3K4me3_10001_N2_Eemb_ChIP_Rep2|Early Embryo	N2	ChIP-Seq
SRX466543	SRA137513	seq-ab9048_H3K36me1_206009_N2_Eemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab9048_H3K36me1_206009_N2_Eemb_Input_Rep1;_...	seq-ab9048_H3K36me1_206009_N2_Eemb_Input_Rep1	seq-ab9048_H3K36me1_20...	N2|seq-ab9048_H3K36me1_206009_N2_Eemb_Input_Rep1|Early Embryo	N2	ChIP-Seq
SRX466544	SRA137513	seq-ab9048_H3K36me1_206009_N2_Eemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab9048_H3K36me1_206009_N2_Eemb_Input_Rep2;_...	seq-ab9048_H3K36me1_206009_N2_Eemb_Input_Rep2	seq-ab9048_H3K36me1_20...	N2|seq-ab9048_H3K36me1_206009_N2_Eemb_Input_Rep2|Early Embryo	N2	ChIP-Seq
SRX466545	SRA137513	seq-ab9048_H3K36me1_206009_N2_Eemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab9048_H3K36me1_206009_N2_Eemb_ChIP_Rep1;_C...	seq-ab9048_H3K36me1_206009_N2_Eemb_ChIP_Rep1	seq-ab9048_H3K36me1_20...	N2|seq-ab9048_H3K36me1_206009_N2_Eemb_ChIP_Rep1|Early Embryo	N2	ChIP-Seq
SRX466546	SRA137513	seq-ab9048_H3K36me1_206009_N2_Eemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab9048_H3K36me1_206009_N2_Eemb_ChIP_Rep2;_C...	seq-ab9048_H3K36me1_206009_N2_Eemb_ChIP_Rep2	seq-ab9048_H3K36me1_20...	N2|seq-ab9048_H3K36me1_206009_N2_Eemb_ChIP_Rep2|Early Embryo	N2	ChIP-Seq
SRX466547	SRA137514	seq-ab2886_H3K79me1_361912_N2_Eemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab2886_H3K79me1_361912_N2_Eemb_Input_Rep1;_...	seq-ab2886_H3K79me1_361912_N2_Eemb_Input_Rep1	seq-ab2886_H3K79me1_36...	N2|seq-ab2886_H3K79me1_361912_N2_Eemb_Input_Rep1|Early Embryo	N2	ChIP-Seq
SRX466548	SRA137514	seq-ab2886_H3K79me1_361912_N2_Eemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab2886_H3K79me1_361912_N2_Eemb_Input_Rep2;_...	seq-ab2886_H3K79me1_361912_N2_Eemb_Input_Rep2	seq-ab2886_H3K79me1_36...	N2|seq-ab2886_H3K79me1_361912_N2_Eemb_Input_Rep2|Early Embryo	N2	ChIP-Seq
SRX466549	SRA137514	seq-ab2886_H3K79me1_361912_N2_Eemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab2886_H3K79me1_361912_N2_Eemb_ChIP_Rep1;_C...	seq-ab2886_H3K79me1_361912_N2_Eemb_ChIP_Rep1	seq-ab2886_H3K79me1_36...	N2|seq-ab2886_H3K79me1_361912_N2_Eemb_ChIP_Rep1|Early Embryo	N2	ChIP-Seq
SRX466550	SRA137514	seq-ab2886_H3K79me1_361912_N2_Eemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab2886_H3K79me1_361912_N2_Eemb_ChIP_Rep2;_C...	seq-ab2886_H3K79me1_361912_N2_Eemb_ChIP_Rep2	seq-ab2886_H3K79me1_36...	N2|seq-ab2886_H3K79me1_361912_N2_Eemb_ChIP_Rep2|Early Embryo	N2	ChIP-Seq
SRX466551	SRA137516	seq-ab3594_H3K79me2_346021_N2_Eemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab3594_H3K79me2_346021_N2_Eemb_Input_Rep1;_...	seq-ab3594_H3K79me2_346021_N2_Eemb_Input_Rep1	seq-ab3594_H3K79me2_34...	N2|seq-ab3594_H3K79me2_346021_N2_Eemb_Input_Rep1|Early Embryo	N2	ChIP-Seq
SRX466552	SRA137516	seq-ab3594_H3K79me2_346021_N2_Eemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab3594_H3K79me2_346021_N2_Eemb_Input_Rep2;_...	seq-ab3594_H3K79me2_346021_N2_Eemb_Input_Rep2	seq-ab3594_H3K79me2_34...	N2|seq-ab3594_H3K79me2_346021_N2_Eemb_Input_Rep2|Early Embryo	N2	ChIP-Seq
SRX466553	SRA137516	seq-ab3594_H3K79me2_346021_N2_Eemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab3594_H3K79me2_346021_N2_Eemb_ChIP_Rep1;_C...	seq-ab3594_H3K79me2_346021_N2_Eemb_ChIP_Rep1	seq-ab3594_H3K79me2_34...	N2|seq-ab3594_H3K79me2_346021_N2_Eemb_ChIP_Rep1|Early Embryo	N2	ChIP-Seq
SRX466554	SRA137516	seq-ab3594_H3K79me2_346021_N2_Eemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab3594_H3K79me2_346021_N2_Eemb_ChIP_Rep2;_C...	seq-ab3594_H3K79me2_346021_N2_Eemb_ChIP_Rep2	seq-ab3594_H3K79me2_34...	N2|seq-ab3594_H3K79me2_346021_N2_Eemb_ChIP_Rep2|Early Embryo	N2	ChIP-Seq
SRX466555	SRA137517	seq-ab2621_H3K79me3_361576_N2_Eemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab2621_H3K79me3_361576_N2_Eemb_Input_Rep1;_...	seq-ab2621_H3K79me3_361576_N2_Eemb_Input_Rep1	seq-ab2621_H3K79me3_36...	N2|seq-ab2621_H3K79me3_361576_N2_Eemb_Input_Rep1|Early Embryo	N2	ChIP-Seq
SRX466556	SRA137517	seq-ab2621_H3K79me3_361576_N2_Eemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab2621_H3K79me3_361576_N2_Eemb_Input_Rep2;_...	seq-ab2621_H3K79me3_361576_N2_Eemb_Input_Rep2	seq-ab2621_H3K79me3_36...	N2|seq-ab2621_H3K79me3_361576_N2_Eemb_Input_Rep2|Early Embryo	N2	ChIP-Seq
SRX466557	SRA137517	seq-ab2621_H3K79me3_361576_N2_Eemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab2621_H3K79me3_361576_N2_Eemb_ChIP_Rep1;_C...	seq-ab2621_H3K79me3_361576_N2_Eemb_ChIP_Rep1	seq-ab2621_H3K79me3_36...	N2|seq-ab2621_H3K79me3_361576_N2_Eemb_ChIP_Rep1|Early Embryo	N2	ChIP-Seq
SRX466558	SRA137517	seq-ab2621_H3K79me3_361576_N2_Eemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab2621_H3K79me3_361576_N2_Eemb_ChIP_Rep2;_C...	seq-ab2621_H3K79me3_361576_N2_Eemb_ChIP_Rep2	seq-ab2621_H3K79me3_36...	N2|seq-ab2621_H3K79me3_361576_N2_Eemb_ChIP_Rep2|Early Embryo	N2	ChIP-Seq
SRX466559	SRA137518	seq-ab8896_H3K9me1_104560_N2_Eemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab8896_H3K9me1_104560_N2_Eemb_Input_Rep1;_C...	seq-ab8896_H3K9me1_104560_N2_Eemb_Input_Rep1	seq-ab8896_H3K9me1_104...	N2|seq-ab8896_H3K9me1_104560_N2_Eemb_Input_Rep1|Early Embryo	N2	ChIP-Seq
SRX466560	SRA137518	seq-ab8896_H3K9me1_104560_N2_Eemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab8896_H3K9me1_104560_N2_Eemb_Input_Rep2;_C...	seq-ab8896_H3K9me1_104560_N2_Eemb_Input_Rep2	seq-ab8896_H3K9me1_104...	N2|seq-ab8896_H3K9me1_104560_N2_Eemb_Input_Rep2|Early Embryo	N2	ChIP-Seq
SRX466561	SRA137518	seq-ab8896_H3K9me1_104560_N2_Eemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab8896_H3K9me1_104560_N2_Eemb_ChIP_Rep1;_Ca...	seq-ab8896_H3K9me1_104560_N2_Eemb_ChIP_Rep1	seq-ab8896_H3K9me1_104...	N2|seq-ab8896_H3K9me1_104560_N2_Eemb_ChIP_Rep1|Early Embryo	N2	ChIP-Seq
SRX466562	SRA137518	seq-ab8896_H3K9me1_104560_N2_Eemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab8896_H3K9me1_104560_N2_Eemb_ChIP_Rep2;_Ca...	seq-ab8896_H3K9me1_104560_N2_Eemb_ChIP_Rep2	seq-ab8896_H3K9me1_104...	N2|seq-ab8896_H3K9me1_104560_N2_Eemb_ChIP_Rep2|Early Embryo	N2	ChIP-Seq
SRX466563	SRA137519	seq-SDQ0812_COH1_FEM2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ0812_COH1_FEM2_AD_Input_Rep1;_Caenorhabd...	seq-SDQ0812_COH1_FEM2_AD_Input_Rep1	seq-SDQ0812_COH1_FEM2_...	fem-2(b245)|seq-SDQ0812_COH1_FEM2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX466564	SRA137519	seq-SDQ0812_COH1_FEM2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ0812_COH1_FEM2_AD_Input_Rep2;_Caenorhabd...	seq-SDQ0812_COH1_FEM2_AD_Input_Rep2	seq-SDQ0812_COH1_FEM2_...	fem-2(b245)|seq-SDQ0812_COH1_FEM2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX466565	SRA137519	seq-SDQ0812_COH1_FEM2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ0812_COH1_FEM2_AD_ChIP_Rep1;_Caenorhabdi...	seq-SDQ0812_COH1_FEM2_AD_ChIP_Rep1	seq-SDQ0812_COH1_FEM2_...	fem-2(b245)|seq-SDQ0812_COH1_FEM2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX466566	SRA137519	seq-SDQ0812_COH1_FEM2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ0812_COH1_FEM2_AD_ChIP_Rep2;_Caenorhabdi...	seq-SDQ0812_COH1_FEM2_AD_ChIP_Rep2	seq-SDQ0812_COH1_FEM2_...	fem-2(b245)|seq-SDQ0812_COH1_FEM2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX466567	SRA137520	seq-SDQ0821_SCC1_FEM2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ0821_SCC1_FEM2_AD_Input_Rep1;_Caenorhabd...	seq-SDQ0821_SCC1_FEM2_AD_Input_Rep1	seq-SDQ0821_SCC1_FEM2_...	fem-2(b245)|seq-SDQ0821_SCC1_FEM2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX466568	SRA137520	seq-SDQ0821_SCC1_FEM2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ0821_SCC1_FEM2_AD_ChIP_Rep1;_Caenorhabdi...	seq-SDQ0821_SCC1_FEM2_AD_ChIP_Rep1	seq-SDQ0821_SCC1_FEM2_...	fem-2(b245)|seq-SDQ0821_SCC1_FEM2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX466569	SRA137521	seq-SDQ1665_1666_MRG1_FEM2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ1665_1666_MRG1_FEM2_AD_Input_Rep1;_Caeno...	seq-SDQ1665_1666_MRG1_FEM2_AD_Input_Rep1	seq-SDQ1665_1666_MRG1_...	fem-2(b245)|seq-SDQ1665_1666_MRG1_FEM2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX466570	SRA137521	seq-SDQ1665_1666_MRG1_FEM2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ1665_1666_MRG1_FEM2_AD_Input_Rep2;_Caeno...	seq-SDQ1665_1666_MRG1_FEM2_AD_Input_Rep2	seq-SDQ1665_1666_MRG1_...	fem-2(b245)|seq-SDQ1665_1666_MRG1_FEM2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX466571	SRA137521	seq-SDQ1665_1666_MRG1_FEM2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ1665_1666_MRG1_FEM2_AD_ChIP_Rep1;_Caenor...	seq-SDQ1665_1666_MRG1_FEM2_AD_ChIP_Rep1	seq-SDQ1665_1666_MRG1_...	fem-2(b245)|seq-SDQ1665_1666_MRG1_FEM2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX466572	SRA137521	seq-SDQ1665_1666_MRG1_FEM2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ1665_1666_MRG1_FEM2_AD_ChIP_Rep2;_Caenor...	seq-SDQ1665_1666_MRG1_FEM2_AD_ChIP_Rep2	seq-SDQ1665_1666_MRG1_...	fem-2(b245)|seq-SDQ1665_1666_MRG1_FEM2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX466575	SRA137522	seq-SDQ2972_HIM8_FEM2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2972_HIM8_FEM2_AD_ChIP_Rep1;_Caenorhabdi...	seq-SDQ2972_HIM8_FEM2_AD_ChIP_Rep1	seq-SDQ2972_HIM8_FEM2_...	fem-2(b245)|seq-SDQ2972_HIM8_FEM2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX466576	SRA137522	seq-SDQ2972_HIM8_FEM2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2972_HIM8_FEM2_AD_ChIP_Rep2;_Caenorhabdi...	seq-SDQ2972_HIM8_FEM2_AD_ChIP_Rep2	seq-SDQ2972_HIM8_FEM2_...	fem-2(b245)|seq-SDQ2972_HIM8_FEM2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX466577	SRA137523	seq-SDQ2340_HPL2_N2_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2340_HPL2_N2_L3_Input_Rep1;_Caenorhabdit...	seq-SDQ2340_HPL2_N2_L3_Input_Rep1	seq-SDQ2340_HPL2_N2_L3...	N2|seq-SDQ2340_HPL2_N2_L3_Input_Rep1|L3 Larva	N2	ChIP-Seq
SRX466578	SRA137523	seq-SDQ2340_HPL2_N2_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2340_HPL2_N2_L3_Input_Rep2;_Caenorhabdit...	seq-SDQ2340_HPL2_N2_L3_Input_Rep2	seq-SDQ2340_HPL2_N2_L3...	N2|seq-SDQ2340_HPL2_N2_L3_Input_Rep2|L3 Larva	N2	ChIP-Seq
SRX466579	SRA137523	seq-SDQ2340_HPL2_N2_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2340_HPL2_N2_L3_ChIP_Rep1;_Caenorhabditi...	seq-SDQ2340_HPL2_N2_L3_ChIP_Rep1	seq-SDQ2340_HPL2_N2_L3...	N2|seq-SDQ2340_HPL2_N2_L3_ChIP_Rep1|L3 Larva	N2	ChIP-Seq
SRX466580	SRA137523	seq-SDQ2340_HPL2_N2_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2340_HPL2_N2_L3_ChIP_Rep2;_Caenorhabditi...	seq-SDQ2340_HPL2_N2_L3_ChIP_Rep2	seq-SDQ2340_HPL2_N2_L3...	N2|seq-SDQ2340_HPL2_N2_L3_ChIP_Rep2|L3 Larva	N2	ChIP-Seq
SRX466581	SRA137524	seq-SDQ3898_KLE2_FEM2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3898_KLE2_FEM2_AD_Input_Rep1;_Caenorhabd...	seq-SDQ3898_KLE2_FEM2_AD_Input_Rep1	seq-SDQ3898_KLE2_FEM2_...	fem-2(b245)|seq-SDQ3898_KLE2_FEM2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX466582	SRA137524	seq-SDQ3898_KLE2_FEM2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3898_KLE2_FEM2_AD_Input_Rep2;_Caenorhabd...	seq-SDQ3898_KLE2_FEM2_AD_Input_Rep2	seq-SDQ3898_KLE2_FEM2_...	fem-2(b245)|seq-SDQ3898_KLE2_FEM2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX466583	SRA137524	seq-SDQ3898_KLE2_FEM2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3898_KLE2_FEM2_AD_ChIP_Rep1;_Caenorhabdi...	seq-SDQ3898_KLE2_FEM2_AD_ChIP_Rep1	seq-SDQ3898_KLE2_FEM2_...	fem-2(b245)|seq-SDQ3898_KLE2_FEM2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX466584	SRA137524	seq-SDQ3898_KLE2_FEM2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3898_KLE2_FEM2_AD_ChIP_Rep2;_Caenorhabdi...	seq-SDQ3898_KLE2_FEM2_AD_ChIP_Rep2	seq-SDQ3898_KLE2_FEM2_...	fem-2(b245)|seq-SDQ3898_KLE2_FEM2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX466585	SRA137525	seq-SDQ2946_HCP4_N2_Mxemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2946_HCP4_N2_Mxemb_Input_Rep1;_Caenorhab...	seq-SDQ2946_HCP4_N2_Mxemb_Input_Rep1	seq-SDQ2946_HCP4_N2_Mx...	N2|seq-SDQ2946_HCP4_N2_Mxemb_Input_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX466586	SRA137525	seq-SDQ2946_HCP4_N2_Mxemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2946_HCP4_N2_Mxemb_Input_Rep2;_Caenorhab...	seq-SDQ2946_HCP4_N2_Mxemb_Input_Rep2	seq-SDQ2946_HCP4_N2_Mx...	N2|seq-SDQ2946_HCP4_N2_Mxemb_Input_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX466587	SRA137525	seq-SDQ2946_HCP4_N2_Mxemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2946_HCP4_N2_Mxemb_ChIP_Rep1;_Caenorhabd...	seq-SDQ2946_HCP4_N2_Mxemb_ChIP_Rep1	seq-SDQ2946_HCP4_N2_Mx...	N2|seq-SDQ2946_HCP4_N2_Mxemb_ChIP_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX466588	SRA137525	seq-SDQ2946_HCP4_N2_Mxemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2946_HCP4_N2_Mxemb_ChIP_Rep2;_Caenorhabd...	seq-SDQ2946_HCP4_N2_Mxemb_ChIP_Rep2	seq-SDQ2946_HCP4_N2_Mx...	N2|seq-SDQ2946_HCP4_N2_Mxemb_ChIP_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX467091	SRA137566	Snyder_Pmex-5_HPL-2_eGFP_YL472_yAd_C.elegans_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_Pmex-5_HPL-2_eGFP_YL472_yAd_C.elegans_In...	Snyder Pmex-5 HPL-2 eGFP YL472 yAd Input Rep.1	Snyder Pmex-5 HPL-2 eG...	YL472(official name : YL472 genotype : unc-119(ed3) III; vrEx66 pMEX-5::HPL-2:GFP:FLAG::HPL-2 3?UTR genotype : unc-119 (+)) outcross : 0 mutagen : None tags : GFP::3xFlag description : It is actually extrachromosomal line by bombardment. made_by : Michelle Kudron in Reinke lab )|Snyder Pmex-5 HPL-2 eGFP YL472 yAd Input Rep.1|Young adult	YL472(official name : ...	ChIP-Seq
SRX467092	SRA137566	Snyder_Pmex-5_HPL-2_eGFP_YL472_yAd_C.elegans_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_Pmex-5_HPL-2_eGFP_YL472_yAd_C.elegans_Ch...	Snyder Pmex-5 HPL-2 eGFP YL472 yAd ChIP Rep.1	Snyder Pmex-5 HPL-2 eG...	YL472(official name : YL472 genotype : unc-119(ed3) III; vrEx66 pMEX-5::HPL-2:GFP:FLAG::HPL-2 3?UTR genotype : unc-119 (+)) outcross : 0 mutagen : None tags : GFP::3xFlag description : It is actually extrachromosomal line by bombardment. made_by : Michelle Kudron in Reinke lab )|Snyder Pmex-5 HPL-2 eGFP YL472 yAd ChIP Rep.1|Young adult	YL472(official name : ...	ChIP-Seq
SRX467093	SRA137566	Snyder_Pmex-5_HPL-2_eGFP_YL472_yAd_C.elegans_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_Pmex-5_HPL-2_eGFP_YL472_yAd_C.elegans_In...	Snyder Pmex-5 HPL-2 eGFP YL472 yAd Input Rep.2	Snyder Pmex-5 HPL-2 eG...	YL472(official name : YL472 genotype : unc-119(ed3) III; vrEx66 pMEX-5::HPL-2:GFP:FLAG::HPL-2 3?UTR genotype : unc-119 (+)) outcross : 0 mutagen : None tags : GFP::3xFlag description : It is actually extrachromosomal line by bombardment. made_by : Michelle Kudron in Reinke lab )|Snyder Pmex-5 HPL-2 eGFP YL472 yAd Input Rep.2|Young adult	YL472(official name : ...	ChIP-Seq
SRX467094	SRA137566	Snyder_Pmex-5_HPL-2_eGFP_YL472_yAd_C.elegans_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_Pmex-5_HPL-2_eGFP_YL472_yAd_C.elegans_Ch...	Snyder Pmex-5 HPL-2 eGFP YL472 yAd ChIP Rep.2	Snyder Pmex-5 HPL-2 eG...	YL472(official name : YL472 genotype : unc-119(ed3) III; vrEx66 pMEX-5::HPL-2:GFP:FLAG::HPL-2 3?UTR genotype : unc-119 (+)) outcross : 0 mutagen : None tags : GFP::3xFlag description : It is actually extrachromosomal line by bombardment. made_by : Michelle Kudron in Reinke lab )|Snyder Pmex-5 HPL-2 eGFP YL472 yAd ChIP Rep.2|Young adult	YL472(official name : ...	ChIP-Seq
SRX467177	SRA137628	Snyder_lin-35_n745_EFL-1_Ab_L1_26dC_C.elegans_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_lin-35_n745_EFL-1_Ab_L1_26dC_C.elegans_C...	Snyder lin-35 n745 EFL-1 Ab L1 ChIP Rep.1	Snyder lin-35 n745 EFL...	MT10430(official name : MT10430 genotype : lin-35(n745) I. )|Snyder lin-35 n745 EFL-1 Ab L1 ChIP Rep.1|L1 26dC	MT10430(official name ...	ChIP-Seq
SRX467178	SRA137628	Snyder_lin-35_n745_EFL-1_Ab_L1_26dC_C.elegans_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_lin-35_n745_EFL-1_Ab_L1_26dC_C.elegans_I...	Snyder lin-35 n745 EFL-1 Ab L1 Input Rep.1	Snyder lin-35 n745 EFL...	MT10430(official name : MT10430 genotype : lin-35(n745) I. )|Snyder lin-35 n745 EFL-1 Ab L1 Input Rep.1|L1 26dC	MT10430(official name ...	ChIP-Seq
SRX467179	SRA137628	Snyder_lin-35_n745_EFL-1_Ab_L1_26dC_C.elegans_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_lin-35_n745_EFL-1_Ab_L1_26dC_C.elegans_C...	Snyder lin-35 n745 EFL-1 Ab L1 ChIP Rep.2	Snyder lin-35 n745 EFL...	MT10430(official name : MT10430 genotype : lin-35(n745) I. )|Snyder lin-35 n745 EFL-1 Ab L1 ChIP Rep.2|L1 26dC	MT10430(official name ...	ChIP-Seq
SRX467180	SRA137628	Snyder_lin-35_n745_EFL-1_Ab_L1_26dC_C.elegans_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_lin-35_n745_EFL-1_Ab_L1_26dC_C.elegans_I...	Snyder lin-35 n745 EFL-1 Ab L1 Input Rep.2	Snyder lin-35 n745 EFL...	MT10430(official name : MT10430 genotype : lin-35(n745) I. )|Snyder lin-35 n745 EFL-1 Ab L1 Input Rep.2|L1 26dC	MT10430(official name ...	ChIP-Seq
SRX494819	SRA146773	seq-SDQ2370_LIN53_N2_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2370_LIN53_N2_L3_Input_Rep1;_Caenorhabdi...	seq-SDQ2370_LIN53_N2_L3_Input_Rep1	seq-SDQ2370_LIN53_N2_L...	N2|seq-SDQ2370_LIN53_N2_L3_Input_Rep1|L3 Larva	N2	ChIP-Seq
SRX494820	SRA146773	seq-SDQ2370_LIN53_N2_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2370_LIN53_N2_L3_Input_Rep2;_Caenorhabdi...	seq-SDQ2370_LIN53_N2_L3_Input_Rep2	seq-SDQ2370_LIN53_N2_L...	N2|seq-SDQ2370_LIN53_N2_L3_Input_Rep2|L3 Larva	N2	ChIP-Seq
SRX494821	SRA146773	seq-SDQ2370_LIN53_N2_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2370_LIN53_N2_L3_ChIP_Rep1;_Caenorhabdit...	seq-SDQ2370_LIN53_N2_L3_ChIP_Rep1	seq-SDQ2370_LIN53_N2_L...	N2|seq-SDQ2370_LIN53_N2_L3_ChIP_Rep1|L3 Larva	N2	ChIP-Seq
SRX494822	SRA146773	seq-SDQ2370_LIN53_N2_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2370_LIN53_N2_L3_ChIP_Rep2;_Caenorhabdit...	seq-SDQ2370_LIN53_N2_L3_ChIP_Rep2	seq-SDQ2370_LIN53_N2_L...	N2|seq-SDQ2370_LIN53_N2_L3_ChIP_Rep2|L3 Larva	N2	ChIP-Seq
SRX494823	SRA146774	seq-SDQ0801_HIM17_FEM2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ0801_HIM17_FEM2_AD_Input_Rep1;_Caenorhab...	seq-SDQ0801_HIM17_FEM2_AD_Input_Rep1	seq-SDQ0801_HIM17_FEM2...	fem-2(b245)|seq-SDQ0801_HIM17_FEM2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494824	SRA146774	seq-SDQ0801_HIM17_FEM2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ0801_HIM17_FEM2_AD_Input_Rep2;_Caenorhab...	seq-SDQ0801_HIM17_FEM2_AD_Input_Rep2	seq-SDQ0801_HIM17_FEM2...	fem-2(b245)|seq-SDQ0801_HIM17_FEM2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494825	SRA146774	seq-SDQ0801_HIM17_FEM2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ0801_HIM17_FEM2_AD_ChIP_Rep1;_Caenorhabd...	seq-SDQ0801_HIM17_FEM2_AD_ChIP_Rep1	seq-SDQ0801_HIM17_FEM2...	fem-2(b245)|seq-SDQ0801_HIM17_FEM2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494826	SRA146774	seq-SDQ0801_HIM17_FEM2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ0801_HIM17_FEM2_AD_ChIP_Rep2;_Caenorhabd...	seq-SDQ0801_HIM17_FEM2_AD_ChIP_Rep2	seq-SDQ0801_HIM17_FEM2...	fem-2(b245)|seq-SDQ0801_HIM17_FEM2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494827	SRA146775	seq-SDQ0811_RAD51_FEM2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ0811_RAD51_FEM2_AD_Input_Rep1;_Caenorhab...	seq-SDQ0811_RAD51_FEM2_AD_Input_Rep1	seq-SDQ0811_RAD51_FEM2...	fem-2(b245)|seq-SDQ0811_RAD51_FEM2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494828	SRA146776	seq-SDQ2370_LIN53_N2_LTemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2370_LIN53_N2_LTemb_Input_Rep1;_Caenorha...	seq-SDQ2370_LIN53_N2_LTemb_Input_Rep1	seq-SDQ2370_LIN53_N2_L...	N2|seq-SDQ2370_LIN53_N2_LTemb_Input_Rep1|Late Embryos	N2	ChIP-Seq
SRX494829	SRA146776	seq-SDQ2370_LIN53_N2_LTemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2370_LIN53_N2_LTemb_Input_Rep2;_Caenorha...	seq-SDQ2370_LIN53_N2_LTemb_Input_Rep2	seq-SDQ2370_LIN53_N2_L...	N2|seq-SDQ2370_LIN53_N2_LTemb_Input_Rep2|Late Embryos	N2	ChIP-Seq
SRX494830	SRA146776	seq-SDQ2370_LIN53_N2_LTemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2370_LIN53_N2_LTemb_ChIP_Rep1;_Caenorhab...	seq-SDQ2370_LIN53_N2_LTemb_ChIP_Rep1	seq-SDQ2370_LIN53_N2_L...	N2|seq-SDQ2370_LIN53_N2_LTemb_ChIP_Rep1|Late Embryos	N2	ChIP-Seq
SRX494831	SRA146776	seq-SDQ2370_LIN53_N2_LTemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2370_LIN53_N2_LTemb_ChIP_Rep2;_Caenorhab...	seq-SDQ2370_LIN53_N2_LTemb_ChIP_Rep2	seq-SDQ2370_LIN53_N2_L...	N2|seq-SDQ2370_LIN53_N2_LTemb_ChIP_Rep2|Late Embryos	N2	ChIP-Seq
SRX494832	SRA146777	seq-ab1791_H3_377098_N2_Eemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab1791_H3_377098_N2_Eemb_Input_Rep1;_Caenor...	seq-ab1791_H3_377098_N2_Eemb_Input_Rep1	seq-ab1791_H3_377098_N...	N2|seq-ab1791_H3_377098_N2_Eemb_Input_Rep1|Early Embryo	N2	ChIP-Seq
SRX494833	SRA146777	seq-ab1791_H3_377098_N2_Eemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab1791_H3_377098_N2_Eemb_Input_Rep2;_Caenor...	seq-ab1791_H3_377098_N2_Eemb_Input_Rep2	seq-ab1791_H3_377098_N...	N2|seq-ab1791_H3_377098_N2_Eemb_Input_Rep2|Early Embryo	N2	ChIP-Seq
SRX494834	SRA146777	seq-ab1791_H3_377098_N2_Eemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab1791_H3_377098_N2_Eemb_ChIP_Rep1;_Caenorh...	seq-ab1791_H3_377098_N2_Eemb_ChIP_Rep1	seq-ab1791_H3_377098_N...	N2|seq-ab1791_H3_377098_N2_Eemb_ChIP_Rep1|Early Embryo	N2	ChIP-Seq
SRX494835	SRA146777	seq-ab1791_H3_377098_N2_Eemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab1791_H3_377098_N2_Eemb_ChIP_Rep2;_Caenorh...	seq-ab1791_H3_377098_N2_Eemb_ChIP_Rep2	seq-ab1791_H3_377098_N...	N2|seq-ab1791_H3_377098_N2_Eemb_ChIP_Rep2|Early Embryo	N2	ChIP-Seq
SRX494836	SRA146778	seq-SN147_H4K20me1_N2_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SN147_H4K20me1_N2_L3_Input_Rep1;_Caenorhabd...	seq-SN147_H4K20me1_N2_L3_Input_Rep1	seq-SN147_H4K20me1_N2_...	N2|seq-SN147_H4K20me1_N2_L3_Input_Rep1|L3 Larva	N2	ChIP-Seq
SRX494837	SRA146778	seq-SN147_H4K20me1_N2_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SN147_H4K20me1_N2_L3_Input_Rep2;_Caenorhabd...	seq-SN147_H4K20me1_N2_L3_Input_Rep2	seq-SN147_H4K20me1_N2_...	N2|seq-SN147_H4K20me1_N2_L3_Input_Rep2|L3 Larva	N2	ChIP-Seq
SRX494838	SRA146778	seq-SN147_H4K20me1_N2_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SN147_H4K20me1_N2_L3_ChIP_Rep1;_Caenorhabdi...	seq-SN147_H4K20me1_N2_L3_ChIP_Rep1	seq-SN147_H4K20me1_N2_...	N2|seq-SN147_H4K20me1_N2_L3_ChIP_Rep1|L3 Larva	N2	ChIP-Seq
SRX494839	SRA146778	seq-SN147_H4K20me1_N2_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SN147_H4K20me1_N2_L3_ChIP_Rep2;_Caenorhabdi...	seq-SN147_H4K20me1_N2_L3_ChIP_Rep2	seq-SN147_H4K20me1_N2_...	N2|seq-SN147_H4K20me1_N2_L3_ChIP_Rep2|L3 Larva	N2	ChIP-Seq
SRX494840	SRA146779	seq-UP07442_H3K9me3_DAM1411287_N2_Eemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-UP07442_H3K9me3_DAM1411287_N2_Eemb_Input_Re...	seq-UP07442_H3K9me3_DAM1411287_N2_Eemb_Input_Rep1	seq-UP07442_H3K9me3_DA...	N2|seq-UP07442_H3K9me3_DAM1411287_N2_Eemb_Input_Rep1|Early Embryo	N2	ChIP-Seq
SRX494841	SRA146779	seq-UP07442_H3K9me3_DAM1411287_N2_Eemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-UP07442_H3K9me3_DAM1411287_N2_Eemb_Input_Re...	seq-UP07442_H3K9me3_DAM1411287_N2_Eemb_Input_Rep2	seq-UP07442_H3K9me3_DA...	N2|seq-UP07442_H3K9me3_DAM1411287_N2_Eemb_Input_Rep2|Early Embryo	N2	ChIP-Seq
SRX494842	SRA146779	seq-UP07442_H3K9me3_DAM1411287_N2_Eemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-UP07442_H3K9me3_DAM1411287_N2_Eemb_ChIP_Rep...	seq-UP07442_H3K9me3_DAM1411287_N2_Eemb_ChIP_Rep1	seq-UP07442_H3K9me3_DA...	N2|seq-UP07442_H3K9me3_DAM1411287_N2_Eemb_ChIP_Rep1|Early Embryo	N2	ChIP-Seq
SRX494843	SRA146779	seq-UP07442_H3K9me3_DAM1411287_N2_Eemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-UP07442_H3K9me3_DAM1411287_N2_Eemb_ChIP_Rep...	seq-UP07442_H3K9me3_DAM1411287_N2_Eemb_ChIP_Rep2	seq-UP07442_H3K9me3_DA...	N2|seq-UP07442_H3K9me3_DAM1411287_N2_Eemb_ChIP_Rep2|Early Embryo	N2	ChIP-Seq
SRX494844	SRA146780	seq-ab8895_H3K4me1_733246_N2_Eemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab8895_H3K4me1_733246_N2_Eemb_Input_Rep1;_C...	seq-ab8895_H3K4me1_733246_N2_Eemb_Input_Rep1	seq-ab8895_H3K4me1_733...	N2|seq-ab8895_H3K4me1_733246_N2_Eemb_Input_Rep1|Early Embryo	N2	ChIP-Seq
SRX494845	SRA146780	seq-ab8895_H3K4me1_733246_N2_Eemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab8895_H3K4me1_733246_N2_Eemb_Input_Rep2;_C...	seq-ab8895_H3K4me1_733246_N2_Eemb_Input_Rep2	seq-ab8895_H3K4me1_733...	N2|seq-ab8895_H3K4me1_733246_N2_Eemb_Input_Rep2|Early Embryo	N2	ChIP-Seq
SRX494846	SRA146780	seq-ab8895_H3K4me1_733246_N2_Eemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab8895_H3K4me1_733246_N2_Eemb_ChIP_Rep1;_Ca...	seq-ab8895_H3K4me1_733246_N2_Eemb_ChIP_Rep1	seq-ab8895_H3K4me1_733...	N2|seq-ab8895_H3K4me1_733246_N2_Eemb_ChIP_Rep1|Early Embryo	N2	ChIP-Seq
SRX494847	SRA146780	seq-ab8895_H3K4me1_733246_N2_Eemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab8895_H3K4me1_733246_N2_Eemb_ChIP_Rep2;_Ca...	seq-ab8895_H3K4me1_733246_N2_Eemb_ChIP_Rep2	seq-ab8895_H3K4me1_733...	N2|seq-ab8895_H3K4me1_733246_N2_Eemb_ChIP_Rep2|Early Embryo	N2	ChIP-Seq
SRX494848	SRA146781	seq-HK00012_H3K36me2_2C3_N2_Eemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00012_H3K36me2_2C3_N2_Eemb_Input_Rep1;_Ca...	seq-HK00012_H3K36me2_2C3_N2_Eemb_Input_Rep1	seq-HK00012_H3K36me2_2...	N2|seq-HK00012_H3K36me2_2C3_N2_Eemb_Input_Rep1|Early Embryo	N2	ChIP-Seq
SRX494849	SRA146781	seq-HK00012_H3K36me2_2C3_N2_Eemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00012_H3K36me2_2C3_N2_Eemb_Input_Rep2;_Ca...	seq-HK00012_H3K36me2_2C3_N2_Eemb_Input_Rep2	seq-HK00012_H3K36me2_2...	N2|seq-HK00012_H3K36me2_2C3_N2_Eemb_Input_Rep2|Early Embryo	N2	ChIP-Seq
SRX494850	SRA146781	seq-HK00012_H3K36me2_2C3_N2_Eemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00012_H3K36me2_2C3_N2_Eemb_ChIP_Rep1;_Cae...	seq-HK00012_H3K36me2_2C3_N2_Eemb_ChIP_Rep1	seq-HK00012_H3K36me2_2...	N2|seq-HK00012_H3K36me2_2C3_N2_Eemb_ChIP_Rep1|Early Embryo	N2	ChIP-Seq
SRX494851	SRA146781	seq-HK00012_H3K36me2_2C3_N2_Eemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00012_H3K36me2_2C3_N2_Eemb_ChIP_Rep2;_Cae...	seq-HK00012_H3K36me2_2C3_N2_Eemb_ChIP_Rep2	seq-HK00012_H3K36me2_2...	N2|seq-HK00012_H3K36me2_2C3_N2_Eemb_ChIP_Rep2|Early Embryo	N2	ChIP-Seq
SRX494852	SRA146782	seq-HK00001_H3K36me3_13C9_N2_Eemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00001_H3K36me3_13C9_N2_Eemb_Input_Rep1;_C...	seq-HK00001_H3K36me3_13C9_N2_Eemb_Input_Rep1	seq-HK00001_H3K36me3_1...	N2|seq-HK00001_H3K36me3_13C9_N2_Eemb_Input_Rep1|Early Embryo	N2	ChIP-Seq
SRX494853	SRA146782	seq-HK00001_H3K36me3_13C9_N2_Eemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00001_H3K36me3_13C9_N2_Eemb_Input_Rep2;_C...	seq-HK00001_H3K36me3_13C9_N2_Eemb_Input_Rep2	seq-HK00001_H3K36me3_1...	N2|seq-HK00001_H3K36me3_13C9_N2_Eemb_Input_Rep2|Early Embryo	N2	ChIP-Seq
SRX494854	SRA146782	seq-HK00001_H3K36me3_13C9_N2_Eemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00001_H3K36me3_13C9_N2_Eemb_ChIP_Rep1;_Ca...	seq-HK00001_H3K36me3_13C9_N2_Eemb_ChIP_Rep1	seq-HK00001_H3K36me3_1...	N2|seq-HK00001_H3K36me3_13C9_N2_Eemb_ChIP_Rep1|Early Embryo	N2	ChIP-Seq
SRX494855	SRA146782	seq-HK00001_H3K36me3_13C9_N2_Eemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00001_H3K36me3_13C9_N2_Eemb_ChIP_Rep2;_Ca...	seq-HK00001_H3K36me3_13C9_N2_Eemb_ChIP_Rep2	seq-HK00001_H3K36me3_1...	N2|seq-HK00001_H3K36me3_13C9_N2_Eemb_ChIP_Rep2|Early Embryo	N2	ChIP-Seq
SRX494856	SRA146783	seq-Ab52946_H3K14ac_FEM2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-Ab52946_H3K14ac_FEM2_AD_Input_Rep1;_Caenorh...	seq-Ab52946_H3K14ac_FEM2_AD_Input_Rep1	seq-Ab52946_H3K14ac_FE...	fem-2(b245)|seq-Ab52946_H3K14ac_FEM2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494857	SRA146783	seq-Ab52946_H3K14ac_FEM2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-Ab52946_H3K14ac_FEM2_AD_Input_Rep2;_Caenorh...	seq-Ab52946_H3K14ac_FEM2_AD_Input_Rep2	seq-Ab52946_H3K14ac_FE...	fem-2(b245)|seq-Ab52946_H3K14ac_FEM2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494858	SRA146783	seq-Ab52946_H3K14ac_FEM2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-Ab52946_H3K14ac_FEM2_AD_ChIP_Rep1;_Caenorha...	seq-Ab52946_H3K14ac_FEM2_AD_ChIP_Rep1	seq-Ab52946_H3K14ac_FE...	fem-2(b245)|seq-Ab52946_H3K14ac_FEM2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494859	SRA146783	seq-Ab52946_H3K14ac_FEM2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-Ab52946_H3K14ac_FEM2_AD_ChIP_Rep2;_Caenorha...	seq-Ab52946_H3K14ac_FEM2_AD_ChIP_Rep2	seq-Ab52946_H3K14ac_FE...	fem-2(b245)|seq-Ab52946_H3K14ac_FEM2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494860	SRA146784	seq-SDQ0835_SCC1_FEM2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ0835_SCC1_FEM2_AD_Input_Rep1;_Caenorhabd...	seq-SDQ0835_SCC1_FEM2_AD_Input_Rep1	seq-SDQ0835_SCC1_FEM2_...	fem-2(b245)|seq-SDQ0835_SCC1_FEM2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494861	SRA146784	seq-SDQ0835_SCC1_FEM2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ0835_SCC1_FEM2_AD_ChIP_Rep1;_Caenorhabdi...	seq-SDQ0835_SCC1_FEM2_AD_ChIP_Rep1	seq-SDQ0835_SCC1_FEM2_...	fem-2(b245)|seq-SDQ0835_SCC1_FEM2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494862	SRA146785	seq-SDQ2356_MRE11_FEM2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2356_MRE11_FEM2_AD_Input_Rep1;_Caenorhab...	seq-SDQ2356_MRE11_FEM2_AD_Input_Rep1	seq-SDQ2356_MRE11_FEM2...	fem-2(b245)|seq-SDQ2356_MRE11_FEM2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494863	SRA146785	seq-SDQ2356_MRE11_FEM2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2356_MRE11_FEM2_AD_Input_Rep2;_Caenorhab...	seq-SDQ2356_MRE11_FEM2_AD_Input_Rep2	seq-SDQ2356_MRE11_FEM2...	fem-2(b245)|seq-SDQ2356_MRE11_FEM2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494864	SRA146785	seq-SDQ2356_MRE11_FEM2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2356_MRE11_FEM2_AD_ChIP_Rep2;_Caenorhabd...	seq-SDQ2356_MRE11_FEM2_AD_ChIP_Rep2	seq-SDQ2356_MRE11_FEM2...	fem-2(b245)|seq-SDQ2356_MRE11_FEM2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494865	SRA146786	seq-SDQ2366_MRE11_FEM2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2366_MRE11_FEM2_AD_Input_Rep1;_Caenorhab...	seq-SDQ2366_MRE11_FEM2_AD_Input_Rep1	seq-SDQ2366_MRE11_FEM2...	fem-2(b245)|seq-SDQ2366_MRE11_FEM2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494866	SRA146786	seq-SDQ2366_MRE11_FEM2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2366_MRE11_FEM2_AD_Input_Rep2;_Caenorhab...	seq-SDQ2366_MRE11_FEM2_AD_Input_Rep2	seq-SDQ2366_MRE11_FEM2...	fem-2(b245)|seq-SDQ2366_MRE11_FEM2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494867	SRA146786	seq-SDQ2366_MRE11_FEM2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2366_MRE11_FEM2_AD_ChIP_Rep1;_Caenorhabd...	seq-SDQ2366_MRE11_FEM2_AD_ChIP_Rep1	seq-SDQ2366_MRE11_FEM2...	fem-2(b245)|seq-SDQ2366_MRE11_FEM2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494868	SRA146786	seq-SDQ2366_MRE11_FEM2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2366_MRE11_FEM2_AD_ChIP_Rep2;_Caenorhabd...	seq-SDQ2366_MRE11_FEM2_AD_ChIP_Rep2	seq-SDQ2366_MRE11_FEM2...	fem-2(b245)|seq-SDQ2366_MRE11_FEM2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494869	SRA146787	seq-SDQ3849_CHD3_FEM2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3849_CHD3_FEM2_AD_Input_Rep2;_Caenorhabd...	seq-SDQ3849_CHD3_FEM2_AD_Input_Rep2	seq-SDQ3849_CHD3_FEM2_...	fem-2(b245)|seq-SDQ3849_CHD3_FEM2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494870	SRA146787	seq-SDQ3849_CHD3_FEM2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3849_CHD3_FEM2_AD_ChIP_Rep2;_Caenorhabdi...	seq-SDQ3849_CHD3_FEM2_AD_ChIP_Rep2	seq-SDQ3849_CHD3_FEM2_...	fem-2(b245)|seq-SDQ3849_CHD3_FEM2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494871	SRA146788	seq-SDQ3853_MSH5_FEM2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3853_MSH5_FEM2_AD_Input_Rep1;_Caenorhabd...	seq-SDQ3853_MSH5_FEM2_AD_Input_Rep1	seq-SDQ3853_MSH5_FEM2_...	fem-2(b245)|seq-SDQ3853_MSH5_FEM2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494872	SRA146788	seq-SDQ3853_MSH5_FEM2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3853_MSH5_FEM2_AD_Input_Rep2;_Caenorhabd...	seq-SDQ3853_MSH5_FEM2_AD_Input_Rep2	seq-SDQ3853_MSH5_FEM2_...	fem-2(b245)|seq-SDQ3853_MSH5_FEM2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494873	SRA146788	seq-SDQ3853_MSH5_FEM2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3853_MSH5_FEM2_AD_ChIP_Rep1;_Caenorhabdi...	seq-SDQ3853_MSH5_FEM2_AD_ChIP_Rep1	seq-SDQ3853_MSH5_FEM2_...	fem-2(b245)|seq-SDQ3853_MSH5_FEM2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494874	SRA146788	seq-SDQ3853_MSH5_FEM2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3853_MSH5_FEM2_AD_ChIP_Rep2;_Caenorhabdi...	seq-SDQ3853_MSH5_FEM2_AD_ChIP_Rep2	seq-SDQ3853_MSH5_FEM2_...	fem-2(b245)|seq-SDQ3853_MSH5_FEM2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494875	SRA146789	seq-SDQ3866_MRE11_FEM2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3866_MRE11_FEM2_AD_Input_Rep1;_Caenorhab...	seq-SDQ3866_MRE11_FEM2_AD_Input_Rep1	seq-SDQ3866_MRE11_FEM2...	fem-2(b245)|seq-SDQ3866_MRE11_FEM2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494876	SRA146789	seq-SDQ3866_MRE11_FEM2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3866_MRE11_FEM2_AD_Input_Rep2;_Caenorhab...	seq-SDQ3866_MRE11_FEM2_AD_Input_Rep2	seq-SDQ3866_MRE11_FEM2...	fem-2(b245)|seq-SDQ3866_MRE11_FEM2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494877	SRA146789	seq-SDQ3866_MRE11_FEM2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3866_MRE11_FEM2_AD_ChIP_Rep2;_Caenorhabd...	seq-SDQ3866_MRE11_FEM2_AD_ChIP_Rep2	seq-SDQ3866_MRE11_FEM2...	fem-2(b245)|seq-SDQ3866_MRE11_FEM2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494878	SRA146790	seq-SDQ3907_CHD3_FEM2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3907_CHD3_FEM2_AD_Input_Rep1;_Caenorhabd...	seq-SDQ3907_CHD3_FEM2_AD_Input_Rep1	seq-SDQ3907_CHD3_FEM2_...	fem-2(b245)|seq-SDQ3907_CHD3_FEM2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494879	SRA146790	seq-SDQ3907_CHD3_FEM2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3907_CHD3_FEM2_AD_Input_Rep2;_Caenorhabd...	seq-SDQ3907_CHD3_FEM2_AD_Input_Rep2	seq-SDQ3907_CHD3_FEM2_...	fem-2(b245)|seq-SDQ3907_CHD3_FEM2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494880	SRA146790	seq-SDQ3907_CHD3_FEM2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3907_CHD3_FEM2_AD_ChIP_Rep1;_Caenorhabdi...	seq-SDQ3907_CHD3_FEM2_AD_ChIP_Rep1	seq-SDQ3907_CHD3_FEM2_...	fem-2(b245)|seq-SDQ3907_CHD3_FEM2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494881	SRA146790	seq-SDQ3907_CHD3_FEM2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3907_CHD3_FEM2_AD_ChIP_Rep2;_Caenorhabdi...	seq-SDQ3907_CHD3_FEM2_AD_ChIP_Rep2	seq-SDQ3907_CHD3_FEM2_...	fem-2(b245)|seq-SDQ3907_CHD3_FEM2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494882	SRA146791	seq-SDQ3925_ZHP3_FEM2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3925_ZHP3_FEM2_AD_Input_Rep1;_Caenorhabd...	seq-SDQ3925_ZHP3_FEM2_AD_Input_Rep1	seq-SDQ3925_ZHP3_FEM2_...	fem-2(b245)|seq-SDQ3925_ZHP3_FEM2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494883	SRA146791	seq-SDQ3925_ZHP3_FEM2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3925_ZHP3_FEM2_AD_Input_Rep2;_Caenorhabd...	seq-SDQ3925_ZHP3_FEM2_AD_Input_Rep2	seq-SDQ3925_ZHP3_FEM2_...	fem-2(b245)|seq-SDQ3925_ZHP3_FEM2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494884	SRA146791	seq-SDQ3925_ZHP3_FEM2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3925_ZHP3_FEM2_AD_ChIP_Rep1;_Caenorhabdi...	seq-SDQ3925_ZHP3_FEM2_AD_ChIP_Rep1	seq-SDQ3925_ZHP3_FEM2_...	fem-2(b245)|seq-SDQ3925_ZHP3_FEM2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494889	SRA146793	seq-SDQ3942_KLE2_FEM2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3942_KLE2_FEM2_AD_ChIP_Rep1;_Caenorhabdi...	seq-SDQ3942_KLE2_FEM2_AD_ChIP_Rep1	seq-SDQ3942_KLE2_FEM2_...	fem-2(b245)|seq-SDQ3942_KLE2_FEM2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494890	SRA146794	seq-SDQ3948_COH3_FEM2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3948_COH3_FEM2_AD_Input_Rep1;_Caenorhabd...	seq-SDQ3948_COH3_FEM2_AD_Input_Rep1	seq-SDQ3948_COH3_FEM2_...	fem-2(b245)|seq-SDQ3948_COH3_FEM2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494891	SRA146794	seq-SDQ3948_COH3_FEM2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3948_COH3_FEM2_AD_Input_Rep2;_Caenorhabd...	seq-SDQ3948_COH3_FEM2_AD_Input_Rep2	seq-SDQ3948_COH3_FEM2_...	fem-2(b245)|seq-SDQ3948_COH3_FEM2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494892	SRA146794	seq-SDQ3948_COH3_FEM2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3948_COH3_FEM2_AD_ChIP_Rep1;_Caenorhabdi...	seq-SDQ3948_COH3_FEM2_AD_ChIP_Rep1	seq-SDQ3948_COH3_FEM2_...	fem-2(b245)|seq-SDQ3948_COH3_FEM2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494893	SRA146794	seq-SDQ3948_COH3_FEM2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3948_COH3_FEM2_AD_ChIP_Rep2;_Caenorhabdi...	seq-SDQ3948_COH3_FEM2_AD_ChIP_Rep2	seq-SDQ3948_COH3_FEM2_...	fem-2(b245)|seq-SDQ3948_COH3_FEM2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494894	SRA146795	seq-SDQ3949_ZIM3_FEM2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3949_ZIM3_FEM2_AD_Input_Rep1;_Caenorhabd...	seq-SDQ3949_ZIM3_FEM2_AD_Input_Rep1	seq-SDQ3949_ZIM3_FEM2_...	fem-2(b245)|seq-SDQ3949_ZIM3_FEM2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494895	SRA146795	seq-SDQ3949_ZIM3_FEM2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3949_ZIM3_FEM2_AD_Input_Rep2;_Caenorhabd...	seq-SDQ3949_ZIM3_FEM2_AD_Input_Rep2	seq-SDQ3949_ZIM3_FEM2_...	fem-2(b245)|seq-SDQ3949_ZIM3_FEM2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494896	SRA146795	seq-SDQ3949_ZIM3_FEM2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3949_ZIM3_FEM2_AD_ChIP_Rep1;_Caenorhabdi...	seq-SDQ3949_ZIM3_FEM2_AD_ChIP_Rep1	seq-SDQ3949_ZIM3_FEM2_...	fem-2(b245)|seq-SDQ3949_ZIM3_FEM2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494897	SRA146795	seq-SDQ3949_ZIM3_FEM2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3949_ZIM3_FEM2_AD_ChIP_Rep2;_Caenorhabdi...	seq-SDQ3949_ZIM3_FEM2_AD_ChIP_Rep2	seq-SDQ3949_ZIM3_FEM2_...	fem-2(b245)|seq-SDQ3949_ZIM3_FEM2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494898	SRA146796	seq-SDQ3953_REC8_FEM2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3953_REC8_FEM2_AD_Input_Rep1;_Caenorhabd...	seq-SDQ3953_REC8_FEM2_AD_Input_Rep1	seq-SDQ3953_REC8_FEM2_...	fem-2(b245)|seq-SDQ3953_REC8_FEM2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494899	SRA146796	seq-SDQ3953_REC8_FEM2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3953_REC8_FEM2_AD_Input_Rep2;_Caenorhabd...	seq-SDQ3953_REC8_FEM2_AD_Input_Rep2	seq-SDQ3953_REC8_FEM2_...	fem-2(b245)|seq-SDQ3953_REC8_FEM2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494900	SRA146796	seq-SDQ3953_REC8_FEM2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3953_REC8_FEM2_AD_ChIP_Rep1;_Caenorhabdi...	seq-SDQ3953_REC8_FEM2_AD_ChIP_Rep1	seq-SDQ3953_REC8_FEM2_...	fem-2(b245)|seq-SDQ3953_REC8_FEM2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494901	SRA146796	seq-SDQ3953_REC8_FEM2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3953_REC8_FEM2_AD_ChIP_Rep2;_Caenorhabdi...	seq-SDQ3953_REC8_FEM2_AD_ChIP_Rep2	seq-SDQ3953_REC8_FEM2_...	fem-2(b245)|seq-SDQ3953_REC8_FEM2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494902	SRA146797	seq-SDQ3956_ZHP3_FEM2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3956_ZHP3_FEM2_AD_Input_Rep1;_Caenorhabd...	seq-SDQ3956_ZHP3_FEM2_AD_Input_Rep1	seq-SDQ3956_ZHP3_FEM2_...	fem-2(b245)|seq-SDQ3956_ZHP3_FEM2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494903	SRA146797	seq-SDQ3956_ZHP3_FEM2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3956_ZHP3_FEM2_AD_Input_Rep2;_Caenorhabd...	seq-SDQ3956_ZHP3_FEM2_AD_Input_Rep2	seq-SDQ3956_ZHP3_FEM2_...	fem-2(b245)|seq-SDQ3956_ZHP3_FEM2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494904	SRA146797	seq-SDQ3956_ZHP3_FEM2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3956_ZHP3_FEM2_AD_ChIP_Rep1;_Caenorhabdi...	seq-SDQ3956_ZHP3_FEM2_AD_ChIP_Rep1	seq-SDQ3956_ZHP3_FEM2_...	fem-2(b245)|seq-SDQ3956_ZHP3_FEM2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494905	SRA146797	seq-SDQ3956_ZHP3_FEM2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3956_ZHP3_FEM2_AD_ChIP_Rep2;_Caenorhabdi...	seq-SDQ3956_ZHP3_FEM2_AD_ChIP_Rep2	seq-SDQ3956_ZHP3_FEM2_...	fem-2(b245)|seq-SDQ3956_ZHP3_FEM2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494906	SRA146798	seq-SDQ3965_ZIM1_FEM2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3965_ZIM1_FEM2_AD_Input_Rep1;_Caenorhabd...	seq-SDQ3965_ZIM1_FEM2_AD_Input_Rep1	seq-SDQ3965_ZIM1_FEM2_...	fem-2(b245)|seq-SDQ3965_ZIM1_FEM2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494907	SRA146798	seq-SDQ3965_ZIM1_FEM2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3965_ZIM1_FEM2_AD_Input_Rep2;_Caenorhabd...	seq-SDQ3965_ZIM1_FEM2_AD_Input_Rep2	seq-SDQ3965_ZIM1_FEM2_...	fem-2(b245)|seq-SDQ3965_ZIM1_FEM2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494908	SRA146798	seq-SDQ3965_ZIM1_FEM2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3965_ZIM1_FEM2_AD_ChIP_Rep1;_Caenorhabdi...	seq-SDQ3965_ZIM1_FEM2_AD_ChIP_Rep1	seq-SDQ3965_ZIM1_FEM2_...	fem-2(b245)|seq-SDQ3965_ZIM1_FEM2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494909	SRA146798	seq-SDQ3965_ZIM1_FEM2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3965_ZIM1_FEM2_AD_ChIP_Rep2;_Caenorhabdi...	seq-SDQ3965_ZIM1_FEM2_AD_ChIP_Rep2	seq-SDQ3965_ZIM1_FEM2_...	fem-2(b245)|seq-SDQ3965_ZIM1_FEM2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494910	SRA146799	seq-SDQ3972_COH3_FEM2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3972_COH3_FEM2_AD_Input_Rep1;_Caenorhabd...	seq-SDQ3972_COH3_FEM2_AD_Input_Rep1	seq-SDQ3972_COH3_FEM2_...	fem-2(b245)|seq-SDQ3972_COH3_FEM2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494911	SRA146799	seq-SDQ3972_COH3_FEM2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3972_COH3_FEM2_AD_Input_Rep2;_Caenorhabd...	seq-SDQ3972_COH3_FEM2_AD_Input_Rep2	seq-SDQ3972_COH3_FEM2_...	fem-2(b245)|seq-SDQ3972_COH3_FEM2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494912	SRA146799	seq-SDQ3972_COH3_FEM2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3972_COH3_FEM2_AD_ChIP_Rep1;_Caenorhabdi...	seq-SDQ3972_COH3_FEM2_AD_ChIP_Rep1	seq-SDQ3972_COH3_FEM2_...	fem-2(b245)|seq-SDQ3972_COH3_FEM2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494913	SRA146799	seq-SDQ3972_COH3_FEM2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3972_COH3_FEM2_AD_ChIP_Rep2;_Caenorhabdi...	seq-SDQ3972_COH3_FEM2_AD_ChIP_Rep2	seq-SDQ3972_COH3_FEM2_...	fem-2(b245)|seq-SDQ3972_COH3_FEM2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494914	SRA146800	seq-SDQ3989_ASH2_FEM2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3989_ASH2_FEM2_AD_Input_Rep1;_Caenorhabd...	seq-SDQ3989_ASH2_FEM2_AD_Input_Rep1	seq-SDQ3989_ASH2_FEM2_...	fem-2(b245)|seq-SDQ3989_ASH2_FEM2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494915	SRA146800	seq-SDQ3989_ASH2_FEM2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3989_ASH2_FEM2_AD_Input_Rep2;_Caenorhabd...	seq-SDQ3989_ASH2_FEM2_AD_Input_Rep2	seq-SDQ3989_ASH2_FEM2_...	fem-2(b245)|seq-SDQ3989_ASH2_FEM2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494916	SRA146800	seq-SDQ3989_ASH2_FEM2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3989_ASH2_FEM2_AD_ChIP_Rep1;_Caenorhabdi...	seq-SDQ3989_ASH2_FEM2_AD_ChIP_Rep1	seq-SDQ3989_ASH2_FEM2_...	fem-2(b245)|seq-SDQ3989_ASH2_FEM2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494917	SRA146800	seq-SDQ3989_ASH2_FEM2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3989_ASH2_FEM2_AD_ChIP_Rep2;_Caenorhabdi...	seq-SDQ3989_ASH2_FEM2_AD_ChIP_Rep2	seq-SDQ3989_ASH2_FEM2_...	fem-2(b245)|seq-SDQ3989_ASH2_FEM2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494918	SRA146801	seq-SDQ4068_MRG1_FEM2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4068_MRG1_FEM2_AD_Input_Rep1;_Caenorhabd...	seq-SDQ4068_MRG1_FEM2_AD_Input_Rep1	seq-SDQ4068_MRG1_FEM2_...	fem-2(b245)|seq-SDQ4068_MRG1_FEM2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494919	SRA146801	seq-SDQ4068_MRG1_FEM2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4068_MRG1_FEM2_AD_Input_Rep2;_Caenorhabd...	seq-SDQ4068_MRG1_FEM2_AD_Input_Rep2	seq-SDQ4068_MRG1_FEM2_...	fem-2(b245)|seq-SDQ4068_MRG1_FEM2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494920	SRA146801	seq-SDQ4068_MRG1_FEM2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4068_MRG1_FEM2_AD_ChIP_Rep1;_Caenorhabdi...	seq-SDQ4068_MRG1_FEM2_AD_ChIP_Rep1	seq-SDQ4068_MRG1_FEM2_...	fem-2(b245)|seq-SDQ4068_MRG1_FEM2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494921	SRA146801	seq-SDQ4068_MRG1_FEM2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4068_MRG1_FEM2_AD_ChIP_Rep2;_Caenorhabdi...	seq-SDQ4068_MRG1_FEM2_AD_ChIP_Rep2	seq-SDQ4068_MRG1_FEM2_...	fem-2(b245)|seq-SDQ4068_MRG1_FEM2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494922	SRA146802	seq-SDQ4498_HIM3_FEM2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4498_HIM3_FEM2_AD_Input_Rep1;_Caenorhabd...	seq-SDQ4498_HIM3_FEM2_AD_Input_Rep1	seq-SDQ4498_HIM3_FEM2_...	fem-2(b245)|seq-SDQ4498_HIM3_FEM2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494923	SRA146802	seq-SDQ4498_HIM3_FEM2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4498_HIM3_FEM2_AD_ChIP_Rep1;_Caenorhabdi...	seq-SDQ4498_HIM3_FEM2_AD_ChIP_Rep1	seq-SDQ4498_HIM3_FEM2_...	fem-2(b245)|seq-SDQ4498_HIM3_FEM2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494924	SRA146803	seq-SDQ4713_HIM3_FEM2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4713_HIM3_FEM2_AD_Input_Rep1;_Caenorhabd...	seq-SDQ4713_HIM3_FEM2_AD_Input_Rep1	seq-SDQ4713_HIM3_FEM2_...	fem-2(b245)|seq-SDQ4713_HIM3_FEM2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494925	SRA146803	seq-SDQ4713_HIM3_FEM2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4713_HIM3_FEM2_AD_Input_Rep2;_Caenorhabd...	seq-SDQ4713_HIM3_FEM2_AD_Input_Rep2	seq-SDQ4713_HIM3_FEM2_...	fem-2(b245)|seq-SDQ4713_HIM3_FEM2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494927	SRA146804	seq-WA30335199_H3Ser10_FEM2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-WA30335199_H3Ser10_FEM2_AD_Input_Rep1;_Caen...	seq-WA30335199_H3Ser10_FEM2_AD_Input_Rep1	seq-WA30335199_H3Ser10...	fem-2(b245)|seq-WA30335199_H3Ser10_FEM2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494928	SRA146804	seq-WA30335199_H3Ser10_FEM2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-WA30335199_H3Ser10_FEM2_AD_Input_Rep2;_Caen...	seq-WA30335199_H3Ser10_FEM2_AD_Input_Rep2	seq-WA30335199_H3Ser10...	fem-2(b245)|seq-WA30335199_H3Ser10_FEM2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494929	SRA146804	seq-WA30335199_H3Ser10_FEM2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-WA30335199_H3Ser10_FEM2_AD_ChIP_Rep1;_Caeno...	seq-WA30335199_H3Ser10_FEM2_AD_ChIP_Rep1	seq-WA30335199_H3Ser10...	fem-2(b245)|seq-WA30335199_H3Ser10_FEM2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494930	SRA146804	seq-WA30335199_H3Ser10_FEM2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-WA30335199_H3Ser10_FEM2_AD_ChIP_Rep2;_Caeno...	seq-WA30335199_H3Ser10_FEM2_AD_ChIP_Rep2	seq-WA30335199_H3Ser10...	fem-2(b245)|seq-WA30335199_H3Ser10_FEM2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494931	SRA146805	seq-WA30534799_H3K4me1_FEM2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-WA30534799_H3K4me1_FEM2_AD_Input_Rep1;_Caen...	seq-WA30534799_H3K4me1_FEM2_AD_Input_Rep1	seq-WA30534799_H3K4me1...	fem-2(b245)|seq-WA30534799_H3K4me1_FEM2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494932	SRA146805	seq-WA30534799_H3K4me1_FEM2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-WA30534799_H3K4me1_FEM2_AD_Input_Rep2;_Caen...	seq-WA30534799_H3K4me1_FEM2_AD_Input_Rep2	seq-WA30534799_H3K4me1...	fem-2(b245)|seq-WA30534799_H3K4me1_FEM2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494933	SRA146805	seq-WA30534799_H3K4me1_FEM2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-WA30534799_H3K4me1_FEM2_AD_ChIP_Rep1;_Caeno...	seq-WA30534799_H3K4me1_FEM2_AD_ChIP_Rep1	seq-WA30534799_H3K4me1...	fem-2(b245)|seq-WA30534799_H3K4me1_FEM2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494934	SRA146805	seq-WA30534799_H3K4me1_FEM2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-WA30534799_H3K4me1_FEM2_AD_ChIP_Rep2;_Caeno...	seq-WA30534799_H3K4me1_FEM2_AD_ChIP_Rep2	seq-WA30534799_H3K4me1...	fem-2(b245)|seq-WA30534799_H3K4me1_FEM2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494935	SRA146806	seq-ab45142_H2AK5ac_ojIs9_YA_germline_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab45142_H2AK5ac_ojIs9_YA_germline_Input_Rep...	seq-ab45142_H2AK5ac_ojIs9_YA_germline_Input_Rep1	seq-ab45142_H2AK5ac_oj...	WH223|seq-ab45142_H2AK5ac_ojIs9_YA_germline_Input_Rep1|Germline containing young adult	WH223	ChIP-Seq
SRX494936	SRA146806	seq-ab45142_H2AK5ac_ojIs9_YA_germline_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab45142_H2AK5ac_ojIs9_YA_germline_Input_Rep...	seq-ab45142_H2AK5ac_ojIs9_YA_germline_Input_Rep2	seq-ab45142_H2AK5ac_oj...	WH223|seq-ab45142_H2AK5ac_ojIs9_YA_germline_Input_Rep2|Germline containing young adult	WH223	ChIP-Seq
SRX494937	SRA146806	seq-ab45142_H2AK5ac_ojIs9_YA_germline_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab45142_H2AK5ac_ojIs9_YA_germline_ChIP_Rep1...	seq-ab45142_H2AK5ac_ojIs9_YA_germline_ChIP_Rep1	seq-ab45142_H2AK5ac_oj...	WH223|seq-ab45142_H2AK5ac_ojIs9_YA_germline_ChIP_Rep1|Germline containing young adult	WH223	ChIP-Seq
SRX494938	SRA146806	seq-ab45142_H2AK5ac_ojIs9_YA_germline_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab45142_H2AK5ac_ojIs9_YA_germline_ChIP_Rep2...	seq-ab45142_H2AK5ac_ojIs9_YA_germline_ChIP_Rep2	seq-ab45142_H2AK5ac_oj...	WH223|seq-ab45142_H2AK5ac_ojIs9_YA_germline_ChIP_Rep2|Germline containing young adult	WH223	ChIP-Seq
SRX494939	SRA146807	seq-ab45142_H2AK5ac_FEM2_YA_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab45142_H2AK5ac_FEM2_YA_Input_Rep1;_Caenorh...	seq-ab45142_H2AK5ac_FEM2_YA_Input_Rep1	seq-ab45142_H2AK5ac_FE...	fem-2(b245)|seq-ab45142_H2AK5ac_FEM2_YA_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494940	SRA146807	seq-ab45142_H2AK5ac_FEM2_YA_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab45142_H2AK5ac_FEM2_YA_Input_Rep2;_Caenorh...	seq-ab45142_H2AK5ac_FEM2_YA_Input_Rep2	seq-ab45142_H2AK5ac_FE...	fem-2(b245)|seq-ab45142_H2AK5ac_FEM2_YA_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494941	SRA146807	seq-ab45142_H2AK5ac_FEM2_YA_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab45142_H2AK5ac_FEM2_YA_ChIP_Rep1;_Caenorha...	seq-ab45142_H2AK5ac_FEM2_YA_ChIP_Rep1	seq-ab45142_H2AK5ac_FE...	fem-2(b245)|seq-ab45142_H2AK5ac_FEM2_YA_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494942	SRA146807	seq-ab45142_H2AK5ac_FEM2_YA_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab45142_H2AK5ac_FEM2_YA_ChIP_Rep2;_Caenorha...	seq-ab45142_H2AK5ac_FEM2_YA_ChIP_Rep2	seq-ab45142_H2AK5ac_FE...	fem-2(b245)|seq-ab45142_H2AK5ac_FEM2_YA_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494943	SRA146808	seq-WA30834809_H3K4me2_ojIs9_YA_germline_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-WA30834809_H3K4me2_ojIs9_YA_germline_Input_...	seq-WA30834809_H3K4me2_ojIs9_YA_germline_Input_Rep1	seq-WA30834809_H3K4me2...	WH223|seq-WA30834809_H3K4me2_ojIs9_YA_germline_Input_Rep1|Germline containing young adult	WH223	ChIP-Seq
SRX494944	SRA146808	seq-WA30834809_H3K4me2_ojIs9_YA_germline_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-WA30834809_H3K4me2_ojIs9_YA_germline_Input_...	seq-WA30834809_H3K4me2_ojIs9_YA_germline_Input_Rep2	seq-WA30834809_H3K4me2...	WH223|seq-WA30834809_H3K4me2_ojIs9_YA_germline_Input_Rep2|Germline containing young adult	WH223	ChIP-Seq
SRX494945	SRA146808	seq-WA30834809_H3K4me2_ojIs9_YA_germline_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-WA30834809_H3K4me2_ojIs9_YA_germline_ChIP_R...	seq-WA30834809_H3K4me2_ojIs9_YA_germline_ChIP_Rep1	seq-WA30834809_H3K4me2...	WH223|seq-WA30834809_H3K4me2_ojIs9_YA_germline_ChIP_Rep1|Germline containing young adult	WH223	ChIP-Seq
SRX494946	SRA146808	seq-WA30834809_H3K4me2_ojIs9_YA_germline_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-WA30834809_H3K4me2_ojIs9_YA_germline_ChIP_R...	seq-WA30834809_H3K4me2_ojIs9_YA_germline_ChIP_Rep2	seq-WA30834809_H3K4me2...	WH223|seq-WA30834809_H3K4me2_ojIs9_YA_germline_ChIP_Rep2|Germline containing young adult	WH223	ChIP-Seq
SRX494947	SRA146809	seq-SDQ2354_HDA1_N2_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2354_HDA1_N2_L3_Input_Rep1;_Caenorhabdit...	seq-SDQ2354_HDA1_N2_L3_Input_Rep1	seq-SDQ2354_HDA1_N2_L3...	N2|seq-SDQ2354_HDA1_N2_L3_Input_Rep1|L3 Larva	N2	ChIP-Seq
SRX494948	SRA146809	seq-SDQ2354_HDA1_N2_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2354_HDA1_N2_L3_Input_Rep2;_Caenorhabdit...	seq-SDQ2354_HDA1_N2_L3_Input_Rep2	seq-SDQ2354_HDA1_N2_L3...	N2|seq-SDQ2354_HDA1_N2_L3_Input_Rep2|L3 Larva	N2	ChIP-Seq
SRX494949	SRA146809	seq-SDQ2354_HDA1_N2_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2354_HDA1_N2_L3_ChIP_Rep1;_Caenorhabditi...	seq-SDQ2354_HDA1_N2_L3_ChIP_Rep1	seq-SDQ2354_HDA1_N2_L3...	N2|seq-SDQ2354_HDA1_N2_L3_ChIP_Rep1|L3 Larva	N2	ChIP-Seq
SRX494950	SRA146809	seq-SDQ2354_HDA1_N2_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2354_HDA1_N2_L3_ChIP_Rep2;_Caenorhabditi...	seq-SDQ2354_HDA1_N2_L3_ChIP_Rep2	seq-SDQ2354_HDA1_N2_L3...	N2|seq-SDQ2354_HDA1_N2_L3_ChIP_Rep2|L3 Larva	N2	ChIP-Seq
SRX494951	SRA146810	seq-SDQ3861_LET418_N2_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3861_LET418_N2_L3_Input_Rep1;_Caenorhabd...	seq-SDQ3861_LET418_N2_L3_Input_Rep1	seq-SDQ3861_LET418_N2_...	N2|seq-SDQ3861_LET418_N2_L3_Input_Rep1|L3 Larva	N2	ChIP-Seq
SRX494952	SRA146810	seq-SDQ3861_LET418_N2_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3861_LET418_N2_L3_ChIP_Rep1;_Caenorhabdi...	seq-SDQ3861_LET418_N2_L3_ChIP_Rep1	seq-SDQ3861_LET418_N2_...	N2|seq-SDQ3861_LET418_N2_L3_ChIP_Rep1|L3 Larva	N2	ChIP-Seq
SRX494954	SRA146811	seq-SDQ2342_LET418_N2_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2342_LET418_N2_L3_Input_Rep1;_Caenorhabd...	seq-SDQ2342_LET418_N2_L3_Input_Rep1	seq-SDQ2342_LET418_N2_...	N2|seq-SDQ2342_LET418_N2_L3_Input_Rep1|L3 Larva	N2	ChIP-Seq
SRX494955	SRA146811	seq-SDQ2342_LET418_N2_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2342_LET418_N2_L3_Input_Rep2;_Caenorhabd...	seq-SDQ2342_LET418_N2_L3_Input_Rep2	seq-SDQ2342_LET418_N2_...	N2|seq-SDQ2342_LET418_N2_L3_Input_Rep2|L3 Larva	N2	ChIP-Seq
SRX494956	SRA146811	seq-SDQ2342_LET418_N2_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2342_LET418_N2_L3_ChIP_Rep1;_Caenorhabdi...	seq-SDQ2342_LET418_N2_L3_ChIP_Rep1	seq-SDQ2342_LET418_N2_...	N2|seq-SDQ2342_LET418_N2_L3_ChIP_Rep1|L3 Larva	N2	ChIP-Seq
SRX494957	SRA146811	seq-SDQ2342_LET418_N2_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2342_LET418_N2_L3_ChIP_Rep2;_Caenorhabdi...	seq-SDQ2342_LET418_N2_L3_ChIP_Rep2	seq-SDQ2342_LET418_N2_...	N2|seq-SDQ2342_LET418_N2_L3_ChIP_Rep2|L3 Larva	N2	ChIP-Seq
SRX494958	SRA146812	seq-HM4077_LIN61_N2_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-HM4077_LIN61_N2_L3_Input_Rep1;_Caenorhabdit...	seq-HM4077_LIN61_N2_L3_Input_Rep1	seq-HM4077_LIN61_N2_L3...	N2|seq-HM4077_LIN61_N2_L3_Input_Rep1|L3 Larva	N2	ChIP-Seq
SRX494959	SRA146812	seq-HM4077_LIN61_N2_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-HM4077_LIN61_N2_L3_Input_Rep2;_Caenorhabdit...	seq-HM4077_LIN61_N2_L3_Input_Rep2	seq-HM4077_LIN61_N2_L3...	N2|seq-HM4077_LIN61_N2_L3_Input_Rep2|L3 Larva	N2	ChIP-Seq
SRX494960	SRA146812	seq-HM4077_LIN61_N2_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-HM4077_LIN61_N2_L3_ChIP_Rep1;_Caenorhabditi...	seq-HM4077_LIN61_N2_L3_ChIP_Rep1	seq-HM4077_LIN61_N2_L3...	N2|seq-HM4077_LIN61_N2_L3_ChIP_Rep1|L3 Larva	N2	ChIP-Seq
SRX494961	SRA146812	seq-HM4077_LIN61_N2_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-HM4077_LIN61_N2_L3_ChIP_Rep2;_Caenorhabditi...	seq-HM4077_LIN61_N2_L3_ChIP_Rep2	seq-HM4077_LIN61_N2_L3...	N2|seq-HM4077_LIN61_N2_L3_ChIP_Rep2|L3 Larva	N2	ChIP-Seq
SRX494962	SRA146813	seq-SDQ2940_NURF1_N2_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2940_NURF1_N2_L3_Input_Rep1;_Caenorhabdi...	seq-SDQ2940_NURF1_N2_L3_Input_Rep1	seq-SDQ2940_NURF1_N2_L...	N2|seq-SDQ2940_NURF1_N2_L3_Input_Rep1|L3 Larva	N2	ChIP-Seq
SRX494963	SRA146813	seq-SDQ2940_NURF1_N2_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2940_NURF1_N2_L3_Input_Rep2;_Caenorhabdi...	seq-SDQ2940_NURF1_N2_L3_Input_Rep2	seq-SDQ2940_NURF1_N2_L...	N2|seq-SDQ2940_NURF1_N2_L3_Input_Rep2|L3 Larva	N2	ChIP-Seq
SRX494964	SRA146813	seq-SDQ2940_NURF1_N2_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2940_NURF1_N2_L3_ChIP_Rep1;_Caenorhabdit...	seq-SDQ2940_NURF1_N2_L3_ChIP_Rep1	seq-SDQ2940_NURF1_N2_L...	N2|seq-SDQ2940_NURF1_N2_L3_ChIP_Rep1|L3 Larva	N2	ChIP-Seq
SRX494965	SRA146813	seq-SDQ2940_NURF1_N2_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2940_NURF1_N2_L3_ChIP_Rep2;_Caenorhabdit...	seq-SDQ2940_NURF1_N2_L3_ChIP_Rep2	seq-SDQ2940_NURF1_N2_L...	N2|seq-SDQ2940_NURF1_N2_L3_ChIP_Rep2|L3 Larva	N2	ChIP-Seq
SRX494966	SRA146814	seq-SDQ3525_NURF1_N2_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3525_NURF1_N2_L3_Input_Rep1;_Caenorhabdi...	seq-SDQ3525_NURF1_N2_L3_Input_Rep1	seq-SDQ3525_NURF1_N2_L...	N2|seq-SDQ3525_NURF1_N2_L3_Input_Rep1|L3 Larva	N2	ChIP-Seq
SRX494967	SRA146814	seq-SDQ3525_NURF1_N2_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3525_NURF1_N2_L3_Input_Rep2;_Caenorhabdi...	seq-SDQ3525_NURF1_N2_L3_Input_Rep2	seq-SDQ3525_NURF1_N2_L...	N2|seq-SDQ3525_NURF1_N2_L3_Input_Rep2|L3 Larva	N2	ChIP-Seq
SRX494968	SRA146814	seq-SDQ3525_NURF1_N2_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3525_NURF1_N2_L3_ChIP_Rep1;_Caenorhabdit...	seq-SDQ3525_NURF1_N2_L3_ChIP_Rep1	seq-SDQ3525_NURF1_N2_L...	N2|seq-SDQ3525_NURF1_N2_L3_ChIP_Rep1|L3 Larva	N2	ChIP-Seq
SRX494969	SRA146814	seq-SDQ3525_NURF1_N2_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3525_NURF1_N2_L3_ChIP_Rep2;_Caenorhabdit...	seq-SDQ3525_NURF1_N2_L3_ChIP_Rep2	seq-SDQ3525_NURF1_N2_L...	N2|seq-SDQ3525_NURF1_N2_L3_ChIP_Rep2|L3 Larva	N2	ChIP-Seq
SRX494970	SRA146815	seq-SDQ3528_NURF1_N2_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3528_NURF1_N2_L3_Input_Rep1;_Caenorhabdi...	seq-SDQ3528_NURF1_N2_L3_Input_Rep1	seq-SDQ3528_NURF1_N2_L...	N2|seq-SDQ3528_NURF1_N2_L3_Input_Rep1|L3 Larva	N2	ChIP-Seq
SRX494971	SRA146815	seq-SDQ3528_NURF1_N2_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3528_NURF1_N2_L3_Input_Rep2;_Caenorhabdi...	seq-SDQ3528_NURF1_N2_L3_Input_Rep2	seq-SDQ3528_NURF1_N2_L...	N2|seq-SDQ3528_NURF1_N2_L3_Input_Rep2|L3 Larva	N2	ChIP-Seq
SRX494972	SRA146815	seq-SDQ3528_NURF1_N2_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3528_NURF1_N2_L3_ChIP_Rep1;_Caenorhabdit...	seq-SDQ3528_NURF1_N2_L3_ChIP_Rep1	seq-SDQ3528_NURF1_N2_L...	N2|seq-SDQ3528_NURF1_N2_L3_ChIP_Rep1|L3 Larva	N2	ChIP-Seq
SRX494973	SRA146815	seq-SDQ3528_NURF1_N2_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3528_NURF1_N2_L3_ChIP_Rep2;_Caenorhabdit...	seq-SDQ3528_NURF1_N2_L3_ChIP_Rep2	seq-SDQ3528_NURF1_N2_L...	N2|seq-SDQ3528_NURF1_N2_L3_ChIP_Rep2|L3 Larva	N2	ChIP-Seq
SRX494974	SRA146816	seq-ab15823_H4K8ac_487128_N2_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab15823_H4K8ac_487128_N2_L3_Input_Rep1;_Cae...	seq-ab15823_H4K8ac_487128_N2_L3_Input_Rep1	seq-ab15823_H4K8ac_487...	N2|seq-ab15823_H4K8ac_487128_N2_L3_Input_Rep1|L3 Larva	N2	ChIP-Seq
SRX494975	SRA146816	seq-ab15823_H4K8ac_487128_N2_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab15823_H4K8ac_487128_N2_L3_Input_Rep2;_Cae...	seq-ab15823_H4K8ac_487128_N2_L3_Input_Rep2	seq-ab15823_H4K8ac_487...	N2|seq-ab15823_H4K8ac_487128_N2_L3_Input_Rep2|L3 Larva	N2	ChIP-Seq
SRX494976	SRA146816	seq-ab15823_H4K8ac_487128_N2_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab15823_H4K8ac_487128_N2_L3_ChIP_Rep1;_Caen...	seq-ab15823_H4K8ac_487128_N2_L3_ChIP_Rep1	seq-ab15823_H4K8ac_487...	N2|seq-ab15823_H4K8ac_487128_N2_L3_ChIP_Rep1|L3 Larva	N2	ChIP-Seq
SRX494977	SRA146816	seq-ab15823_H4K8ac_487128_N2_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab15823_H4K8ac_487128_N2_L3_ChIP_Rep2;_Caen...	seq-ab15823_H4K8ac_487128_N2_L3_ChIP_Rep2	seq-ab15823_H4K8ac_487...	N2|seq-ab15823_H4K8ac_487128_N2_L3_ChIP_Rep2|L3 Larva	N2	ChIP-Seq
SRX494978	SRA146817	seq-SDQ4625_T09A5.8_FEM2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4625_T09A5.8_FEM2_AD_Input_Rep1;_Caenorh...	seq-SDQ4625_T09A5.8_FEM2_AD_Input_Rep1	seq-SDQ4625_T09A5.8_FE...	fem-2(b245)|seq-SDQ4625_T09A5.8_FEM2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494979	SRA146817	seq-SDQ4625_T09A5.8_FEM2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4625_T09A5.8_FEM2_AD_Input_Rep2;_Caenorh...	seq-SDQ4625_T09A5.8_FEM2_AD_Input_Rep2	seq-SDQ4625_T09A5.8_FE...	fem-2(b245)|seq-SDQ4625_T09A5.8_FEM2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494980	SRA146817	seq-SDQ4625_T09A5.8_FEM2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4625_T09A5.8_FEM2_AD_ChIP_Rep1;_Caenorha...	seq-SDQ4625_T09A5.8_FEM2_AD_ChIP_Rep1	seq-SDQ4625_T09A5.8_FE...	fem-2(b245)|seq-SDQ4625_T09A5.8_FEM2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494981	SRA146817	seq-SDQ4625_T09A5.8_FEM2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4625_T09A5.8_FEM2_AD_ChIP_Rep2;_Caenorha...	seq-SDQ4625_T09A5.8_FEM2_AD_ChIP_Rep2	seq-SDQ4625_T09A5.8_FE...	fem-2(b245)|seq-SDQ4625_T09A5.8_FEM2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX494982	SRA146818	seq-ab9051_H4K20me1_TY1072_Mxemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab9051_H4K20me1_TY1072_Mxemb_Input_Rep1;_Ca...	seq-ab9051_H4K20me1_TY1072_Mxemb_Input_Rep1	seq-ab9051_H4K20me1_TY...	TY1072|seq-ab9051_H4K20me1_TY1072_Mxemb_Input_Rep1|Mixed Embryo	TY1072	ChIP-Seq
SRX494983	SRA146818	seq-ab9051_H4K20me1_TY1072_Mxemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab9051_H4K20me1_TY1072_Mxemb_Input_Rep2;_Ca...	seq-ab9051_H4K20me1_TY1072_Mxemb_Input_Rep2	seq-ab9051_H4K20me1_TY...	TY1072|seq-ab9051_H4K20me1_TY1072_Mxemb_Input_Rep2|Mixed Embryo	TY1072	ChIP-Seq
SRX494984	SRA146818	seq-ab9051_H4K20me1_TY1072_Mxemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab9051_H4K20me1_TY1072_Mxemb_ChIP_Rep1;_Cae...	seq-ab9051_H4K20me1_TY1072_Mxemb_ChIP_Rep1	seq-ab9051_H4K20me1_TY...	TY1072|seq-ab9051_H4K20me1_TY1072_Mxemb_ChIP_Rep1|Mixed Embryo	TY1072	ChIP-Seq
SRX494985	SRA146818	seq-ab9051_H4K20me1_TY1072_Mxemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab9051_H4K20me1_TY1072_Mxemb_ChIP_Rep2;_Cae...	seq-ab9051_H4K20me1_TY1072_Mxemb_ChIP_Rep2	seq-ab9051_H4K20me1_TY...	TY1072|seq-ab9051_H4K20me1_TY1072_Mxemb_ChIP_Rep2|Mixed Embryo	TY1072	ChIP-Seq
SRX494986	SRA146819	seq-JL00006_ZFP1_N2_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-JL00006_ZFP1_N2_L3_Input_Rep1;_Caenorhabdit...	seq-JL00006_ZFP1_N2_L3_Input_Rep1	seq-JL00006_ZFP1_N2_L3...	N2|seq-JL00006_ZFP1_N2_L3_Input_Rep1|L3 Larva	N2	ChIP-Seq
SRX494987	SRA146819	seq-JL00006_ZFP1_N2_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-JL00006_ZFP1_N2_L3_Input_Rep2;_Caenorhabdit...	seq-JL00006_ZFP1_N2_L3_Input_Rep2	seq-JL00006_ZFP1_N2_L3...	N2|seq-JL00006_ZFP1_N2_L3_Input_Rep2|L3 Larva	N2	ChIP-Seq
SRX494988	SRA146819	seq-JL00006_ZFP1_N2_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-JL00006_ZFP1_N2_L3_ChIP_Rep1;_Caenorhabditi...	seq-JL00006_ZFP1_N2_L3_ChIP_Rep1	seq-JL00006_ZFP1_N2_L3...	N2|seq-JL00006_ZFP1_N2_L3_ChIP_Rep1|L3 Larva	N2	ChIP-Seq
SRX494989	SRA146819	seq-JL00006_ZFP1_N2_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-JL00006_ZFP1_N2_L3_ChIP_Rep2;_Caenorhabditi...	seq-JL00006_ZFP1_N2_L3_ChIP_Rep2	seq-JL00006_ZFP1_N2_L3...	N2|seq-JL00006_ZFP1_N2_L3_ChIP_Rep2|L3 Larva	N2	ChIP-Seq
SRX494990	SRA146820	seq-NBP170893_HTZ1_N2_Mxemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-NBP170893_HTZ1_N2_Mxemb_Input_Rep1;_Caenorh...	seq-NBP170893_HTZ1_N2_Mxemb_Input_Rep1	seq-NBP170893_HTZ1_N2_...	N2|seq-NBP170893_HTZ1_N2_Mxemb_Input_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX494991	SRA146820	seq-NBP170893_HTZ1_N2_Mxemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-NBP170893_HTZ1_N2_Mxemb_Input_Rep2;_Caenorh...	seq-NBP170893_HTZ1_N2_Mxemb_Input_Rep2	seq-NBP170893_HTZ1_N2_...	N2|seq-NBP170893_HTZ1_N2_Mxemb_Input_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX494992	SRA146820	seq-NBP170893_HTZ1_N2_Mxemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-NBP170893_HTZ1_N2_Mxemb_ChIP_Rep1;_Caenorha...	seq-NBP170893_HTZ1_N2_Mxemb_ChIP_Rep1	seq-NBP170893_HTZ1_N2_...	N2|seq-NBP170893_HTZ1_N2_Mxemb_ChIP_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX494993	SRA146820	seq-NBP170893_HTZ1_N2_Mxemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-NBP170893_HTZ1_N2_Mxemb_ChIP_Rep2;_Caenorha...	seq-NBP170893_HTZ1_N2_Mxemb_ChIP_Rep2	seq-NBP170893_HTZ1_N2_...	N2|seq-NBP170893_HTZ1_N2_Mxemb_ChIP_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX494994	SRA146821	seq-OD0039_SMC4_N2_Mxemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-OD0039_SMC4_N2_Mxemb_Input_Rep1;_Caenorhabd...	seq-OD0039_SMC4_N2_Mxemb_Input_Rep1	seq-OD0039_SMC4_N2_Mxe...	N2|seq-OD0039_SMC4_N2_Mxemb_Input_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX494995	SRA146821	seq-OD0039_SMC4_N2_Mxemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-OD0039_SMC4_N2_Mxemb_Input_Rep2;_Caenorhabd...	seq-OD0039_SMC4_N2_Mxemb_Input_Rep2	seq-OD0039_SMC4_N2_Mxe...	N2|seq-OD0039_SMC4_N2_Mxemb_Input_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX494996	SRA146821	seq-OD0039_SMC4_N2_Mxemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-OD0039_SMC4_N2_Mxemb_ChIP_Rep2;_Caenorhabdi...	seq-OD0039_SMC4_N2_Mxemb_ChIP_Rep2	seq-OD0039_SMC4_N2_Mxe...	N2|seq-OD0039_SMC4_N2_Mxemb_ChIP_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX494997	SRA146822	seq-SDQ0839_TBP1_N2_Mxemb_EE_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ0839_TBP1_N2_Mxemb_EE_Input_Rep1;_Caenor...	seq-SDQ0839_TBP1_N2_Mxemb_EE_Input_Rep1	seq-SDQ0839_TBP1_N2_Mx...	N2|seq-SDQ0839_TBP1_N2_Mxemb_EE_Input_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX494998	SRA146822	seq-SDQ0839_TBP1_N2_Mxemb_EE_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ0839_TBP1_N2_Mxemb_EE_Input_Rep2;_Caenor...	seq-SDQ0839_TBP1_N2_Mxemb_EE_Input_Rep2	seq-SDQ0839_TBP1_N2_Mx...	N2|seq-SDQ0839_TBP1_N2_Mxemb_EE_Input_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX494999	SRA146822	seq-SDQ0839_TBP1_N2_Mxemb_EE_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ0839_TBP1_N2_Mxemb_EE_ChIP_Rep1;_Caenorh...	seq-SDQ0839_TBP1_N2_Mxemb_EE_ChIP_Rep1	seq-SDQ0839_TBP1_N2_Mx...	N2|seq-SDQ0839_TBP1_N2_Mxemb_EE_ChIP_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX495000	SRA146822	seq-SDQ0839_TBP1_N2_Mxemb_EE_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ0839_TBP1_N2_Mxemb_EE_ChIP_Rep2;_Caenorh...	seq-SDQ0839_TBP1_N2_Mxemb_EE_ChIP_Rep2	seq-SDQ0839_TBP1_N2_Mx...	N2|seq-SDQ0839_TBP1_N2_Mxemb_EE_ChIP_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX495001	SRA146823	seq-SDQ2357Q2358_AMA1_N2_Mxemb_EE_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2357Q2358_AMA1_N2_Mxemb_EE_Input_Rep1;_C...	seq-SDQ2357Q2358_AMA1_N2_Mxemb_EE_Input_Rep1	seq-SDQ2357Q2358_AMA1_...	N2|seq-SDQ2357Q2358_AMA1_N2_Mxemb_EE_Input_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX495002	SRA146823	seq-SDQ2357Q2358_AMA1_N2_Mxemb_EE_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2357Q2358_AMA1_N2_Mxemb_EE_Input_Rep2;_C...	seq-SDQ2357Q2358_AMA1_N2_Mxemb_EE_Input_Rep2	seq-SDQ2357Q2358_AMA1_...	N2|seq-SDQ2357Q2358_AMA1_N2_Mxemb_EE_Input_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX495003	SRA146823	seq-SDQ2357Q2358_AMA1_N2_Mxemb_EE_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2357Q2358_AMA1_N2_Mxemb_EE_ChIP_Rep1;_Ca...	seq-SDQ2357Q2358_AMA1_N2_Mxemb_EE_ChIP_Rep1	seq-SDQ2357Q2358_AMA1_...	N2|seq-SDQ2357Q2358_AMA1_N2_Mxemb_EE_ChIP_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX495004	SRA146823	seq-SDQ2357Q2358_AMA1_N2_Mxemb_EE_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2357Q2358_AMA1_N2_Mxemb_EE_ChIP_Rep2;_Ca...	seq-SDQ2357Q2358_AMA1_N2_Mxemb_EE_ChIP_Rep2	seq-SDQ2357Q2358_AMA1_...	N2|seq-SDQ2357Q2358_AMA1_N2_Mxemb_EE_ChIP_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX495005	SRA146824	seq-SDQ2357Q2358_AMA1_N2_Mxemb_RiIMB1_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2357Q2358_AMA1_N2_Mxemb_RiIMB1_Input_Rep...	seq-SDQ2357Q2358_AMA1_N2_Mxemb_RiIMB1_Input_Rep1	seq-SDQ2357Q2358_AMA1_...	N2|seq-SDQ2357Q2358_AMA1_N2_Mxemb_RiIMB1_Input_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX495006	SRA146824	seq-SDQ2357Q2358_AMA1_N2_Mxemb_RiIMB1_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2357Q2358_AMA1_N2_Mxemb_RiIMB1_Input_Rep...	seq-SDQ2357Q2358_AMA1_N2_Mxemb_RiIMB1_Input_Rep2	seq-SDQ2357Q2358_AMA1_...	N2|seq-SDQ2357Q2358_AMA1_N2_Mxemb_RiIMB1_Input_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX495007	SRA146824	seq-SDQ2357Q2358_AMA1_N2_Mxemb_RiIMB1_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2357Q2358_AMA1_N2_Mxemb_RiIMB1_ChIP_Rep1...	seq-SDQ2357Q2358_AMA1_N2_Mxemb_RiIMB1_ChIP_Rep1	seq-SDQ2357Q2358_AMA1_...	N2|seq-SDQ2357Q2358_AMA1_N2_Mxemb_RiIMB1_ChIP_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX495008	SRA146824	seq-SDQ2357Q2358_AMA1_N2_Mxemb_RiIMB1_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2357Q2358_AMA1_N2_Mxemb_RiIMB1_ChIP_Rep2...	seq-SDQ2357Q2358_AMA1_N2_Mxemb_RiIMB1_ChIP_Rep2	seq-SDQ2357Q2358_AMA1_...	N2|seq-SDQ2357Q2358_AMA1_N2_Mxemb_RiIMB1_ChIP_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX495009	SRA146825	seq-SDQ3499_DPY30_N2_Mxemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3499_DPY30_N2_Mxemb_Input_Rep1;_Caenorha...	seq-SDQ3499_DPY30_N2_Mxemb_Input_Rep1	seq-SDQ3499_DPY30_N2_M...	N2|seq-SDQ3499_DPY30_N2_Mxemb_Input_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX495010	SRA146825	seq-SDQ3499_DPY30_N2_Mxemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3499_DPY30_N2_Mxemb_Input_Rep2;_Caenorha...	seq-SDQ3499_DPY30_N2_Mxemb_Input_Rep2	seq-SDQ3499_DPY30_N2_M...	N2|seq-SDQ3499_DPY30_N2_Mxemb_Input_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX495011	SRA146825	seq-SDQ3499_DPY30_N2_Mxemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3499_DPY30_N2_Mxemb_ChIP_Rep1;_Caenorhab...	seq-SDQ3499_DPY30_N2_Mxemb_ChIP_Rep1	seq-SDQ3499_DPY30_N2_M...	N2|seq-SDQ3499_DPY30_N2_Mxemb_ChIP_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX495012	SRA146825	seq-SDQ3499_DPY30_N2_Mxemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3499_DPY30_N2_Mxemb_ChIP_Rep2;_Caenorhab...	seq-SDQ3499_DPY30_N2_Mxemb_ChIP_Rep2	seq-SDQ3499_DPY30_N2_M...	N2|seq-SDQ3499_DPY30_N2_Mxemb_ChIP_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX495013	SRA146826	seq-SDQ3582_CBP1_N2_Mxemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3582_CBP1_N2_Mxemb_Input_Rep1;_Caenorhab...	seq-SDQ3582_CBP1_N2_Mxemb_Input_Rep1	seq-SDQ3582_CBP1_N2_Mx...	N2|seq-SDQ3582_CBP1_N2_Mxemb_Input_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX495014	SRA146826	seq-SDQ3582_CBP1_N2_Mxemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3582_CBP1_N2_Mxemb_Input_Rep2;_Caenorhab...	seq-SDQ3582_CBP1_N2_Mxemb_Input_Rep2	seq-SDQ3582_CBP1_N2_Mx...	N2|seq-SDQ3582_CBP1_N2_Mxemb_Input_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX495015	SRA146826	seq-SDQ3582_CBP1_N2_Mxemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3582_CBP1_N2_Mxemb_ChIP_Rep1;_Caenorhabd...	seq-SDQ3582_CBP1_N2_Mxemb_ChIP_Rep1	seq-SDQ3582_CBP1_N2_Mx...	N2|seq-SDQ3582_CBP1_N2_Mxemb_ChIP_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX495016	SRA146826	seq-SDQ3582_CBP1_N2_Mxemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3582_CBP1_N2_Mxemb_ChIP_Rep2;_Caenorhabd...	seq-SDQ3582_CBP1_N2_Mxemb_ChIP_Rep2	seq-SDQ3582_CBP1_N2_Mx...	N2|seq-SDQ3582_CBP1_N2_Mxemb_ChIP_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX495017	SRA146827	seq-SDQ3856_SDC1_N2_Mxemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3856_SDC1_N2_Mxemb_Input_Rep1;_Caenorhab...	seq-SDQ3856_SDC1_N2_Mxemb_Input_Rep1	seq-SDQ3856_SDC1_N2_Mx...	N2|seq-SDQ3856_SDC1_N2_Mxemb_Input_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX495018	SRA146827	seq-SDQ3856_SDC1_N2_Mxemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3856_SDC1_N2_Mxemb_Input_Rep2;_Caenorhab...	seq-SDQ3856_SDC1_N2_Mxemb_Input_Rep2	seq-SDQ3856_SDC1_N2_Mx...	N2|seq-SDQ3856_SDC1_N2_Mxemb_Input_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX495019	SRA146827	seq-SDQ3856_SDC1_N2_Mxemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3856_SDC1_N2_Mxemb_ChIP_Rep1;_Caenorhabd...	seq-SDQ3856_SDC1_N2_Mxemb_ChIP_Rep1	seq-SDQ3856_SDC1_N2_Mx...	N2|seq-SDQ3856_SDC1_N2_Mxemb_ChIP_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX495020	SRA146827	seq-SDQ3856_SDC1_N2_Mxemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3856_SDC1_N2_Mxemb_ChIP_Rep2;_Caenorhabd...	seq-SDQ3856_SDC1_N2_Mxemb_ChIP_Rep2	seq-SDQ3856_SDC1_N2_Mx...	N2|seq-SDQ3856_SDC1_N2_Mxemb_ChIP_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX495021	SRA146828	seq-SDQ3892_MIX1_N2_Mxemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3892_MIX1_N2_Mxemb_Input_Rep1;_Caenorhab...	seq-SDQ3892_MIX1_N2_Mxemb_Input_Rep1	seq-SDQ3892_MIX1_N2_Mx...	N2|seq-SDQ3892_MIX1_N2_Mxemb_Input_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX495022	SRA146828	seq-SDQ3892_MIX1_N2_Mxemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3892_MIX1_N2_Mxemb_Input_Rep2;_Caenorhab...	seq-SDQ3892_MIX1_N2_Mxemb_Input_Rep2	seq-SDQ3892_MIX1_N2_Mx...	N2|seq-SDQ3892_MIX1_N2_Mxemb_Input_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX495023	SRA146828	seq-SDQ3892_MIX1_N2_Mxemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3892_MIX1_N2_Mxemb_ChIP_Rep1;_Caenorhabd...	seq-SDQ3892_MIX1_N2_Mxemb_ChIP_Rep1	seq-SDQ3892_MIX1_N2_Mx...	N2|seq-SDQ3892_MIX1_N2_Mxemb_ChIP_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX495024	SRA146828	seq-SDQ3892_MIX1_N2_Mxemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3892_MIX1_N2_Mxemb_ChIP_Rep2;_Caenorhabd...	seq-SDQ3892_MIX1_N2_Mxemb_ChIP_Rep2	seq-SDQ3892_MIX1_N2_Mx...	N2|seq-SDQ3892_MIX1_N2_Mxemb_ChIP_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX495025	SRA146829	seq-Ab9048_H3K36me1_fem2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-Ab9048_H3K36me1_fem2_AD_Input_Rep1;_Caenorh...	seq-Ab9048_H3K36me1_fem2_AD_Input_Rep1	seq-Ab9048_H3K36me1_fe...	fem-2(b245)|seq-Ab9048_H3K36me1_fem2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495026	SRA146829	seq-Ab9048_H3K36me1_fem2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-Ab9048_H3K36me1_fem2_AD_Input_Rep2;_Caenorh...	seq-Ab9048_H3K36me1_fem2_AD_Input_Rep2	seq-Ab9048_H3K36me1_fe...	fem-2(b245)|seq-Ab9048_H3K36me1_fem2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495027	SRA146829	seq-Ab9048_H3K36me1_fem2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-Ab9048_H3K36me1_fem2_AD_ChIP_Rep1;_Caenorha...	seq-Ab9048_H3K36me1_fem2_AD_ChIP_Rep1	seq-Ab9048_H3K36me1_fe...	fem-2(b245)|seq-Ab9048_H3K36me1_fem2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495028	SRA146829	seq-Ab9048_H3K36me1_fem2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-Ab9048_H3K36me1_fem2_AD_ChIP_Rep2;_Caenorha...	seq-Ab9048_H3K36me1_fem2_AD_ChIP_Rep2	seq-Ab9048_H3K36me1_fe...	fem-2(b245)|seq-Ab9048_H3K36me1_fem2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495029	SRA146830	seq-Ab8895_H3K4me1_fem2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-Ab8895_H3K4me1_fem2_AD_Input_Rep1;_Caenorha...	seq-Ab8895_H3K4me1_fem2_AD_Input_Rep1	seq-Ab8895_H3K4me1_fem...	fem-2(b245)|seq-Ab8895_H3K4me1_fem2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495030	SRA146830	seq-Ab8895_H3K4me1_fem2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-Ab8895_H3K4me1_fem2_AD_Input_Rep2;_Caenorha...	seq-Ab8895_H3K4me1_fem2_AD_Input_Rep2	seq-Ab8895_H3K4me1_fem...	fem-2(b245)|seq-Ab8895_H3K4me1_fem2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495031	SRA146830	seq-Ab8895_H3K4me1_fem2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-Ab8895_H3K4me1_fem2_AD_ChIP_Rep1;_Caenorhab...	seq-Ab8895_H3K4me1_fem2_AD_ChIP_Rep1	seq-Ab8895_H3K4me1_fem...	fem-2(b245)|seq-Ab8895_H3K4me1_fem2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495032	SRA146830	seq-Ab8895_H3K4me1_fem2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-Ab8895_H3K4me1_fem2_AD_ChIP_Rep2;_Caenorhab...	seq-Ab8895_H3K4me1_fem2_AD_ChIP_Rep2	seq-Ab8895_H3K4me1_fem...	fem-2(b245)|seq-Ab8895_H3K4me1_fem2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495033	SRA146831	seq-SDQ4109_TAF1_N2_Mxemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4109_TAF1_N2_Mxemb_Input_Rep1;_Caenorhab...	seq-SDQ4109_TAF1_N2_Mxemb_Input_Rep1	seq-SDQ4109_TAF1_N2_Mx...	N2|seq-SDQ4109_TAF1_N2_Mxemb_Input_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX495034	SRA146831	seq-SDQ4109_TAF1_N2_Mxemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4109_TAF1_N2_Mxemb_Input_Rep2;_Caenorhab...	seq-SDQ4109_TAF1_N2_Mxemb_Input_Rep2	seq-SDQ4109_TAF1_N2_Mx...	N2|seq-SDQ4109_TAF1_N2_Mxemb_Input_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX495035	SRA146831	seq-SDQ4109_TAF1_N2_Mxemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4109_TAF1_N2_Mxemb_ChIP_Rep1;_Caenorhabd...	seq-SDQ4109_TAF1_N2_Mxemb_ChIP_Rep1	seq-SDQ4109_TAF1_N2_Mx...	N2|seq-SDQ4109_TAF1_N2_Mxemb_ChIP_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX495036	SRA146831	seq-SDQ4109_TAF1_N2_Mxemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4109_TAF1_N2_Mxemb_ChIP_Rep2;_Caenorhabd...	seq-SDQ4109_TAF1_N2_Mxemb_ChIP_Rep2	seq-SDQ4109_TAF1_N2_Mx...	N2|seq-SDQ4109_TAF1_N2_Mxemb_ChIP_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX495037	SRA146832	seq-Ab6002_H3K27me3_fem2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-Ab6002_H3K27me3_fem2_AD_Input_Rep1;_Caenorh...	seq-Ab6002_H3K27me3_fem2_AD_Input_Rep1	seq-Ab6002_H3K27me3_fe...	fem-2(b245)|seq-Ab6002_H3K27me3_fem2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495038	SRA146832	seq-Ab6002_H3K27me3_fem2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-Ab6002_H3K27me3_fem2_AD_Input_Rep2;_Caenorh...	seq-Ab6002_H3K27me3_fem2_AD_Input_Rep2	seq-Ab6002_H3K27me3_fe...	fem-2(b245)|seq-Ab6002_H3K27me3_fem2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495039	SRA146832	seq-Ab6002_H3K27me3_fem2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-Ab6002_H3K27me3_fem2_AD_ChIP_Rep1;_Caenorha...	seq-Ab6002_H3K27me3_fem2_AD_ChIP_Rep1	seq-Ab6002_H3K27me3_fe...	fem-2(b245)|seq-Ab6002_H3K27me3_fem2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495040	SRA146832	seq-Ab6002_H3K27me3_fem2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-Ab6002_H3K27me3_fem2_AD_ChIP_Rep2;_Caenorha...	seq-Ab6002_H3K27me3_fem2_AD_ChIP_Rep2	seq-Ab6002_H3K27me3_fe...	fem-2(b245)|seq-Ab6002_H3K27me3_fem2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495041	SRA146833	seq-HK00001-H3K36me3_13C9_fem2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00001-H3K36me3_13C9_fem2_AD_Input_Rep1;_C...	seq-HK00001-H3K36me3_13C9_fem2_AD_Input_Rep1	seq-HK00001-H3K36me3_1...	fem-2(b245)|seq-HK00001-H3K36me3_13C9_fem2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495042	SRA146833	seq-HK00001-H3K36me3_13C9_fem2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00001-H3K36me3_13C9_fem2_AD_Input_Rep2;_C...	seq-HK00001-H3K36me3_13C9_fem2_AD_Input_Rep2	seq-HK00001-H3K36me3_1...	fem-2(b245)|seq-HK00001-H3K36me3_13C9_fem2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495043	SRA146833	seq-HK00001-H3K36me3_13C9_fem2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00001-H3K36me3_13C9_fem2_AD_ChIP_Rep1;_Ca...	seq-HK00001-H3K36me3_13C9_fem2_AD_ChIP_Rep1	seq-HK00001-H3K36me3_1...	fem-2(b245)|seq-HK00001-H3K36me3_13C9_fem2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495044	SRA146833	seq-HK00001-H3K36me3_13C9_fem2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-HK00001-H3K36me3_13C9_fem2_AD_ChIP_Rep2;_Ca...	seq-HK00001-H3K36me3_13C9_fem2_AD_ChIP_Rep2	seq-HK00001-H3K36me3_1...	fem-2(b245)|seq-HK00001-H3K36me3_13C9_fem2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495045	SRA146834	seq-SDQ4154_IMB1_N2_Mxemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4154_IMB1_N2_Mxemb_Input_Rep1;_Caenorhab...	seq-SDQ4154_IMB1_N2_Mxemb_Input_Rep1	seq-SDQ4154_IMB1_N2_Mx...	N2|seq-SDQ4154_IMB1_N2_Mxemb_Input_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX495046	SRA146834	seq-SDQ4154_IMB1_N2_Mxemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4154_IMB1_N2_Mxemb_Input_Rep2;_Caenorhab...	seq-SDQ4154_IMB1_N2_Mxemb_Input_Rep2	seq-SDQ4154_IMB1_N2_Mx...	N2|seq-SDQ4154_IMB1_N2_Mxemb_Input_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX495047	SRA146834	seq-SDQ4154_IMB1_N2_Mxemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4154_IMB1_N2_Mxemb_ChIP_Rep1;_Caenorhabd...	seq-SDQ4154_IMB1_N2_Mxemb_ChIP_Rep1	seq-SDQ4154_IMB1_N2_Mx...	N2|seq-SDQ4154_IMB1_N2_Mxemb_ChIP_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX495048	SRA146834	seq-SDQ4154_IMB1_N2_Mxemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4154_IMB1_N2_Mxemb_ChIP_Rep2;_Caenorhabd...	seq-SDQ4154_IMB1_N2_Mxemb_ChIP_Rep2	seq-SDQ4154_IMB1_N2_Mx...	N2|seq-SDQ4154_IMB1_N2_Mxemb_ChIP_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX495049	SRA146835	seq-SDQ4481_PQN85_N2_Mxemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4481_PQN85_N2_Mxemb_Input_Rep1;_Caenorha...	seq-SDQ4481_PQN85_N2_Mxemb_Input_Rep1	seq-SDQ4481_PQN85_N2_M...	N2|seq-SDQ4481_PQN85_N2_Mxemb_Input_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX495050	SRA146835	seq-SDQ4481_PQN85_N2_Mxemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4481_PQN85_N2_Mxemb_Input_Rep2;_Caenorha...	seq-SDQ4481_PQN85_N2_Mxemb_Input_Rep2	seq-SDQ4481_PQN85_N2_M...	N2|seq-SDQ4481_PQN85_N2_Mxemb_Input_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX495051	SRA146835	seq-SDQ4481_PQN85_N2_Mxemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4481_PQN85_N2_Mxemb_ChIP_Rep1;_Caenorhab...	seq-SDQ4481_PQN85_N2_Mxemb_ChIP_Rep1	seq-SDQ4481_PQN85_N2_M...	N2|seq-SDQ4481_PQN85_N2_Mxemb_ChIP_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX495052	SRA146835	seq-SDQ4481_PQN85_N2_Mxemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4481_PQN85_N2_Mxemb_ChIP_Rep2;_Caenorhab...	seq-SDQ4481_PQN85_N2_Mxemb_ChIP_Rep2	seq-SDQ4481_PQN85_N2_M...	N2|seq-SDQ4481_PQN85_N2_Mxemb_ChIP_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX495053	SRA146836	seq-SDQ4493_MAU2_N2_Mxemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4493_MAU2_N2_Mxemb_Input_Rep1;_Caenorhab...	seq-SDQ4493_MAU2_N2_Mxemb_Input_Rep1	seq-SDQ4493_MAU2_N2_Mx...	N2|seq-SDQ4493_MAU2_N2_Mxemb_Input_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX495054	SRA146836	seq-SDQ4493_MAU2_N2_Mxemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4493_MAU2_N2_Mxemb_Input_Rep2;_Caenorhab...	seq-SDQ4493_MAU2_N2_Mxemb_Input_Rep2	seq-SDQ4493_MAU2_N2_Mx...	N2|seq-SDQ4493_MAU2_N2_Mxemb_Input_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX495055	SRA146836	seq-SDQ4493_MAU2_N2_Mxemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4493_MAU2_N2_Mxemb_ChIP_Rep1;_Caenorhabd...	seq-SDQ4493_MAU2_N2_Mxemb_ChIP_Rep1	seq-SDQ4493_MAU2_N2_Mx...	N2|seq-SDQ4493_MAU2_N2_Mxemb_ChIP_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX495056	SRA146836	seq-SDQ4493_MAU2_N2_Mxemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4493_MAU2_N2_Mxemb_ChIP_Rep2;_Caenorhabd...	seq-SDQ4493_MAU2_N2_Mxemb_ChIP_Rep2	seq-SDQ4493_MAU2_N2_Mx...	N2|seq-SDQ4493_MAU2_N2_Mxemb_ChIP_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX495057	SRA146837	seq-SDQ4496_DPY26_N2_Mxemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4496_DPY26_N2_Mxemb_Input_Rep1;_Caenorha...	seq-SDQ4496_DPY26_N2_Mxemb_Input_Rep1	seq-SDQ4496_DPY26_N2_M...	N2|seq-SDQ4496_DPY26_N2_Mxemb_Input_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX495058	SRA146837	seq-SDQ4496_DPY26_N2_Mxemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4496_DPY26_N2_Mxemb_Input_Rep2;_Caenorha...	seq-SDQ4496_DPY26_N2_Mxemb_Input_Rep2	seq-SDQ4496_DPY26_N2_M...	N2|seq-SDQ4496_DPY26_N2_Mxemb_Input_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX495059	SRA146837	seq-SDQ4496_DPY26_N2_Mxemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4496_DPY26_N2_Mxemb_ChIP_Rep1;_Caenorhab...	seq-SDQ4496_DPY26_N2_Mxemb_ChIP_Rep1	seq-SDQ4496_DPY26_N2_M...	N2|seq-SDQ4496_DPY26_N2_Mxemb_ChIP_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX495060	SRA146837	seq-SDQ4496_DPY26_N2_Mxemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4496_DPY26_N2_Mxemb_ChIP_Rep2;_Caenorhab...	seq-SDQ4496_DPY26_N2_Mxemb_ChIP_Rep2	seq-SDQ4496_DPY26_N2_M...	N2|seq-SDQ4496_DPY26_N2_Mxemb_ChIP_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX495061	SRA146838	seq-G0655G0656_HTP3_fem2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-G0655G0656_HTP3_fem2_AD_Input_Rep1;_Caenorh...	seq-G0655G0656_HTP3_fem2_AD_Input_Rep1	seq-G0655G0656_HTP3_fe...	fem-2(b245)|seq-G0655G0656_HTP3_fem2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495062	SRA146838	seq-G0655G0656_HTP3_fem2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-G0655G0656_HTP3_fem2_AD_Input_Rep2;_Caenorh...	seq-G0655G0656_HTP3_fem2_AD_Input_Rep2	seq-G0655G0656_HTP3_fe...	fem-2(b245)|seq-G0655G0656_HTP3_fem2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495063	SRA146838	seq-G0655G0656_HTP3_fem2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-G0655G0656_HTP3_fem2_AD_ChIP_Rep1;_Caenorha...	seq-G0655G0656_HTP3_fem2_AD_ChIP_Rep1	seq-G0655G0656_HTP3_fe...	fem-2(b245)|seq-G0655G0656_HTP3_fem2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495064	SRA146838	seq-G0655G0656_HTP3_fem2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-G0655G0656_HTP3_fem2_AD_ChIP_Rep2;_Caenorha...	seq-G0655G0656_HTP3_fem2_AD_ChIP_Rep2	seq-G0655G0656_HTP3_fe...	fem-2(b245)|seq-G0655G0656_HTP3_fem2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495065	SRA146839	seq-SDQ0802_REC8_fem2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ0802_REC8_fem2_AD_Input_Rep1;_Caenorhabd...	seq-SDQ0802_REC8_fem2_AD_Input_Rep1	seq-SDQ0802_REC8_fem2_...	fem-2(b245)|seq-SDQ0802_REC8_fem2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495066	SRA146839	seq-SDQ0802_REC8_fem2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ0802_REC8_fem2_AD_Input_Rep2;_Caenorhabd...	seq-SDQ0802_REC8_fem2_AD_Input_Rep2	seq-SDQ0802_REC8_fem2_...	fem-2(b245)|seq-SDQ0802_REC8_fem2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495067	SRA146839	seq-SDQ0802_REC8_fem2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ0802_REC8_fem2_AD_ChIP_Rep1;_Caenorhabdi...	seq-SDQ0802_REC8_fem2_AD_ChIP_Rep1	seq-SDQ0802_REC8_fem2_...	fem-2(b245)|seq-SDQ0802_REC8_fem2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495068	SRA146839	seq-SDQ0802_REC8_fem2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ0802_REC8_fem2_AD_ChIP_Rep2;_Caenorhabdi...	seq-SDQ0802_REC8_fem2_AD_ChIP_Rep2	seq-SDQ0802_REC8_fem2_...	fem-2(b245)|seq-SDQ0802_REC8_fem2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495069	SRA146840	seq-SDQ3914_REC8_fem2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3914_REC8_fem2_AD_Input_Rep1;_Caenorhabd...	seq-SDQ3914_REC8_fem2_AD_Input_Rep1	seq-SDQ3914_REC8_fem2_...	fem-2(b245)|seq-SDQ3914_REC8_fem2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495070	SRA146840	seq-SDQ3914_REC8_fem2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3914_REC8_fem2_AD_Input_Rep2;_Caenorhabd...	seq-SDQ3914_REC8_fem2_AD_Input_Rep2	seq-SDQ3914_REC8_fem2_...	fem-2(b245)|seq-SDQ3914_REC8_fem2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495071	SRA146840	seq-SDQ3914_REC8_fem2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3914_REC8_fem2_AD_ChIP_Rep1;_Caenorhabdi...	seq-SDQ3914_REC8_fem2_AD_ChIP_Rep1	seq-SDQ3914_REC8_fem2_...	fem-2(b245)|seq-SDQ3914_REC8_fem2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495072	SRA146840	seq-SDQ3914_REC8_fem2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3914_REC8_fem2_AD_ChIP_Rep2;_Caenorhabdi...	seq-SDQ3914_REC8_fem2_AD_ChIP_Rep2	seq-SDQ3914_REC8_fem2_...	fem-2(b245)|seq-SDQ3914_REC8_fem2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495073	SRA146841	seq-SDQ4561_DPY26_N2_Mxemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4561_DPY26_N2_Mxemb_Input_Rep1;_Caenorha...	seq-SDQ4561_DPY26_N2_Mxemb_Input_Rep1	seq-SDQ4561_DPY26_N2_M...	N2|seq-SDQ4561_DPY26_N2_Mxemb_Input_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX495074	SRA146841	seq-SDQ4561_DPY26_N2_Mxemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4561_DPY26_N2_Mxemb_Input_Rep2;_Caenorha...	seq-SDQ4561_DPY26_N2_Mxemb_Input_Rep2	seq-SDQ4561_DPY26_N2_M...	N2|seq-SDQ4561_DPY26_N2_Mxemb_Input_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX495075	SRA146841	seq-SDQ4561_DPY26_N2_Mxemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4561_DPY26_N2_Mxemb_ChIP_Rep1;_Caenorhab...	seq-SDQ4561_DPY26_N2_Mxemb_ChIP_Rep1	seq-SDQ4561_DPY26_N2_M...	N2|seq-SDQ4561_DPY26_N2_Mxemb_ChIP_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX495076	SRA146841	seq-SDQ4561_DPY26_N2_Mxemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4561_DPY26_N2_Mxemb_ChIP_Rep2;_Caenorhab...	seq-SDQ4561_DPY26_N2_Mxemb_ChIP_Rep2	seq-SDQ4561_DPY26_N2_M...	N2|seq-SDQ4561_DPY26_N2_Mxemb_ChIP_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX495077	SRA146842	seq-SDQ0809_COH1_fem2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ0809_COH1_fem2_AD_Input_Rep1;_Caenorhabd...	seq-SDQ0809_COH1_fem2_AD_Input_Rep1	seq-SDQ0809_COH1_fem2_...	fem-2(b245)|seq-SDQ0809_COH1_fem2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495078	SRA146842	seq-SDQ0809_COH1_fem2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ0809_COH1_fem2_AD_Input_Rep2;_Caenorhabd...	seq-SDQ0809_COH1_fem2_AD_Input_Rep2	seq-SDQ0809_COH1_fem2_...	fem-2(b245)|seq-SDQ0809_COH1_fem2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495079	SRA146842	seq-SDQ0809_COH1_fem2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ0809_COH1_fem2_AD_ChIP_Rep1;_Caenorhabdi...	seq-SDQ0809_COH1_fem2_AD_ChIP_Rep1	seq-SDQ0809_COH1_fem2_...	fem-2(b245)|seq-SDQ0809_COH1_fem2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495080	SRA146842	seq-SDQ0809_COH1_fem2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ0809_COH1_fem2_AD_ChIP_Rep2;_Caenorhabdi...	seq-SDQ0809_COH1_fem2_AD_ChIP_Rep2	seq-SDQ0809_COH1_fem2_...	fem-2(b245)|seq-SDQ0809_COH1_fem2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495081	SRA146843	seq-SDQ4562_SMC6_N2_Mxemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4562_SMC6_N2_Mxemb_Input_Rep1;_Caenorhab...	seq-SDQ4562_SMC6_N2_Mxemb_Input_Rep1	seq-SDQ4562_SMC6_N2_Mx...	N2|seq-SDQ4562_SMC6_N2_Mxemb_Input_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX495082	SRA146843	seq-SDQ4562_SMC6_N2_Mxemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4562_SMC6_N2_Mxemb_Input_Rep2;_Caenorhab...	seq-SDQ4562_SMC6_N2_Mxemb_Input_Rep2	seq-SDQ4562_SMC6_N2_Mx...	N2|seq-SDQ4562_SMC6_N2_Mxemb_Input_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX495083	SRA146843	seq-SDQ4562_SMC6_N2_Mxemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4562_SMC6_N2_Mxemb_ChIP_Rep1;_Caenorhabd...	seq-SDQ4562_SMC6_N2_Mxemb_ChIP_Rep1	seq-SDQ4562_SMC6_N2_Mx...	N2|seq-SDQ4562_SMC6_N2_Mxemb_ChIP_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX495084	SRA146843	seq-SDQ4562_SMC6_N2_Mxemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4562_SMC6_N2_Mxemb_ChIP_Rep2;_Caenorhabd...	seq-SDQ4562_SMC6_N2_Mxemb_ChIP_Rep2	seq-SDQ4562_SMC6_N2_Mx...	N2|seq-SDQ4562_SMC6_N2_Mxemb_ChIP_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX495085	SRA146844	seq-SDQ4564_DPY28_N2_Mxemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4564_DPY28_N2_Mxemb_Input_Rep1;_Caenorha...	seq-SDQ4564_DPY28_N2_Mxemb_Input_Rep1	seq-SDQ4564_DPY28_N2_M...	N2|seq-SDQ4564_DPY28_N2_Mxemb_Input_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX495086	SRA146844	seq-SDQ4564_DPY28_N2_Mxemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4564_DPY28_N2_Mxemb_Input_Rep2;_Caenorha...	seq-SDQ4564_DPY28_N2_Mxemb_Input_Rep2	seq-SDQ4564_DPY28_N2_M...	N2|seq-SDQ4564_DPY28_N2_Mxemb_Input_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX495087	SRA146844	seq-SDQ4564_DPY28_N2_Mxemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4564_DPY28_N2_Mxemb_ChIP_Rep1;_Caenorhab...	seq-SDQ4564_DPY28_N2_Mxemb_ChIP_Rep1	seq-SDQ4564_DPY28_N2_M...	N2|seq-SDQ4564_DPY28_N2_Mxemb_ChIP_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX495088	SRA146844	seq-SDQ4564_DPY28_N2_Mxemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4564_DPY28_N2_Mxemb_ChIP_Rep2;_Caenorhab...	seq-SDQ4564_DPY28_N2_Mxemb_ChIP_Rep2	seq-SDQ4564_DPY28_N2_M...	N2|seq-SDQ4564_DPY28_N2_Mxemb_ChIP_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX495089	SRA146845	seq-SDQ4585_ASH2_N2_Mxemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4585_ASH2_N2_Mxemb_Input_Rep1;_Caenorhab...	seq-SDQ4585_ASH2_N2_Mxemb_Input_Rep1	seq-SDQ4585_ASH2_N2_Mx...	N2|seq-SDQ4585_ASH2_N2_Mxemb_Input_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX495090	SRA146845	seq-SDQ4585_ASH2_N2_Mxemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4585_ASH2_N2_Mxemb_Input_Rep2;_Caenorhab...	seq-SDQ4585_ASH2_N2_Mxemb_Input_Rep2	seq-SDQ4585_ASH2_N2_Mx...	N2|seq-SDQ4585_ASH2_N2_Mxemb_Input_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX495091	SRA146845	seq-SDQ4585_ASH2_N2_Mxemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4585_ASH2_N2_Mxemb_ChIP_Rep1;_Caenorhabd...	seq-SDQ4585_ASH2_N2_Mxemb_ChIP_Rep1	seq-SDQ4585_ASH2_N2_Mx...	N2|seq-SDQ4585_ASH2_N2_Mxemb_ChIP_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX495092	SRA146845	seq-SDQ4585_ASH2_N2_Mxemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4585_ASH2_N2_Mxemb_ChIP_Rep2;_Caenorhabd...	seq-SDQ4585_ASH2_N2_Mxemb_ChIP_Rep2	seq-SDQ4585_ASH2_N2_Mx...	N2|seq-SDQ4585_ASH2_N2_Mxemb_ChIP_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX495093	SRA146846	seq-SDQ4640_SWD3_N2_Mxemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4640_SWD3_N2_Mxemb_Input_Rep1;_Caenorhab...	seq-SDQ4640_SWD3_N2_Mxemb_Input_Rep1	seq-SDQ4640_SWD3_N2_Mx...	N2|seq-SDQ4640_SWD3_N2_Mxemb_Input_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX495094	SRA146846	seq-SDQ4640_SWD3_N2_Mxemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4640_SWD3_N2_Mxemb_Input_Rep2;_Caenorhab...	seq-SDQ4640_SWD3_N2_Mxemb_Input_Rep2	seq-SDQ4640_SWD3_N2_Mx...	N2|seq-SDQ4640_SWD3_N2_Mxemb_Input_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX495095	SRA146846	seq-SDQ4640_SWD3_N2_Mxemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4640_SWD3_N2_Mxemb_ChIP_Rep1;_Caenorhabd...	seq-SDQ4640_SWD3_N2_Mxemb_ChIP_Rep1	seq-SDQ4640_SWD3_N2_Mx...	N2|seq-SDQ4640_SWD3_N2_Mxemb_ChIP_Rep1|Mixed Embryo	N2	ChIP-Seq
SRX495096	SRA146846	seq-SDQ4640_SWD3_N2_Mxemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4640_SWD3_N2_Mxemb_ChIP_Rep2;_Caenorhabd...	seq-SDQ4640_SWD3_N2_Mxemb_ChIP_Rep2	seq-SDQ4640_SWD3_N2_Mx...	N2|seq-SDQ4640_SWD3_N2_Mxemb_ChIP_Rep2|Mixed Embryo	N2	ChIP-Seq
SRX495097	SRA146847	seq-SDQ4663_RPC1_N2_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4663_RPC1_N2_L3_Input_Rep1;_Caenorhabdit...	seq-SDQ4663_RPC1_N2_L3_Input_Rep1	seq-SDQ4663_RPC1_N2_L3...	N2|seq-SDQ4663_RPC1_N2_L3_Input_Rep1|L3 Larva	N2	ChIP-Seq
SRX495098	SRA146847	seq-SDQ4663_RPC1_N2_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4663_RPC1_N2_L3_Input_Rep2;_Caenorhabdit...	seq-SDQ4663_RPC1_N2_L3_Input_Rep2	seq-SDQ4663_RPC1_N2_L3...	N2|seq-SDQ4663_RPC1_N2_L3_Input_Rep2|L3 Larva	N2	ChIP-Seq
SRX495099	SRA146847	seq-SDQ4663_RPC1_N2_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4663_RPC1_N2_L3_ChIP_Rep1;_Caenorhabditi...	seq-SDQ4663_RPC1_N2_L3_ChIP_Rep1	seq-SDQ4663_RPC1_N2_L3...	N2|seq-SDQ4663_RPC1_N2_L3_ChIP_Rep1|L3 Larva	N2	ChIP-Seq
SRX495100	SRA146847	seq-SDQ4663_RPC1_N2_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4663_RPC1_N2_L3_ChIP_Rep2;_Caenorhabditi...	seq-SDQ4663_RPC1_N2_L3_ChIP_Rep2	seq-SDQ4663_RPC1_N2_L3...	N2|seq-SDQ4663_RPC1_N2_L3_ChIP_Rep2|L3 Larva	N2	ChIP-Seq
SRX495101	SRA146848	seq-SDQ2382_him5_fem2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2382_him5_fem2_AD_Input_Rep1;_Caenorhabd...	seq-SDQ2382_him5_fem2_AD_Input_Rep1	seq-SDQ2382_him5_fem2_...	fem-2(b245)|seq-SDQ2382_him5_fem2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495102	SRA146848	seq-SDQ2382_him5_fem2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2382_him5_fem2_AD_Input_Rep2;_Caenorhabd...	seq-SDQ2382_him5_fem2_AD_Input_Rep2	seq-SDQ2382_him5_fem2_...	fem-2(b245)|seq-SDQ2382_him5_fem2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495103	SRA146848	seq-SDQ2382_him5_fem2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2382_him5_fem2_AD_ChIP_Rep1;_Caenorhabdi...	seq-SDQ2382_him5_fem2_AD_ChIP_Rep1	seq-SDQ2382_him5_fem2_...	fem-2(b245)|seq-SDQ2382_him5_fem2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495104	SRA146848	seq-SDQ2382_him5_fem2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ2382_him5_fem2_AD_ChIP_Rep2;_Caenorhabdi...	seq-SDQ2382_him5_fem2_AD_ChIP_Rep2	seq-SDQ2382_him5_fem2_...	fem-2(b245)|seq-SDQ2382_him5_fem2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495105	SRA146849	seq-302-32369_H3K9me2_ojIs9_YA_germline_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-302-32369_H3K9me2_ojIs9_YA_germline_Input_R...	seq-302-32369_H3K9me2_ojIs9_YA_germline_Input_Rep1	seq-302-32369_H3K9me2_...	WH223|seq-302-32369_H3K9me2_ojIs9_YA_germline_Input_Rep1|Germline containing young adult	WH223	ChIP-Seq
SRX495106	SRA146849	seq-302-32369_H3K9me2_ojIs9_YA_germline_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-302-32369_H3K9me2_ojIs9_YA_germline_Input_R...	seq-302-32369_H3K9me2_ojIs9_YA_germline_Input_Rep2	seq-302-32369_H3K9me2_...	WH223|seq-302-32369_H3K9me2_ojIs9_YA_germline_Input_Rep2|Germline containing young adult	WH223	ChIP-Seq
SRX495107	SRA146849	seq-302-32369_H3K9me2_ojIs9_YA_germline_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-302-32369_H3K9me2_ojIs9_YA_germline_ChIP_Re...	seq-302-32369_H3K9me2_ojIs9_YA_germline_ChIP_Rep1	seq-302-32369_H3K9me2_...	WH223|seq-302-32369_H3K9me2_ojIs9_YA_germline_ChIP_Rep1|Germline containing young adult	WH223	ChIP-Seq
SRX495108	SRA146849	seq-302-32369_H3K9me2_ojIs9_YA_germline_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-302-32369_H3K9me2_ojIs9_YA_germline_ChIP_Re...	seq-302-32369_H3K9me2_ojIs9_YA_germline_ChIP_Rep2	seq-302-32369_H3K9me2_...	WH223|seq-302-32369_H3K9me2_ojIs9_YA_germline_ChIP_Rep2|Germline containing young adult	WH223	ChIP-Seq
SRX495109	SRA146850	seq-SDQ3838_T26A5.5_N2_Eemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3838_T26A5.5_N2_Eemb_Input_Rep1;_Caenorh...	seq-SDQ3838_T26A5.5_N2_Eemb_Input_Rep1	seq-SDQ3838_T26A5.5_N2...	N2|seq-SDQ3838_T26A5.5_N2_Eemb_Input_Rep1|Early Embryo	N2	ChIP-Seq
SRX495110	SRA146850	seq-SDQ3838_T26A5.5_N2_Eemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3838_T26A5.5_N2_Eemb_Input_Rep2;_Caenorh...	seq-SDQ3838_T26A5.5_N2_Eemb_Input_Rep2	seq-SDQ3838_T26A5.5_N2...	N2|seq-SDQ3838_T26A5.5_N2_Eemb_Input_Rep2|Early Embryo	N2	ChIP-Seq
SRX495111	SRA146850	seq-SDQ3838_T26A5.5_N2_Eemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3838_T26A5.5_N2_Eemb_ChIP_Rep1;_Caenorha...	seq-SDQ3838_T26A5.5_N2_Eemb_ChIP_Rep1	seq-SDQ3838_T26A5.5_N2...	N2|seq-SDQ3838_T26A5.5_N2_Eemb_ChIP_Rep1|Early Embryo	N2	ChIP-Seq
SRX495112	SRA146850	seq-SDQ3838_T26A5.5_N2_Eemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3838_T26A5.5_N2_Eemb_ChIP_Rep2;_Caenorha...	seq-SDQ3838_T26A5.5_N2_Eemb_ChIP_Rep2	seq-SDQ3838_T26A5.5_N2...	N2|seq-SDQ3838_T26A5.5_N2_Eemb_ChIP_Rep2|Early Embryo	N2	ChIP-Seq
SRX495113	SRA146851	seq-SDQ3927_MRG1_N2_Eemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3927_MRG1_N2_Eemb_Input_Rep1;_Caenorhabd...	seq-SDQ3927_MRG1_N2_Eemb_Input_Rep1	seq-SDQ3927_MRG1_N2_Ee...	N2|seq-SDQ3927_MRG1_N2_Eemb_Input_Rep1|Early Embryo	N2	ChIP-Seq
SRX495114	SRA146851	seq-SDQ3927_MRG1_N2_Eemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3927_MRG1_N2_Eemb_Input_Rep2;_Caenorhabd...	seq-SDQ3927_MRG1_N2_Eemb_Input_Rep2	seq-SDQ3927_MRG1_N2_Ee...	N2|seq-SDQ3927_MRG1_N2_Eemb_Input_Rep2|Early Embryo	N2	ChIP-Seq
SRX495115	SRA146851	seq-SDQ3927_MRG1_N2_Eemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3927_MRG1_N2_Eemb_ChIP_Rep1;_Caenorhabdi...	seq-SDQ3927_MRG1_N2_Eemb_ChIP_Rep1	seq-SDQ3927_MRG1_N2_Ee...	N2|seq-SDQ3927_MRG1_N2_Eemb_ChIP_Rep1|Early Embryo	N2	ChIP-Seq
SRX495116	SRA146851	seq-SDQ3927_MRG1_N2_Eemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3927_MRG1_N2_Eemb_ChIP_Rep2;_Caenorhabdi...	seq-SDQ3927_MRG1_N2_Eemb_ChIP_Rep2	seq-SDQ3927_MRG1_N2_Ee...	N2|seq-SDQ3927_MRG1_N2_Eemb_ChIP_Rep2|Early Embryo	N2	ChIP-Seq
SRX495117	SRA146852	seq-ab817_8WG16_639746_N2_Eemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab817_8WG16_639746_N2_Eemb_Input_Rep1;_Caen...	seq-ab817_8WG16_639746_N2_Eemb_Input_Rep1	seq-ab817_8WG16_639746...	N2|seq-ab817_8WG16_639746_N2_Eemb_Input_Rep1|Early Embryo	N2	ChIP-Seq
SRX495118	SRA146852	seq-ab817_8WG16_639746_N2_Eemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab817_8WG16_639746_N2_Eemb_Input_Rep2;_Caen...	seq-ab817_8WG16_639746_N2_Eemb_Input_Rep2	seq-ab817_8WG16_639746...	N2|seq-ab817_8WG16_639746_N2_Eemb_Input_Rep2|Early Embryo	N2	ChIP-Seq
SRX495119	SRA146852	seq-ab817_8WG16_639746_N2_Eemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab817_8WG16_639746_N2_Eemb_ChIP_Rep1;_Caeno...	seq-ab817_8WG16_639746_N2_Eemb_ChIP_Rep1	seq-ab817_8WG16_639746...	N2|seq-ab817_8WG16_639746_N2_Eemb_ChIP_Rep1|Early Embryo	N2	ChIP-Seq
SRX495120	SRA146852	seq-ab817_8WG16_639746_N2_Eemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab817_8WG16_639746_N2_Eemb_ChIP_Rep2;_Caeno...	seq-ab817_8WG16_639746_N2_Eemb_ChIP_Rep2	seq-ab817_8WG16_639746...	N2|seq-ab817_8WG16_639746_N2_Eemb_ChIP_Rep2|Early Embryo	N2	ChIP-Seq
SRX495121	SRA146853	seq-SDQ5413_CEC7_fem2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ5413_CEC7_fem2_AD_Input_Rep2;_Caenorhabd...	seq-SDQ5413_CEC7_fem2_AD_Input_Rep2	seq-SDQ5413_CEC7_fem2_...	fem-2(b245)|seq-SDQ5413_CEC7_fem2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495122	SRA146853	seq-SDQ5413_CEC7_fem2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ5413_CEC7_fem2_AD_ChIP_Rep2;_Caenorhabdi...	seq-SDQ5413_CEC7_fem2_AD_ChIP_Rep2	seq-SDQ5413_CEC7_fem2_...	fem-2(b245)|seq-SDQ5413_CEC7_fem2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495123	SRA146854	seq-SDQ5421_CEC7_fem2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ5421_CEC7_fem2_AD_Input_Rep1;_Caenorhabd...	seq-SDQ5421_CEC7_fem2_AD_Input_Rep1	seq-SDQ5421_CEC7_fem2_...	fem-2(b245)|seq-SDQ5421_CEC7_fem2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX495124	SRA146854	seq-SDQ5421_CEC7_fem2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ5421_CEC7_fem2_AD_ChIP_Rep1;_Caenorhabdi...	seq-SDQ5421_CEC7_fem2_AD_ChIP_Rep1	seq-SDQ5421_CEC7_fem2_...	fem-2(b245)|seq-SDQ5421_CEC7_fem2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX4996803	SRA807805	ChIP_lem-2_N2_eemb_20oC_rep1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP_lem-2_N2_eemb_20oC_rep1;_Caenorhabditis_el...	Lem-2 antibody (Novus Biologicals 48540002)|early embryo	Lem-2 antibody (Novus ...	N2 (Bristol)|early embryo	N2 (Bristol)	ChIP-Seq
SRX4996804	SRA807805	ChIP_lem-2_N2_eemb_20oC_rep2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP_lem-2_N2_eemb_20oC_rep2;_Caenorhabditis_el...	Lem-2 antibody (Novus Biologicals 48540002)|early embryo	Lem-2 antibody (Novus ...	N2 (Bristol)|early embryo	N2 (Bristol)	ChIP-Seq
SRX4996805	SRA807805	ChIP_lem-2_N2_eemb_20oC_rep3;_Caenorhabditis_elegans;_ChIP-Seq	ChIP_lem-2_N2_eemb_20oC_rep3;_Caenorhabditis_el...	Lem-2 antibody (Novus Biologicals 48540002)|early embryo	Lem-2 antibody (Novus ...	N2 (Bristol)|early embryo	N2 (Bristol)	ChIP-Seq
SRX4996806	SRA807805	ChIP_lem-2_met-2_eemb_20oC_rep1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP_lem-2_met-2_eemb_20oC_rep1;_Caenorhabditis...	Lem-2 antibody (Novus Biologicals 48540002)|early embryo	Lem-2 antibody (Novus ...	met-2(n4256) III|early embryo	met-2(n4256) III	ChIP-Seq
SRX4996807	SRA807805	ChIP_lem-2_met-2_eemb_20oC_rep2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP_lem-2_met-2_eemb_20oC_rep2;_Caenorhabditis...	Lem-2 antibody (Novus Biologicals 48540002)|early embryo	Lem-2 antibody (Novus ...	met-2(n4256) III|early embryo	met-2(n4256) III	ChIP-Seq
SRX4996808	SRA807805	ChIP_lem-2_met-2_eemb_20oC_rep3;_Caenorhabditis_elegans;_ChIP-Seq	ChIP_lem-2_met-2_eemb_20oC_rep3;_Caenorhabditis...	Lem-2 antibody (Novus Biologicals 48540002)|early embryo	Lem-2 antibody (Novus ...	met-2(n4256) III|early embryo	met-2(n4256) III	ChIP-Seq
SRX4996809	SRA807805	ChIP_lem-2_set-25_eemb_20oC_rep1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP_lem-2_set-25_eemb_20oC_rep1;_Caenorhabditi...	Lem-2 antibody (Novus Biologicals 48540002)|early embryo	Lem-2 antibody (Novus ...	set-25(n5021) III|early embryo	set-25(n5021) III	ChIP-Seq
SRX4996810	SRA807805	ChIP_lem-2_set-25_eemb_20oC_rep2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP_lem-2_set-25_eemb_20oC_rep2;_Caenorhabditi...	Lem-2 antibody (Novus Biologicals 48540002)|early embryo	Lem-2 antibody (Novus ...	set-25(n5021) III|early embryo	set-25(n5021) III	ChIP-Seq
SRX4996811	SRA807805	ChIP_lem-2_set-25_eemb_20oC_rep3;_Caenorhabditis_elegans;_ChIP-Seq	ChIP_lem-2_set-25_eemb_20oC_rep3;_Caenorhabditi...	Lem-2 antibody (Novus Biologicals 48540002)|early embryo	Lem-2 antibody (Novus ...	set-25(n5021) III|early embryo	set-25(n5021) III	ChIP-Seq
SRX4996813	SRA807805	input_N2_eemb_20oC_rep1;_Caenorhabditis_elegans;_ChIP-Seq	input_N2_eemb_20oC_rep1;_Caenorhabditis_elegans...	none|early embryo	none	N2 (Bristol)|early embryo	N2 (Bristol)	ChIP-Seq
SRX4996814	SRA807805	input_N2_eemb_20oC_rep2;_Caenorhabditis_elegans;_ChIP-Seq	input_N2_eemb_20oC_rep2;_Caenorhabditis_elegans...	none|early embryo	none	N2 (Bristol)|early embryo	N2 (Bristol)	ChIP-Seq
SRX4996815	SRA807805	input_N2_eemb_20oC_rep3;_Caenorhabditis_elegans;_ChIP-Seq	input_N2_eemb_20oC_rep3;_Caenorhabditis_elegans...	none|early embryo	none	N2 (Bristol)|early embryo	N2 (Bristol)	ChIP-Seq
SRX4996816	SRA807805	input_met2_eemb_20oC_rep1;_Caenorhabditis_elegans;_ChIP-Seq	input_met2_eemb_20oC_rep1;_Caenorhabditis_elega...	none|early embryo	none	met-2(n4256) III|early embryo	met-2(n4256) III	ChIP-Seq
SRX4996817	SRA807805	input_met2_eemb_20oC_rep2;_Caenorhabditis_elegans;_ChIP-Seq	input_met2_eemb_20oC_rep2;_Caenorhabditis_elega...	none|early embryo	none	met-2(n4256) III|early embryo	met-2(n4256) III	ChIP-Seq
SRX4996818	SRA807805	input_met2_eemb_20oC_rep3;_Caenorhabditis_elegans;_ChIP-Seq	input_met2_eemb_20oC_rep3;_Caenorhabditis_elega...	none|early embryo	none	met-2(n4256) III|early embryo	met-2(n4256) III	ChIP-Seq
SRX4996819	SRA807805	input_set25_eemb_20oC_rep1;_Caenorhabditis_elegans;_ChIP-Seq	input_set25_eemb_20oC_rep1;_Caenorhabditis_eleg...	none|early embryo	none	set-25(n5021) III|early embryo	set-25(n5021) III	ChIP-Seq
SRX4996820	SRA807805	input_set25_eemb_20oC_rep2;_Caenorhabditis_elegans;_ChIP-Seq	input_set25_eemb_20oC_rep2;_Caenorhabditis_eleg...	none|early embryo	none	set-25(n5021) III|early embryo	set-25(n5021) III	ChIP-Seq
SRX4996821	SRA807805	input_set25_eemb_20oC_rep3;_Caenorhabditis_elegans;_ChIP-Seq	input_set25_eemb_20oC_rep3;_Caenorhabditis_eleg...	none|early embryo	none	set-25(n5021) III|early embryo	set-25(n5021) III	ChIP-Seq
SRX5020695	SRA811199	H3K4me3_N2_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_N2_emb_rep1_ChIP-seq;_Caenorhabditis_el...	H3K4me3|whole worms	H3K4me3	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020696	SRA811199	H3K4me3_N2_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_N2_emb_rep2_ChIP-seq;_Caenorhabditis_el...	H3K4me3|whole worms	H3K4me3	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020697	SRA811199	H3K4me3_CB428_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_CB428_emb_rep1_ChIP-seq;_Caenorhabditis...	H3K4me3|whole worms	H3K4me3	CB428|whole worms|mixed embryo	CB428	ChIP-Seq
SRX5020698	SRA811199	H3K4me3_CB428_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_CB428_emb_rep2_ChIP-seq;_Caenorhabditis...	H3K4me3|whole worms	H3K4me3	CB428|whole worms|mixed embryo	CB428	ChIP-Seq
SRX5020699	SRA811199	H3K4me3_CB428_emb_rep3_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_CB428_emb_rep3_ChIP-seq;_Caenorhabditis...	H3K4me3|whole worms	H3K4me3	CB428|whole worms|mixed embryo	CB428	ChIP-Seq
SRX5020700	SRA811199	H3K4me3_N2_Control_RNAi_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_N2_Control_RNAi_emb_rep1_ChIP-seq;_Caen...	H3K4me3|whole worms	H3K4me3	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020701	SRA811199	H3K4me3_N2_Control_RNAi_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_N2_Control_RNAi_emb_rep2_ChIP-seq;_Caen...	H3K4me3|whole worms	H3K4me3	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020702	SRA811199	H3K4me3_N2_DPY-27_RNAi_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_N2_DPY-27_RNAi_emb_rep1_ChIP-seq;_Caeno...	H3K4me3|whole worms	H3K4me3	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020703	SRA811199	H3K4me3_N2_DPY-27_RNAi_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_N2_DPY-27_RNAi_emb_rep2_ChIP-seq;_Caeno...	H3K4me3|whole worms	H3K4me3	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020704	SRA811199	H3K4me3_N2_DPY-27_RNAi_emb_rep3_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_N2_DPY-27_RNAi_emb_rep3_ChIP-seq;_Caeno...	H3K4me3|whole worms	H3K4me3	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020705	SRA811199	H3K4me1_N2_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me1_N2_emb_rep1_ChIP-seq;_Caenorhabditis_el...	H3K4me1|whole worms	H3K4me1	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020706	SRA811199	H3K4me1_N2_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me1_N2_emb_rep2_ChIP-seq;_Caenorhabditis_el...	H3K4me1|whole worms	H3K4me1	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020707	SRA811199	H3K4me1_N2_Control_RNAi_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me1_N2_Control_RNAi_emb_rep1_ChIP-seq;_Caen...	H3K4me1|whole worms	H3K4me1	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020708	SRA811199	H3K4me1_N2_Control_RNAi_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me1_N2_Control_RNAi_emb_rep2_ChIP-seq;_Caen...	H3K4me1|whole worms	H3K4me1	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020709	SRA811199	H3K4me1_N2_DPY-27_RNAi_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me1_N2_DPY-27_RNAi_emb_rep1_ChIP-seq;_Caeno...	H3K4me1|whole worms	H3K4me1	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020710	SRA811199	H3K4me1_N2_DPY-27_RNAi_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me1_N2_DPY-27_RNAi_emb_rep2_ChIP-seq;_Caeno...	H3K4me1|whole worms	H3K4me1	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020711	SRA811199	H3K4me1_CB428_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me1_CB428_emb_rep1_ChIP-seq;_Caenorhabditis...	H3K4me1|whole worms	H3K4me1	CB428|whole worms|mixed embryo	CB428	ChIP-Seq
SRX5020712	SRA811199	H3K4me1_CB428_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me1_CB428_emb_rep2_ChIP-seq;_Caenorhabditis...	H3K4me1|whole worms	H3K4me1	CB428|whole worms|mixed embryo	CB428	ChIP-Seq
SRX5020713	SRA811199	H3_CB428_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3_CB428_emb_rep1_ChIP-seq;_Caenorhabditis_eleg...	H3|whole worms	H3	CB428|whole worms|mixed embryo	CB428	ChIP-Seq
SRX5020714	SRA811199	H3_CB428_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3_CB428_emb_rep2_ChIP-seq;_Caenorhabditis_eleg...	H3|whole worms	H3	CB428|whole worms|mixed embryo	CB428	ChIP-Seq
SRX5020715	SRA811199	H3K27ac_N2_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K27ac_N2_emb_rep1_ChIP-seq;_Caenorhabditis_el...	H3K27ac|whole worms	H3K27ac	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020716	SRA811199	H3K27ac_N2_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K27ac_N2_emb_rep2_ChIP-seq;_Caenorhabditis_el...	H3K27ac|whole worms	H3K27ac	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020717	SRA811199	H3K27ac_N2_emb_rep3_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K27ac_N2_emb_rep3_ChIP-seq;_Caenorhabditis_el...	H3K27ac|whole worms	H3K27ac	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020718	SRA811199	H3K27ac_CB428_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K27ac_CB428_emb_rep1_ChIP-seq;_Caenorhabditis...	H3K27ac|whole worms	H3K27ac	CB428|whole worms|mixed embryo	CB428	ChIP-Seq
SRX5020719	SRA811199	H3K27ac_CB428_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K27ac_CB428_emb_rep2_ChIP-seq;_Caenorhabditis...	H3K27ac|whole worms	H3K27ac	CB428|whole worms|mixed embryo	CB428	ChIP-Seq
SRX5020720	SRA811199	H3K27ac_N2_DPY-27_RNAi_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K27ac_N2_DPY-27_RNAi_emb_rep1_ChIP-seq;_Caeno...	H3K27ac|whole worms	H3K27ac	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020721	SRA811199	H3K27ac_N2_DPY-27_RNAi_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K27ac_N2_DPY-27_RNAi_emb_rep2_ChIP-seq;_Caeno...	H3K27ac|whole worms	H3K27ac	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020722	SRA811199	H4K16ac_N2_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H4K16ac_N2_emb_rep1_ChIP-seq;_Caenorhabditis_el...	H4K16ac|whole worms	H4K16ac	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020723	SRA811199	H4K16ac_N2_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H4K16ac_N2_emb_rep2_ChIP-seq;_Caenorhabditis_el...	H4K16ac|whole worms	H4K16ac	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020724	SRA811199	H4K16ac_N2_emb_rep3_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H4K16ac_N2_emb_rep3_ChIP-seq;_Caenorhabditis_el...	H4K16ac|whole worms	H4K16ac	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020725	SRA811199	H4K16ac_CB428_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H4K16ac_CB428_emb_rep1_ChIP-seq;_Caenorhabditis...	H4K16ac|whole worms	H4K16ac	CB428|whole worms|mixed embryo	CB428	ChIP-Seq
SRX5020726	SRA811199	H4K16ac_CB428_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H4K16ac_CB428_emb_rep2_ChIP-seq;_Caenorhabditis...	H4K16ac|whole worms	H4K16ac	CB428|whole worms|mixed embryo	CB428	ChIP-Seq
SRX5020727	SRA811199	H3ac_N2_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3ac_N2_emb_rep1_ChIP-seq;_Caenorhabditis_elega...	H3ac|whole worms	H3ac	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020728	SRA811199	H3ac_N2_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3ac_N2_emb_rep2_ChIP-seq;_Caenorhabditis_elega...	H3ac|whole worms	H3ac	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020729	SRA811199	H3ac_CB428_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3ac_CB428_emb_rep1_ChIP-seq;_Caenorhabditis_el...	H3ac|whole worms	H3ac	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020730	SRA811199	H3ac_CB428_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3ac_CB428_emb_rep2_ChIP-seq;_Caenorhabditis_el...	H3ac|whole worms	H3ac	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020731	SRA811199	H3K27me1_N2_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me1_N2_emb_rep1_ChIP-seq;_Caenorhabditis_e...	H3K27me1|whole worms	H3K27me1	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020732	SRA811199	H3K27me1_N2_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me1_N2_emb_rep2_ChIP-seq;_Caenorhabditis_e...	H3K27me1|whole worms	H3K27me1	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020733	SRA811199	H3K27me1_CB428_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me1_CB428_emb_rep1_ChIP-seq;_Caenorhabditi...	H3K27me1|whole worms	H3K27me1	CB428|whole worms|mixed embryo	CB428	ChIP-Seq
SRX5020734	SRA811199	H3K27me1_CB428_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me1_CB428_emb_rep2_ChIP-seq;_Caenorhabditi...	H3K27me1|whole worms	H3K27me1	CB428|whole worms|mixed embryo	CB428	ChIP-Seq
SRX5020735	SRA811199	H3K27me1_N2_DPY-27_RNAi_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me1_N2_DPY-27_RNAi_emb_rep1_ChIP-seq;_Caen...	H3K27me1|whole worms	H3K27me1	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020736	SRA811199	H3K27me1_N2_DPY-27_RNAi_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me1_N2_DPY-27_RNAi_emb_rep2_ChIP-seq;_Caen...	H3K27me1|whole worms	H3K27me1	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020737	SRA811199	H3K27me2_N2_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me2_N2_emb_rep1_ChIP-seq;_Caenorhabditis_e...	H3K27me2|whole worms	H3K27me2	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020738	SRA811199	H3K27me2_N2_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me2_N2_emb_rep2_ChIP-seq;_Caenorhabditis_e...	H3K27me2|whole worms	H3K27me2	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020739	SRA811199	H3K27me2_CB428_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me2_CB428_emb_rep1_ChIP-seq;_Caenorhabditi...	H3K27me2|whole worms	H3K27me2	CB428|whole worms|mixed embryo	CB428	ChIP-Seq
SRX5020740	SRA811199	H3K27me2_CB428_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me2_CB428_emb_rep2_ChIP-seq;_Caenorhabditi...	H3K27me2|whole worms	H3K27me2	CB428|whole worms|mixed embryo	CB428	ChIP-Seq
SRX5020741	SRA811199	H3K27me2_N2_DPY-27_RNAi_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me2_N2_DPY-27_RNAi_emb_rep1_ChIP-seq;_Caen...	H3K27me2|whole worms	H3K27me2	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020742	SRA811199	H3K27me2_N2_DPY-27_RNAi_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me2_N2_DPY-27_RNAi_emb_rep2_ChIP-seq;_Caen...	H3K27me2|whole worms	H3K27me2	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020743	SRA811199	H3K9me3_N2_Control_RNAi_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_N2_Control_RNAi_emb_rep1_ChIP-seq;_Caen...	H3K9me3|whole worms	H3K9me3	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020744	SRA811199	H3K9me3_N2_Control_RNAi_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_N2_Control_RNAi_emb_rep2_ChIP-seq;_Caen...	H3K9me3|whole worms	H3K9me3	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020745	SRA811199	H3K9me3_N2_DPY-27_RNAi_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_N2_DPY-27_RNAi_emb_rep1_ChIP-seq;_Caeno...	H3K9me3|whole worms	H3K9me3	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020746	SRA811199	H3K9me3_N2_DPY-27_RNAi_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_N2_DPY-27_RNAi_emb_rep2_ChIP-seq;_Caeno...	H3K9me3|whole worms	H3K9me3	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020747	SRA811199	H3K9me3_N2_DPY-27_RNAi_emb_rep3_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_N2_DPY-27_RNAi_emb_rep3_ChIP-seq;_Caeno...	H3K9me3|whole worms	H3K9me3	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020748	SRA811199	H4panAc_N2_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H4panAc_N2_emb_rep1_ChIP-seq;_Caenorhabditis_el...	H4panAc|whole worms	H4panAc	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020749	SRA811199	H4panAc_N2_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H4panAc_N2_emb_rep2_ChIP-seq;_Caenorhabditis_el...	H4panAc|whole worms	H4panAc	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020750	SRA811199	H4panAc_N2_emb_rep3_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H4panAc_N2_emb_rep3_ChIP-seq;_Caenorhabditis_el...	H4panAc|whole worms	H4panAc	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020751	SRA811199	H4panAc_CB428_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H4panAc_CB428_emb_rep1_ChIP-seq;_Caenorhabditis...	H4panAc|whole worms	H4panAc	CB428|whole worms|mixed embryo	CB428	ChIP-Seq
SRX5020752	SRA811199	H4panAc_CB428_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H4panAc_CB428_emb_rep2_ChIP-seq;_Caenorhabditis...	H4panAc|whole worms	H4panAc	CB428|whole worms|mixed embryo	CB428	ChIP-Seq
SRX5020753	SRA811199	IgG_CB428_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	IgG_CB428_emb_rep1_ChIP-seq;_Caenorhabditis_ele...	IgG|whole worms	IgG	CB428|whole worms|mixed embryo	CB428	ChIP-Seq
SRX5020754	SRA811199	IgG_CB428_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	IgG_CB428_emb_rep2_ChIP-seq;_Caenorhabditis_ele...	IgG|whole worms	IgG	CB428|whole worms|mixed embryo	CB428	ChIP-Seq
SRX5020755	SRA811199	H4K20me1_N2_Control_RNAi_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H4K20me1_N2_Control_RNAi_emb_rep1_ChIP-seq;_Cae...	H4K20me1|whole worms	H4K20me1	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020756	SRA811199	H4K20me1_N2_Control_RNAi_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H4K20me1_N2_Control_RNAi_emb_rep2_ChIP-seq;_Cae...	H4K20me1|whole worms	H4K20me1	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020757	SRA811199	H4K20me1_N2_DPY-27_RNAi_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H4K20me1_N2_DPY-27_RNAi_emb_rep1_ChIP-seq;_Caen...	H4K20me1|whole worms	H4K20me1	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020758	SRA811199	H4K20me1_N2_DPY-27_RNAi_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H4K20me1_N2_DPY-27_RNAi_emb_rep2_ChIP-seq;_Caen...	H4K20me1|whole worms	H4K20me1	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020759	SRA811199	SDC3_GW638_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SDC3_GW638_emb_rep1_ChIP-seq;_Caenorhabditis_el...	SDC-3|whole worms	SDC-3	GW638|whole worms|mixed embryo	GW638	ChIP-Seq
SRX5020760	SRA811199	SDC3_GW638_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SDC3_GW638_emb_rep2_ChIP-seq;_Caenorhabditis_el...	SDC-3|whole worms	SDC-3	GW638|whole worms|mixed embryo	GW638	ChIP-Seq
SRX5020761	SRA811199	CAPG1_GW638_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	CAPG1_GW638_emb_rep1_ChIP-seq;_Caenorhabditis_e...	CAPG-1|whole worms	CAPG-1	GW638|whole worms|mixed embryo	GW638	ChIP-Seq
SRX5020762	SRA811199	CAPG1_GW638_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	CAPG1_GW638_emb_rep2_ChIP-seq;_Caenorhabditis_e...	CAPG-1|whole worms	CAPG-1	GW638|whole worms|mixed embryo	GW638	ChIP-Seq
SRX5020763	SRA811199	AMA1_N2_DPY-27_RNAi_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	AMA1_N2_DPY-27_RNAi_emb_rep1_ChIP-seq;_Caenorha...	AMA-1|whole worms	AMA-1	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020764	SRA811199	AMA1_N2_DPY-27_RNAi_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	AMA1_N2_DPY-27_RNAi_emb_rep2_ChIP-seq;_Caenorha...	AMA-1|whole worms	AMA-1	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020765	SRA811199	RNA_Pol_II_N2_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	RNA_Pol_II_N2_emb_rep1_ChIP-seq;_Caenorhabditis...	8WG16|whole worms	8WG16	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020766	SRA811199	RNA_Pol_II_N2_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	RNA_Pol_II_N2_emb_rep2_ChIP-seq;_Caenorhabditis...	8WG16|whole worms	8WG16	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020767	SRA811199	RNA_Pol_II_CB428_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	RNA_Pol_II_CB428_emb_rep1_ChIP-seq;_Caenorhabdi...	8WG16|whole worms	8WG16	CB428|whole worms|mixed embryo	CB428	ChIP-Seq
SRX5020768	SRA811199	RNA_Pol_II_CB428_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	RNA_Pol_II_CB428_emb_rep2_ChIP-seq;_Caenorhabdi...	8WG16|whole worms	8WG16	CB428|whole worms|mixed embryo	CB428	ChIP-Seq
SRX5020769	SRA811199	RNA_Pol_II_GW638_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	RNA_Pol_II_GW638_emb_rep1_ChIP-seq;_Caenorhabdi...	8WG16|whole worms	8WG16	GW638|whole worms|mixed embryo	GW638	ChIP-Seq
SRX5020770	SRA811199	RNA_Pol_II_GW638_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	RNA_Pol_II_GW638_emb_rep2_ChIP-seq;_Caenorhabdi...	8WG16|whole worms	8WG16	GW638|whole worms|mixed embryo	GW638	ChIP-Seq
SRX5020771	SRA811199	CBP-1_N2_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	CBP-1_N2_emb_rep1_ChIP-seq;_Caenorhabditis_eleg...	CBP-1|whole worms	CBP-1	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020772	SRA811199	CBP-1_N2_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	CBP-1_N2_emb_rep2_ChIP-seq;_Caenorhabditis_eleg...	CBP-1|whole worms	CBP-1	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020773	SRA811199	CBP-1_N2_emb_rep3_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	CBP-1_N2_emb_rep3_ChIP-seq;_Caenorhabditis_eleg...	CBP-1|whole worms	CBP-1	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020774	SRA811199	CBP1_N2_DPY-27_RNAi_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	CBP1_N2_DPY-27_RNAi_emb_rep1_ChIP-seq;_Caenorha...	CBP-1|whole worms	CBP-1	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020775	SRA811199	CBP1_N2_DPY-27_RNAi_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	CBP1_N2_DPY-27_RNAi_emb_rep2_ChIP-seq;_Caenorha...	CBP-1|whole worms	CBP-1	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020776	SRA811199	MDT-15_N2_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	MDT-15_N2_emb_rep1_ChIP-seq;_Caenorhabditis_ele...	MDT-15|whole worms	MDT-15	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020777	SRA811199	MDT-15_N2_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	MDT-15_N2_emb_rep2_ChIP-seq;_Caenorhabditis_ele...	MDT-15|whole worms	MDT-15	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020778	SRA811199	PQN-85_N2_Control_RNAi_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	PQN-85_N2_Control_RNAi_emb_rep1_ChIP-seq;_Caeno...	PQN-85|whole worms	PQN-85	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020779	SRA811199	PQN-85_N2_Control_RNAi_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	PQN-85_N2_Control_RNAi_emb_rep2_ChIP-seq;_Caeno...	PQN-85|whole worms	PQN-85	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020780	SRA811199	PQN-85_N2_Control_RNAi_emb_rep3_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	PQN-85_N2_Control_RNAi_emb_rep3_ChIP-seq;_Caeno...	PQN-85|whole worms	PQN-85	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020781	SRA811199	PQN-85_N2_DPY-27_RNAi_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	PQN-85_N2_DPY-27_RNAi_emb_rep1_ChIP-seq;_Caenor...	PQN-85|whole worms	PQN-85	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020782	SRA811199	PQN-85_N2_DPY-27_RNAi_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	PQN-85_N2_DPY-27_RNAi_emb_rep2_ChIP-seq;_Caenor...	PQN-85|whole worms	PQN-85	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020783	SRA811199	PQN-85_N2_DPY-27_RNAi_emb_rep3_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	PQN-85_N2_DPY-27_RNAi_emb_rep3_ChIP-seq;_Caenor...	PQN-85|whole worms	PQN-85	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020784	SRA811199	PHA-4_N2_Control_RNAi_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	PHA-4_N2_Control_RNAi_emb_rep1_ChIP-seq;_Caenor...	PHA-4::GFP|whole worms	PHA-4::GFP	OP37|whole worms|mixed embryo	OP37	ChIP-Seq
SRX5020785	SRA811199	PHA-4_N2_Control_RNAi_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	PHA-4_N2_Control_RNAi_emb_rep2_ChIP-seq;_Caenor...	PHA-4::GFP|whole worms	PHA-4::GFP	OP37|whole worms|mixed embryo	OP37	ChIP-Seq
SRX5020786	SRA811199	PHA-4_N2_Control_RNAi_emb_rep3_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	PHA-4_N2_Control_RNAi_emb_rep3_ChIP-seq;_Caenor...	PHA-4::GFP|whole worms	PHA-4::GFP	OP37|whole worms|mixed embryo	OP37	ChIP-Seq
SRX5020787	SRA811199	PHA-4_N2_DPY-27_RNAi_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	PHA-4_N2_DPY-27_RNAi_emb_rep1_ChIP-seq;_Caenorh...	PHA-4::GFP|whole worms	PHA-4::GFP	OP37|whole worms|mixed embryo	OP37	ChIP-Seq
SRX5020788	SRA811199	PHA-4_N2_DPY-27_RNAi_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	PHA-4_N2_DPY-27_RNAi_emb_rep2_ChIP-seq;_Caenorh...	PHA-4::GFP|whole worms	PHA-4::GFP	OP37|whole worms|mixed embryo	OP37	ChIP-Seq
SRX5020789	SRA811199	PHA-4_N2_DPY-27_RNAi_emb_rep3_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	PHA-4_N2_DPY-27_RNAi_emb_rep3_ChIP-seq;_Caenorh...	PHA-4::GFP|whole worms	PHA-4::GFP	OP37|whole worms|mixed embryo	OP37	ChIP-Seq
SRX5020790	SRA811199	DPY-27_X;V_L3_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	DPY-27_X;V_L3_rep1_ChIP-seq;_Caenorhabditis_ele...	DPY-27|whole worms	DPY-27	15eh1|whole worms|L3	15eh1	ChIP-Seq
SRX5020791	SRA811199	DPY-27_X;V_L3_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	DPY-27_X;V_L3_rep2_ChIP-seq;_Caenorhabditis_ele...	DPY-27|whole worms	DPY-27	15eh1|whole worms|L3	15eh1	ChIP-Seq
SRX5020792	SRA811199	H3K4me3_X;V_L3_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_X;V_L3_rep1_ChIP-seq;_Caenorhabditis_el...	H3K4me3|whole worms	H3K4me3	15eh1|whole worms|L3	15eh1	ChIP-Seq
SRX5020793	SRA811199	H3K4me3_X;V_L3_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_X;V_L3_rep2_ChIP-seq;_Caenorhabditis_el...	H3K4me3|whole worms	H3K4me3	15eh1|whole worms|L3	15eh1	ChIP-Seq
SRX5020794	SRA811199	H3K27ac_X;V_L3_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K27ac_X;V_L3_rep1_ChIP-seq;_Caenorhabditis_el...	H3K27ac|whole worms	H3K27ac	15eh1|whole worms|L3	15eh1	ChIP-Seq
SRX5020795	SRA811199	H3K27ac_X;V_L3_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K27ac_X;V_L3_rep2_ChIP-seq;_Caenorhabditis_el...	H3K27ac|whole worms	H3K27ac	15eh1|whole worms|L3	15eh1	ChIP-Seq
SRX5020796	SRA811199	IgG_N2_L3_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	IgG_N2_L3_rep1_ChIP-seq;_Caenorhabditis_elegans...	IgG|whole worms	IgG	N2|whole worms|L3	N2	ChIP-Seq
SRX5020797	SRA811199	IgG_N2_L3_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	IgG_N2_L3_rep2_ChIP-seq;_Caenorhabditis_elegans...	IgG|whole worms	IgG	N2|whole worms|L3	N2	ChIP-Seq
SRX5020798	SRA811199	CJ21_input_CB428_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	CJ21_input_CB428_emb_ChIP-seq;_Caenorhabditis_e...	INPUT|whole worms	INPUT	CB428|whole worms|mixed embryo	CB428	ChIP-Seq
SRX5020799	SRA811199	CJ119_input_N2_DPY-27_RNAi_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	CJ119_input_N2_DPY-27_RNAi_emb_ChIP-seq;_Caenor...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020800	SRA811199	CJ120_input_N2_DPY-27_RNAi_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	CJ120_input_N2_DPY-27_RNAi_emb_ChIP-seq;_Caenor...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020801	SRA811199	LAS52_input_GW638_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	LAS52_input_GW638_emb_ChIP-seq;_Caenorhabditis_...	INPUT|whole worms	INPUT	GW638|whole worms|mixed embryo	GW638	ChIP-Seq
SRX5020802	SRA811199	LAS58_input_OP37_Control_RNAi_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	LAS58_input_OP37_Control_RNAi_emb_ChIP-seq;_Cae...	INPUT|whole worms	INPUT	OP37|whole worms|mixed embryo	OP37	ChIP-Seq
SRX5020803	SRA811199	LAS59__input_OP37_DPY-27_RNAi_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	LAS59__input_OP37_DPY-27_RNAi_emb_ChIP-seq;_Cae...	INPUT|whole worms	INPUT	OP37|whole worms|mixed embryo	OP37	ChIP-Seq
SRX5020804	SRA811199	LAS60_input_OP37_Control_RNAi_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	LAS60_input_OP37_Control_RNAi_emb_ChIP-seq;_Cae...	INPUT|whole worms	INPUT	OP37|whole worms|mixed embryo	OP37	ChIP-Seq
SRX5020805	SRA811199	LAS61_input_OP37_DPY-27_RNAi_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	LAS61_input_OP37_DPY-27_RNAi_emb_ChIP-seq;_Caen...	INPUT|whole worms	INPUT	OP37|whole worms|mixed embryo	OP37	ChIP-Seq
SRX5020806	SRA811199	LAS79_input_N2_DPY-27_RNAi_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	LAS79_input_N2_DPY-27_RNAi_emb_ChIP-seq;_Caenor...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020807	SRA811199	LAS80_input_GW638_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	LAS80_input_GW638_emb_ChIP-seq;_Caenorhabditis_...	INPUT|whole worms	INPUT	GW638|whole worms|mixed embryo	GW638	ChIP-Seq
SRX5020808	SRA811199	LAS93_input_N2_DPY-27_RNAi_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	LAS93_input_N2_DPY-27_RNAi_emb_ChIP-seq;_Caenor...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020809	SRA811199	LAS94_input_N2_Control_RNAi_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	LAS94_input_N2_Control_RNAi_emb_ChIP-seq;_Caeno...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020810	SRA811199	LAS95_input_N2_DPY-27_RNAi_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	LAS95_input_N2_DPY-27_RNAi_emb_ChIP-seq;_Caenor...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020811	SRA811199	LAS96_input_N2_Control_RNAi_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	LAS96_input_N2_Control_RNAi_emb_ChIP-seq;_Caeno...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020812	SRA811199	LW100_input_N2_Control_RNAi_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	LW100_input_N2_Control_RNAi_emb_ChIP-seq;_Caeno...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020813	SRA811199	LW101_input_N2_DPY-27_RNAi_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	LW101_input_N2_DPY-27_RNAi_emb_ChIP-seq;_Caenor...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020814	SRA811199	LW102_input_N2_DPY-27_RNAi_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	LW102_input_N2_DPY-27_RNAi_emb_ChIP-seq;_Caenor...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020815	SRA811199	LW110_input_N2_Control_RNAi_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	LW110_input_N2_Control_RNAi_emb_ChIP-seq;_Caeno...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020816	SRA811199	LW111_input_N2_DPY-27_RNAi_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	LW111_input_N2_DPY-27_RNAi_emb_ChIP-seq;_Caenor...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020817	SRA811199	LW144_input_CB428_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	LW144_input_CB428_emb_ChIP-seq;_Caenorhabditis_...	INPUT|whole worms	INPUT	CB428|whole worms|mixed embryo	CB428	ChIP-Seq
SRX5020818	SRA811199	LW145_input_CB428_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	LW145_input_CB428_emb_ChIP-seq;_Caenorhabditis_...	INPUT|whole worms	INPUT	CB428|whole worms|mixed embryo	CB428	ChIP-Seq
SRX5020819	SRA811199	LW179_input_N2_DPY-27_RNAi_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	LW179_input_N2_DPY-27_RNAi_emb_ChIP-seq;_Caenor...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020820	SRA811199	LW180_input_N2_Control_RNAi_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	LW180_input_N2_Control_RNAi_emb_ChIP-seq;_Caeno...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020821	SRA811199	LW205_input_N2_Control_RNAi_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	LW205_input_N2_Control_RNAi_emb_ChIP-seq;_Caeno...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020822	SRA811199	LW55_input_N2_Control_RNAi_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	LW55_input_N2_Control_RNAi_emb_ChIP-seq;_Caenor...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020823	SRA811199	LW68_input_N2_DPY-27_RNAi_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	LW68_input_N2_DPY-27_RNAi_emb_ChIP-seq;_Caenorh...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020824	SRA811199	LW69_input_N2_DPY-27_RNAi_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	LW69_input_N2_DPY-27_RNAi_emb_ChIP-seq;_Caenorh...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020825	SRA811199	LW76_input_N2_Control_RNAi_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	LW76_input_N2_Control_RNAi_emb_ChIP-seq;_Caenor...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020826	SRA811199	LW77_input_N2_DPY-27_RNAi_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	LW77_input_N2_DPY-27_RNAi_emb_ChIP-seq;_Caenorh...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020827	SRA811199	LW89_input_N2_Control_RNAi_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	LW89_input_N2_Control_RNAi_emb_ChIP-seq;_Caenor...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020828	SRA811199	LW99_input_N2_Control_RNAi_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	LW99_input_N2_Control_RNAi_emb_ChIP-seq;_Caenor...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020829	SRA811199	SE197_input_N2_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SE197_input_N2_emb_ChIP-seq;_Caenorhabditis_ele...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020830	SRA811199	SE248_input_N2_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SE248_input_N2_emb_ChIP-seq;_Caenorhabditis_ele...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020831	SRA811199	SE346_input_N2_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SE346_input_N2_emb_ChIP-seq;_Caenorhabditis_ele...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020832	SRA811199	SE364_input_X;V_L3_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SE364_input_X;V_L3_ChIP-seq;_Caenorhabditis_ele...	INPUT|whole worms	INPUT	15eh1|whole worms|L3	15eh1	ChIP-Seq
SRX5020833	SRA811199	SEA150_input_X;V_L3_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SEA150_input_X;V_L3_ChIP-seq;_Caenorhabditis_el...	INPUT|whole worms	INPUT	15eh1|whole worms|L3	15eh1	ChIP-Seq
SRX5020834	SRA811199	SEA152_input_X;V_L3_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SEA152_input_X;V_L3_ChIP-seq;_Caenorhabditis_el...	INPUT|whole worms	INPUT	15eh1|whole worms|L3	15eh1	ChIP-Seq
SRX5020835	SRA811199	SEA181_input_CB428_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	SEA181_input_CB428_emb_ChIP-seq;_Caenorhabditis...	INPUT|whole worms	INPUT	CB428|whole worms|mixed embryo	CB428	ChIP-Seq
SRX5020836	SRA811199	LAS70_input_N2_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	LAS70_input_N2_emb_ChIP-seq;_Caenorhabditis_ele...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020837	SRA811199	CJ19_input_N2_MxEmb_ChIP-seq_(reanalysis);_Caenorhabditis_elegans;_ChIP-Seq	CJ19_input_N2_MxEmb_ChIP-seq_(reanalysis);_Caen...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020838	SRA811199	SE176_input_N2_MxEmb_ChIP-seq_(reanalysis);_Caenorhabditis_elegans;_ChIP-Seq	SE176_input_N2_MxEmb_ChIP-seq_(reanalysis);_Cae...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020839	SRA811199	SE210_input_N2_MxEmb_ChIP-seq_(reanalysis);_Caenorhabditis_elegans;_ChIP-Seq	SE210_input_N2_MxEmb_ChIP-seq_(reanalysis);_Cae...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020840	SRA811199	LW127_input_N2_emb_ChIP-seq_(reanalysis);_Caenorhabditis_elegans;_ChIP-Seq	LW127_input_N2_emb_ChIP-seq_(reanalysis);_Caeno...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020841	SRA811199	CJ44_input_N2_emb_ChIP-seq_(reanalysis);_Caenorhabditis_elegans;_ChIP-Seq	CJ44_input_N2_emb_ChIP-seq_(reanalysis);_Caenor...	INPUT|whole worms	INPUT	CB428|whole worms|mixed embryo	CB428	ChIP-Seq
SRX5020842	SRA811199	LW192_input_N2_L3_ChIP-seq_(reanalysis);_Caenorhabditis_elegans;_ChIP-Seq	LW192_input_N2_L3_ChIP-seq_(reanalysis);_Caenor...	INPUT|whole worms	INPUT	N2|whole worms|L3	N2	ChIP-Seq
SRX5020843	SRA811199	SE245_input_N2_L3_ChIP-seq_(reanalysis);_Caenorhabditis_elegans;_ChIP-Seq	SE245_input_N2_L3_ChIP-seq_(reanalysis);_Caenor...	INPUT|whole worms	INPUT	N2|whole worms|L3	N2	ChIP-Seq
SRX5020844	SRA811199	SE169_input_CB428_emb_ChIP-seq_(reanalysis);_Caenorhabditis_elegans;_ChIP-Seq	SE169_input_CB428_emb_ChIP-seq_(reanalysis);_Ca...	INPUT|whole worms	INPUT	CB428|whole worms|mixed embryo	CB428	ChIP-Seq
SRX5020845	SRA811199	SE139_input_N2_emb_ChIP-seq_(reanalysis);_Caenorhabditis_elegans;_ChIP-Seq	SE139_input_N2_emb_ChIP-seq_(reanalysis);_Caeno...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020846	SRA811199	SE140_input_N2_emb_ChIP-seq_(reanalysis);_Caenorhabditis_elegans;_ChIP-Seq	SE140_input_N2_emb_ChIP-seq_(reanalysis);_Caeno...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5020847	SRA811199	BC032_input_N2_emb_ChIP-seq_(reanalysis);_Caenorhabditis_elegans;_ChIP-Seq	BC032_input_N2_emb_ChIP-seq_(reanalysis);_Caeno...	INPUT|whole worms	INPUT	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX5064640	SRA815165	H3K4me3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3(Abcam)|whole worms	H3K4me3(Abcam)	N2|whole worms|L4	N2	ChIP-Seq
SRX5064641	SRA815165	H3K4me3_input;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_input;_Caenorhabditis_elegans;_ChIP-Seq	input|whole worms	input	N2|whole worms|L4	N2	ChIP-Seq
SRX5064642	SRA815165	H3K9me3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3(Abcam)|whole worms	H3K9me3(Abcam)	N2|whole worms|L4	N2	ChIP-Seq
SRX5064643	SRA815165	H3K9me3_input;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_input;_Caenorhabditis_elegans;_ChIP-Seq	input|whole worms	input	N2|whole worms|L4	N2	ChIP-Seq
SRX5073496	SRA687155	OP201_input_r4;_Caenorhabditis_elegans;_ChIP-Seq	OP201_input_r4;_Caenorhabditis_elegans;_ChIP-Seq	none|Whole animals	none	OP201|Whole animals|Day 1 adults	OP201	ChIP-Seq
SRX5073497	SRA687155	OP201_PQM-1_M2_IP_r4;_Caenorhabditis_elegans;_ChIP-Seq	OP201_PQM-1_M2_IP_r4;_Caenorhabditis_elegans;_C...	anti-FLAG (M2, Sigma-Aldrich, F1804)|Whole animals	anti-FLAG (M2, Sigma-A...	OP201|Whole animals|Day 1 adults	OP201	ChIP-Seq
SRX5073498	SRA687155	DLS422_PQM-1_M2_IP_r4;_Caenorhabditis_elegans;_ChIP-Seq	DLS422_PQM-1_M2_IP_r4;_Caenorhabditis_elegans;_...	anti-FLAG (M2, Sigma-Aldrich, F1804)|Whole animals	anti-FLAG (M2, Sigma-A...	DLS422|Whole animals|Day 1 adults	DLS422	ChIP-Seq
SRX5073499	SRA687155	DLS395_CEH-60_3F10_IP_r2;_Caenorhabditis_elegans;_ChIP-Seq	DLS395_CEH-60_3F10_IP_r2;_Caenorhabditis_elegan...	anti-HA (3F10, Sigma-Aldrich, 11867423001)|Whole animals	anti-HA (3F10, Sigma-A...	DLS395|Whole animals|Day 1 adults	DLS395	ChIP-Seq
SRX5073500	SRA687155	DLS435_CEH-60_3F10_IP_r2;_Caenorhabditis_elegans;_ChIP-Seq	DLS435_CEH-60_3F10_IP_r2;_Caenorhabditis_elegan...	anti-HA (3F10, Sigma-Aldrich, 11867423001)|Whole animals	anti-HA (3F10, Sigma-A...	DLS435|Whole animals|Day 1 adults	DLS435	ChIP-Seq
SRX514567	SRA157029	H4K16ac_ChIP-seq,_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H4K16ac_ChIP-seq,_rep1;_Caenorhabditis_elegans;...	anti-H4K16ac|L3 larvae, H4K16ac ChIP	anti-H4K16ac	L3 larvae, H4K16ac ChIP|whole body|L3	L3 larvae, H4K16ac ChIP	ChIP-Seq
SRX514568	SRA157029	H4K16ac_ChIP-seq,_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H4K16ac_ChIP-seq,_rep2;_Caenorhabditis_elegans;...	anti-H4K16ac|L3 larvae, H4K16ac ChIP	anti-H4K16ac	L3 larvae, H4K16ac ChIP|whole body|L3	L3 larvae, H4K16ac ChIP	ChIP-Seq
SRX514569	SRA157029	Input,_rep1;_Caenorhabditis_elegans;_ChIP-Seq	Input,_rep1;_Caenorhabditis_elegans;_ChIP-Seq	none|L3 larvae, input	none	L3 larvae, input|whole body|L3	L3 larvae, input	ChIP-Seq
SRX514570	SRA157029	Input,_rep2;_Caenorhabditis_elegans;_ChIP-Seq	Input,_rep2;_Caenorhabditis_elegans;_ChIP-Seq	none|L3 larvae, input	none	L3 larvae, input|whole body|L3	L3 larvae, input	ChIP-Seq
SRX514727	SRA157221	H4K16ac.MP07329.EE8.1B;_Caenorhabditis_elegans;_ChIP-Seq	H4K16ac.MP07329.EE8.1B;_Caenorhabditis_elegans;...	H4K16ac|early embryos H4K16ac ChIP seq	H4K16ac	N2|early embryos H4K16ac ChIP seq|whole embryo|early embryos	N2	ChIP-Seq
SRX514728	SRA157221	Input.EE8.1B;_Caenorhabditis_elegans;_ChIP-Seq	Input.EE8.1B;_Caenorhabditis_elegans;_ChIP-Seq	none (input)|early embryos Input DNA seq	none (input)	N2|early embryos Input DNA seq|whole embryo|early embryos	N2	ChIP-Seq
SRX514729	SRA157221	H4K16ac.MP07329.EE18;_Caenorhabditis_elegans;_ChIP-Seq	H4K16ac.MP07329.EE18;_Caenorhabditis_elegans;_C...	H4K16ac|early embryos H4K16ac ChIP seq	H4K16ac	N2|early embryos H4K16ac ChIP seq|whole embryo|early embryos	N2	ChIP-Seq
SRX514730	SRA157221	Input.EE18;_Caenorhabditis_elegans;_ChIP-Seq	Input.EE18;_Caenorhabditis_elegans;_ChIP-Seq	none (input)|early embryos Input DNA seq	none (input)	N2|early embryos Input DNA seq|whole embryo|early embryos	N2	ChIP-Seq
SRX515118	SRA157368	Snyder_EFL-1_GFP_L1_Input_Rep2_extraction3_seq3;_Caenorhabditis_elegans;_ChIP-Seq	Snyder_EFL-1_GFP_L1_Input_Rep2_extraction3_seq3...	EFL-1_GFP_L1 Input Rep.2 extraction4_seq4	EFL-1_GFP_L1 Input Rep...	YL418(official name : YL418 genotype : unc-119(ed3) III; vrIs65pGES-1::EFL-1::GFP FLAG:EFL-1 3'-UTR genotype : unc-119 (+) outcross : 0 mutagen : None tags : GFP::3xFlag description : The EFL-1::GFP fusion protein is driven by the ges-1 promoter and expressed in the instestine. made_by : Michelle Kudron (Valerie Reinke's lab) )|EFL-1_GFP_L1 Input Rep.2 extraction4_seq4|fed L1	YL418(official name : ...	ChIP-Seq
SRX529206	SRA160435	seq-AR0144_H3_144_N2_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-AR0144_H3_144_N2_L3_Input_Rep1;_Caenorhabdi...	seq-AR0144_H3_144_N2_L3_Input_Rep1	seq-AR0144_H3_144_N2_L...	N2|seq-AR0144_H3_144_N2_L3_Input_Rep1|L3 Larva	N2	ChIP-Seq
SRX529207	SRA160435	seq-AR0144_H3_144_N2_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-AR0144_H3_144_N2_L3_Input_Rep2;_Caenorhabdi...	seq-AR0144_H3_144_N2_L3_Input_Rep2	seq-AR0144_H3_144_N2_L...	N2|seq-AR0144_H3_144_N2_L3_Input_Rep2|L3 Larva	N2	ChIP-Seq
SRX529208	SRA160435	seq-AR0144_H3_144_N2_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-AR0144_H3_144_N2_L3_ChIP_Rep1;_Caenorhabdit...	seq-AR0144_H3_144_N2_L3_ChIP_Rep1	seq-AR0144_H3_144_N2_L...	N2|seq-AR0144_H3_144_N2_L3_ChIP_Rep1|L3 Larva	N2	ChIP-Seq
SRX529209	SRA160435	seq-AR0144_H3_144_N2_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-AR0144_H3_144_N2_L3_ChIP_Rep2;_Caenorhabdit...	seq-AR0144_H3_144_N2_L3_ChIP_Rep2	seq-AR0144_H3_144_N2_L...	N2|seq-AR0144_H3_144_N2_L3_ChIP_Rep2|L3 Larva	N2	ChIP-Seq
SRX529210	SRA160436	seq-WA30932379_H3K9ac_N2_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-WA30932379_H3K9ac_N2_L3_Input_Rep1;_Caenorh...	seq-WA30932379_H3K9ac_N2_L3_Input_Rep1	seq-WA30932379_H3K9ac_...	N2|seq-WA30932379_H3K9ac_N2_L3_Input_Rep1|L3 Larva	N2	ChIP-Seq
SRX529211	SRA160436	seq-WA30932379_H3K9ac_N2_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-WA30932379_H3K9ac_N2_L3_Input_Rep2;_Caenorh...	seq-WA30932379_H3K9ac_N2_L3_Input_Rep2	seq-WA30932379_H3K9ac_...	N2|seq-WA30932379_H3K9ac_N2_L3_Input_Rep2|L3 Larva	N2	ChIP-Seq
SRX529212	SRA160436	seq-WA30932379_H3K9ac_N2_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-WA30932379_H3K9ac_N2_L3_ChIP_Rep1;_Caenorha...	seq-WA30932379_H3K9ac_N2_L3_ChIP_Rep1	seq-WA30932379_H3K9ac_...	N2|seq-WA30932379_H3K9ac_N2_L3_ChIP_Rep1|L3 Larva	N2	ChIP-Seq
SRX529213	SRA160436	seq-WA30932379_H3K9ac_N2_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-WA30932379_H3K9ac_N2_L3_ChIP_Rep2;_Caenorha...	seq-WA30932379_H3K9ac_N2_L3_ChIP_Rep2	seq-WA30932379_H3K9ac_...	N2|seq-WA30932379_H3K9ac_N2_L3_ChIP_Rep2|L3 Larva	N2	ChIP-Seq
SRX529214	SRA160437	seq-SDQ4501_T09A5.8_FEM2_AD_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4501_T09A5.8_FEM2_AD_Input_Rep1;_Caenorh...	seq-SDQ4501_T09A5.8_FEM2_AD_Input_Rep1	seq-SDQ4501_T09A5.8_FE...	fem-2(b245)|seq-SDQ4501_T09A5.8_FEM2_AD_Input_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX529215	SRA160437	seq-SDQ4501_T09A5.8_FEM2_AD_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4501_T09A5.8_FEM2_AD_Input_Rep2;_Caenorh...	seq-SDQ4501_T09A5.8_FEM2_AD_Input_Rep2	seq-SDQ4501_T09A5.8_FE...	fem-2(b245)|seq-SDQ4501_T09A5.8_FEM2_AD_Input_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX529216	SRA160437	seq-SDQ4501_T09A5.8_FEM2_AD_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4501_T09A5.8_FEM2_AD_ChIP_Rep1;_Caenorha...	seq-SDQ4501_T09A5.8_FEM2_AD_ChIP_Rep1	seq-SDQ4501_T09A5.8_FE...	fem-2(b245)|seq-SDQ4501_T09A5.8_FEM2_AD_ChIP_Rep1|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX529217	SRA160437	seq-SDQ4501_T09A5.8_FEM2_AD_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ4501_T09A5.8_FEM2_AD_ChIP_Rep2;_Caenorha...	seq-SDQ4501_T09A5.8_FEM2_AD_ChIP_Rep2	seq-SDQ4501_T09A5.8_FE...	fem-2(b245)|seq-SDQ4501_T09A5.8_FEM2_AD_ChIP_Rep2|Germline containing young adult	fem-2(b245)	ChIP-Seq
SRX529218	SRA160438	seq-SDQ3166_LIN37_N2_LTemb_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3166_LIN37_N2_LTemb_Input_Rep1;_Caenorha...	seq-SDQ3166_LIN37_N2_LTemb_Input_Rep1	seq-SDQ3166_LIN37_N2_L...	N2|seq-SDQ3166_LIN37_N2_LTemb_Input_Rep1|Late Embryos	N2	ChIP-Seq
SRX529219	SRA160438	seq-SDQ3166_LIN37_N2_LTemb_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3166_LIN37_N2_LTemb_Input_Rep2;_Caenorha...	seq-SDQ3166_LIN37_N2_LTemb_Input_Rep2	seq-SDQ3166_LIN37_N2_L...	N2|seq-SDQ3166_LIN37_N2_LTemb_Input_Rep2|Late Embryos	N2	ChIP-Seq
SRX529220	SRA160438	seq-SDQ3166_LIN37_N2_LTemb_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3166_LIN37_N2_LTemb_ChIP_Rep1;_Caenorhab...	seq-SDQ3166_LIN37_N2_LTemb_ChIP_Rep1	seq-SDQ3166_LIN37_N2_L...	N2|seq-SDQ3166_LIN37_N2_LTemb_ChIP_Rep1|Late Embryos	N2	ChIP-Seq
SRX529221	SRA160438	seq-SDQ3166_LIN37_N2_LTemb_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-SDQ3166_LIN37_N2_LTemb_ChIP_Rep2;_Caenorhab...	seq-SDQ3166_LIN37_N2_LTemb_ChIP_Rep2	seq-SDQ3166_LIN37_N2_L...	N2|seq-SDQ3166_LIN37_N2_LTemb_ChIP_Rep2|Late Embryos	N2	ChIP-Seq
SRX529222	SRA160439	seq-ab8896_H3K9me1_104560_N2_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab8896_H3K9me1_104560_N2_L3_Input_Rep1;_Cae...	seq-ab8896_H3K9me1_104560_N2_L3_Input_Rep1	seq-ab8896_H3K9me1_104...	N2|seq-ab8896_H3K9me1_104560_N2_L3_Input_Rep1|L3 Larva	N2	ChIP-Seq
SRX529223	SRA160439	seq-ab8896_H3K9me1_104560_N2_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab8896_H3K9me1_104560_N2_L3_Input_Rep2;_Cae...	seq-ab8896_H3K9me1_104560_N2_L3_Input_Rep2	seq-ab8896_H3K9me1_104...	N2|seq-ab8896_H3K9me1_104560_N2_L3_Input_Rep2|L3 Larva	N2	ChIP-Seq
SRX529224	SRA160439	seq-ab8896_H3K9me1_104560_N2_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab8896_H3K9me1_104560_N2_L3_ChIP_Rep1;_Caen...	seq-ab8896_H3K9me1_104560_N2_L3_ChIP_Rep1	seq-ab8896_H3K9me1_104...	N2|seq-ab8896_H3K9me1_104560_N2_L3_ChIP_Rep1|L3 Larva	N2	ChIP-Seq
SRX529225	SRA160439	seq-ab8896_H3K9me1_104560_N2_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab8896_H3K9me1_104560_N2_L3_ChIP_Rep2;_Caen...	seq-ab8896_H3K9me1_104560_N2_L3_ChIP_Rep2	seq-ab8896_H3K9me1_104...	N2|seq-ab8896_H3K9me1_104560_N2_L3_ChIP_Rep2|L3 Larva	N2	ChIP-Seq
SRX529226	SRA160440	seq-ab8895_H3K4me1:733246_N2_L3_Input_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab8895_H3K4me1:733246_N2_L3_Input_Rep1;_Cae...	seq-ab8895_H3K4me1:733246_N2_L3_Input_Rep1	seq-ab8895_H3K4me1:733...	N2|seq-ab8895_H3K4me1:733246_N2_L3_Input_Rep1|L3 Larva	N2	ChIP-Seq
SRX529227	SRA160440	seq-ab8895_H3K4me1:733246_N2_L3_Input_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab8895_H3K4me1:733246_N2_L3_Input_Rep2;_Cae...	seq-ab8895_H3K4me1:733246_N2_L3_Input_Rep2	seq-ab8895_H3K4me1:733...	N2|seq-ab8895_H3K4me1:733246_N2_L3_Input_Rep2|L3 Larva	N2	ChIP-Seq
SRX529228	SRA160440	seq-ab8895_H3K4me1:733246_N2_L3_ChIP_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab8895_H3K4me1:733246_N2_L3_ChIP_Rep1;_Caen...	seq-ab8895_H3K4me1:733246_N2_L3_ChIP_Rep1	seq-ab8895_H3K4me1:733...	N2|seq-ab8895_H3K4me1:733246_N2_L3_ChIP_Rep1|L3 Larva	N2	ChIP-Seq
SRX529229	SRA160440	seq-ab8895_H3K4me1:733246_N2_L3_ChIP_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	seq-ab8895_H3K4me1:733246_N2_L3_ChIP_Rep2;_Caen...	seq-ab8895_H3K4me1:733246_N2_L3_ChIP_Rep2	seq-ab8895_H3K4me1:733...	N2|seq-ab8895_H3K4me1:733246_N2_L3_ChIP_Rep2|L3 Larva	N2	ChIP-Seq
SRX5402697	SRA851254	H3K27me3_N2_20C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me3_N2_20C_rep1;_Caenorhabditis_elegans;_C...	Fujifilm Wako MABI0323, #30995259|H3K27me3 N2 20C	Fujifilm Wako MABI0323...	H3K27me3 N2 20C|L1	H3K27me3 N2 20C	ChIP-Seq
SRX5402698	SRA851254	H3K27me3_N2_26C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me3_N2_26C_rep1;_Caenorhabditis_elegans;_C...	Fujifilm Wako MABI0323, #30995259|H3K27me3 N2 26C	Fujifilm Wako MABI0323...	H3K27me3 N2 26C|L1	H3K27me3 N2 26C	ChIP-Seq
SRX5402699	SRA851254	H3K27me3_lin15B_20C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me3_lin15B_20C_rep1;_Caenorhabditis_elegan...	Fujifilm Wako MABI0323, #30995259|H3K27me3 lin15B 20C	Fujifilm Wako MABI0323...	H3K27me3 lin15B 20C|L1	H3K27me3 lin15B 20C	ChIP-Seq
SRX5402700	SRA851254	H3K27me3_lin15B_26C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me3_lin15B_26C_rep1;_Caenorhabditis_elegan...	Fujifilm Wako MABI0323, #30995259|H3K27me3 lin15B 26C	Fujifilm Wako MABI0323...	H3K27me3 lin15B 26C|L1	H3K27me3 lin15B 26C	ChIP-Seq
SRX5402701	SRA851254	H3K27me3_lin35_20C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me3_lin35_20C_rep1;_Caenorhabditis_elegans...	Fujifilm Wako MABI0323, #30995259|H3K27me3 lin35 20C	Fujifilm Wako MABI0323...	H3K27me3 lin35 20C|L1	H3K27me3 lin35 20C	ChIP-Seq
SRX5402702	SRA851254	H3K27me3_lin35_26C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me3_lin35_26C_rep1;_Caenorhabditis_elegans...	Fujifilm Wako MABI0323, #30995259|H3K27me3 lin35 26C	Fujifilm Wako MABI0323...	H3K27me3 lin35 26C|L1	H3K27me3 lin35 26C	ChIP-Seq
SRX5402703	SRA851254	H3K27me3_lin37_20C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me3_lin37_20C_rep1;_Caenorhabditis_elegans...	Fujifilm Wako MABI0323, #30995259|H3K27me3 lin37 20C	Fujifilm Wako MABI0323...	H3K27me3 lin37 20C|L1	H3K27me3 lin37 20C	ChIP-Seq
SRX5402704	SRA851254	H3K27me3_lin37_26C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K27me3_lin37_26C_rep1;_Caenorhabditis_elegans...	Fujifilm Wako MABI0323, #30995259|H3K27me3 lin37 26C	Fujifilm Wako MABI0323...	H3K27me3 lin37 26C|L1	H3K27me3 lin37 26C	ChIP-Seq
SRX5402705	SRA851254	H3K36me3_N2_20C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_N2_20C_rep1;_Caenorhabditis_elegans;_C...	Fujifilm Wako MABI0333, #300952|H3K36me3 N2 20C	Fujifilm Wako MABI0333...	H3K36me3 N2 20C|L1	H3K36me3 N2 20C	ChIP-Seq
SRX5402706	SRA851254	H3K36me3_N2_20C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_N2_20C_rep2;_Caenorhabditis_elegans;_C...	Fujifilm Wako MABI0333, #300952|H3K36me3 N2 20C	Fujifilm Wako MABI0333...	H3K36me3 N2 20C|L1	H3K36me3 N2 20C	ChIP-Seq
SRX5402707	SRA851254	H3K36me3_N2_26C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_N2_26C_rep1;_Caenorhabditis_elegans;_C...	Fujifilm Wako MABI0333, #300952|H3K36me3 N2 26C	Fujifilm Wako MABI0333...	H3K36me3 N2 26C|L1	H3K36me3 N2 26C	ChIP-Seq
SRX5402708	SRA851254	H3K36me3_N2_26C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_N2_26C_rep2;_Caenorhabditis_elegans;_C...	Fujifilm Wako MABI0333, #300952|H3K36me3 N2 26C	Fujifilm Wako MABI0333...	H3K36me3 N2 26C|L1	H3K36me3 N2 26C	ChIP-Seq
SRX5402709	SRA851254	H3K36me3_lin15B_20C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_lin15B_20C_rep1;_Caenorhabditis_elegan...	Fujifilm Wako MABI0333, #300952|H3K36me3 lin15B 20C	Fujifilm Wako MABI0333...	H3K36me3 lin15B 20C|L1	H3K36me3 lin15B 20C	ChIP-Seq
SRX5402710	SRA851254	H3K36me3_lin15B_20C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_lin15B_20C_rep2;_Caenorhabditis_elegan...	Fujifilm Wako MABI0333, #300952|H3K36me3 lin15B 20C	Fujifilm Wako MABI0333...	H3K36me3 lin15B 20C|L1	H3K36me3 lin15B 20C	ChIP-Seq
SRX5402711	SRA851254	H3K36me3_lin15B_26C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_lin15B_26C_rep1;_Caenorhabditis_elegan...	Fujifilm Wako MABI0333, #300952|H3K36me3 lin15B 26C	Fujifilm Wako MABI0333...	H3K36me3 lin15B 26C|L1	H3K36me3 lin15B 26C	ChIP-Seq
SRX5402712	SRA851254	H3K36me3_lin15B_26C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_lin15B_26C_rep2;_Caenorhabditis_elegan...	Fujifilm Wako MABI0333, #300952|H3K36me3 lin15B 26C	Fujifilm Wako MABI0333...	H3K36me3 lin15B 26C|L1	H3K36me3 lin15B 26C	ChIP-Seq
SRX5402713	SRA851254	H3K36me3_lin35_20C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_lin35_20C_rep1;_Caenorhabditis_elegans...	Fujifilm Wako MABI0333, #300952|H3K36me3 lin35 20C	Fujifilm Wako MABI0333...	H3K36me3 lin35 20C|L1	H3K36me3 lin35 20C	ChIP-Seq
SRX5402714	SRA851254	H3K36me3_lin35_20C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_lin35_20C_rep2;_Caenorhabditis_elegans...	Fujifilm Wako MABI0333, #300952|H3K36me3 lin35 20C	Fujifilm Wako MABI0333...	H3K36me3 lin35 20C|L1	H3K36me3 lin35 20C	ChIP-Seq
SRX5402715	SRA851254	H3K36me3_lin35_26C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_lin35_26C_rep1;_Caenorhabditis_elegans...	Fujifilm Wako MABI0333, #300952|H3K36me3 lin35 26C	Fujifilm Wako MABI0333...	H3K36me3 lin35 26C|L1	H3K36me3 lin35 26C	ChIP-Seq
SRX5402716	SRA851254	H3K36me3_lin35_26C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_lin35_26C_rep2;_Caenorhabditis_elegans...	Fujifilm Wako MABI0333, #300952|H3K36me3 lin35 26C	Fujifilm Wako MABI0333...	H3K36me3 lin35 26C|L1	H3K36me3 lin35 26C	ChIP-Seq
SRX5402717	SRA851254	H3K36me3_lin37_20C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_lin37_20C_rep1;_Caenorhabditis_elegans...	Fujifilm Wako MABI0333, #300952|H3K36me3 lin37 20C	Fujifilm Wako MABI0333...	H3K36me3 lin37 20C|L1	H3K36me3 lin37 20C	ChIP-Seq
SRX5402718	SRA851254	H3K36me3_lin37_20C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_lin37_20C_rep2;_Caenorhabditis_elegans...	Fujifilm Wako MABI0333, #300952|H3K36me3 lin37 20C	Fujifilm Wako MABI0333...	H3K36me3 lin37 20C|L1	H3K36me3 lin37 20C	ChIP-Seq
SRX5402719	SRA851254	H3K36me3_lin37_20C_rep3;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_lin37_20C_rep3;_Caenorhabditis_elegans...	Fujifilm Wako MABI0333, #300952|H3K36me3 lin37 20C	Fujifilm Wako MABI0333...	H3K36me3 lin37 20C|L1	H3K36me3 lin37 20C	ChIP-Seq
SRX5402720	SRA851254	H3K36me3_lin37_26C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_lin37_26C_rep1;_Caenorhabditis_elegans...	Fujifilm Wako MABI0333, #300952|H3K36me3 lin37 26C	Fujifilm Wako MABI0333...	H3K36me3 lin37 26C|L1	H3K36me3 lin37 26C	ChIP-Seq
SRX5402721	SRA851254	H3K36me3_lin37_26C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_lin37_26C_rep2;_Caenorhabditis_elegans...	Fujifilm Wako MABI0333, #300952|H3K36me3 lin37 26C	Fujifilm Wako MABI0333...	H3K36me3 lin37 26C|L1	H3K36me3 lin37 26C	ChIP-Seq
SRX5402722	SRA851254	H3K36me3_lin37_26C_rep3;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_lin37_26C_rep3;_Caenorhabditis_elegans...	Fujifilm Wako MABI0333, #300952|H3K36me3 lin37 26C	Fujifilm Wako MABI0333...	H3K36me3 lin37 26C|L1	H3K36me3 lin37 26C	ChIP-Seq
SRX5402723	SRA851254	H3K4me3_N2_20C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_N2_20C_rep1;_Caenorhabditis_elegans;_Ch...	Fujifilm Wako MABI0304, #30534819|H3K4me3 N2 20C	Fujifilm Wako MABI0304...	H3K4me3 N2 20C|L1	H3K4me3 N2 20C	ChIP-Seq
SRX5402724	SRA851254	H3K4me3_N2_20C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_N2_20C_rep2;_Caenorhabditis_elegans;_Ch...	Fujifilm Wako MABI0304, #30534819|H3K4me3 N2 20C	Fujifilm Wako MABI0304...	H3K4me3 N2 20C|L1	H3K4me3 N2 20C	ChIP-Seq
SRX5402725	SRA851254	H3K4me3_N2_26C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_N2_26C_rep1;_Caenorhabditis_elegans;_Ch...	Fujifilm Wako MABI0304, #30534819|H3K4me3 N2 26C	Fujifilm Wako MABI0304...	H3K4me3 N2 26C|L1	H3K4me3 N2 26C	ChIP-Seq
SRX5402726	SRA851254	H3K4me3_N2_26C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_N2_26C_rep2;_Caenorhabditis_elegans;_Ch...	Fujifilm Wako MABI0304, #30534819|H3K4me3 N2 26C	Fujifilm Wako MABI0304...	H3K4me3 N2 26C|L1	H3K4me3 N2 26C	ChIP-Seq
SRX5402727	SRA851254	H3K4me3_lin15B_20C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_lin15B_20C_rep1;_Caenorhabditis_elegans...	Fujifilm Wako MABI0304, #30534819|H3K4me3 lin15B 20C	Fujifilm Wako MABI0304...	H3K4me3 lin15B 20C|L1	H3K4me3 lin15B 20C	ChIP-Seq
SRX5402728	SRA851254	H3K4me3_lin15B_20C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_lin15B_20C_rep2;_Caenorhabditis_elegans...	Fujifilm Wako MABI0304, #30534819|H3K4me3 lin15B 20C	Fujifilm Wako MABI0304...	H3K4me3 lin15B 20C|L1	H3K4me3 lin15B 20C	ChIP-Seq
SRX5402729	SRA851254	H3K4me3_lin15B_26C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_lin15B_26C_rep1;_Caenorhabditis_elegans...	Fujifilm Wako MABI0304, #30534819|H3K4me3 lin15B 26C	Fujifilm Wako MABI0304...	H3K4me3 lin15B 26C|L1	H3K4me3 lin15B 26C	ChIP-Seq
SRX5402730	SRA851254	H3K4me3_lin15B_26C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_lin15B_26C_rep2;_Caenorhabditis_elegans...	Fujifilm Wako MABI0304, #30534819|H3K4me3 lin15B 26C	Fujifilm Wako MABI0304...	H3K4me3 lin15B 26C|L1	H3K4me3 lin15B 26C	ChIP-Seq
SRX5402731	SRA851254	H3K4me3_lin35_20C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_lin35_20C_rep1;_Caenorhabditis_elegans;...	Fujifilm Wako MABI0304, #30534819|H3K4me3 lin35 20C	Fujifilm Wako MABI0304...	H3K4me3 lin35 20C|L1	H3K4me3 lin35 20C	ChIP-Seq
SRX5402732	SRA851254	H3K4me3_lin35_20C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_lin35_20C_rep2;_Caenorhabditis_elegans;...	Fujifilm Wako MABI0304, #30534819|H3K4me3 lin35 20C	Fujifilm Wako MABI0304...	H3K4me3 lin35 20C|L1	H3K4me3 lin35 20C	ChIP-Seq
SRX5402733	SRA851254	H3K4me3_lin35_26C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_lin35_26C_rep1;_Caenorhabditis_elegans;...	Fujifilm Wako MABI0304, #30534819|H3K4me3 lin35 26C	Fujifilm Wako MABI0304...	H3K4me3 lin35 26C|L1	H3K4me3 lin35 26C	ChIP-Seq
SRX5402734	SRA851254	H3K4me3_lin35_26C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_lin35_26C_rep2;_Caenorhabditis_elegans;...	Fujifilm Wako MABI0304, #30534819|H3K4me3 lin35 26C	Fujifilm Wako MABI0304...	H3K4me3 lin35 26C|L1	H3K4me3 lin35 26C	ChIP-Seq
SRX5402735	SRA851254	H3K4me3_lin37_20C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_lin37_20C_rep1;_Caenorhabditis_elegans;...	Fujifilm Wako MABI0304, #30534819|H3K4me3 lin37 20C	Fujifilm Wako MABI0304...	H3K4me3 lin37 20C|L1	H3K4me3 lin37 20C	ChIP-Seq
SRX5402736	SRA851254	H3K4me3_lin37_20C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_lin37_20C_rep2;_Caenorhabditis_elegans;...	Fujifilm Wako MABI0304, #30534819|H3K4me3 lin37 20C	Fujifilm Wako MABI0304...	H3K4me3 lin37 20C|L1	H3K4me3 lin37 20C	ChIP-Seq
SRX5402737	SRA851254	H3K4me3_lin37_26C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_lin37_26C_rep1;_Caenorhabditis_elegans;...	Fujifilm Wako MABI0304, #30534819|H3K4me3 lin37 26C	Fujifilm Wako MABI0304...	H3K4me3 lin37 26C|L1	H3K4me3 lin37 26C	ChIP-Seq
SRX5402738	SRA851254	H3K4me3_lin37_26C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me3_lin37_26C_rep2;_Caenorhabditis_elegans;...	Fujifilm Wako MABI0304, #30534819|H3K4me3 lin37 26C	Fujifilm Wako MABI0304...	H3K4me3 lin37 26C|L1	H3K4me3 lin37 26C	ChIP-Seq
SRX5402739	SRA851254	H3K9me2_N2_20C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me2_N2_20C_rep1;_Caenorhabditis_elegans;_Ch...	Fujifilm Wako MABI0307, #302-32369|H3K9me2 N2 20C	Fujifilm Wako MABI0307...	H3K9me2 N2 20C|L1	H3K9me2 N2 20C	ChIP-Seq
SRX5402740	SRA851254	H3K9me2_N2_20C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me2_N2_20C_rep2;_Caenorhabditis_elegans;_Ch...	Fujifilm Wako MABI0307, #302-32369|H3K9me2 N2 20C	Fujifilm Wako MABI0307...	H3K9me2 N2 20C|L1	H3K9me2 N2 20C	ChIP-Seq
SRX5402741	SRA851254	H3K9me2_N2_26C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me2_N2_26C_rep1;_Caenorhabditis_elegans;_Ch...	Fujifilm Wako MABI0307, #302-32369|H3K9me2 N2 26C	Fujifilm Wako MABI0307...	H3K9me2 N2 26C|L1	H3K9me2 N2 26C	ChIP-Seq
SRX5402742	SRA851254	H3K9me2_N2_26C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me2_N2_26C_rep2;_Caenorhabditis_elegans;_Ch...	Fujifilm Wako MABI0307, #302-32369|H3K9me2 N2 26C	Fujifilm Wako MABI0307...	H3K9me2 N2 26C|L1	H3K9me2 N2 26C	ChIP-Seq
SRX5402743	SRA851254	H3K9me2_lin15B_20C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me2_lin15B_20C_rep1;_Caenorhabditis_elegans...	Fujifilm Wako MABI0307, #302-32369|H3K9me2 lin15B 20C	Fujifilm Wako MABI0307...	H3K9me2 lin15B 20C|L1	H3K9me2 lin15B 20C	ChIP-Seq
SRX5402744	SRA851254	H3K9me2_lin15B_20C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me2_lin15B_20C_rep2;_Caenorhabditis_elegans...	Fujifilm Wako MABI0307, #302-32369|H3K9me2 lin15B 20C	Fujifilm Wako MABI0307...	H3K9me2 lin15B 20C|L1	H3K9me2 lin15B 20C	ChIP-Seq
SRX5402745	SRA851254	H3K9me2_lin15B_26C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me2_lin15B_26C_rep1;_Caenorhabditis_elegans...	Fujifilm Wako MABI0307, #302-32369|H3K9me2 lin15B 26C	Fujifilm Wako MABI0307...	H3K9me2 lin15B 26C|L1	H3K9me2 lin15B 26C	ChIP-Seq
SRX5402746	SRA851254	H3K9me2_lin15B_26C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me2_lin15B_26C_rep2;_Caenorhabditis_elegans...	Fujifilm Wako MABI0307, #302-32369|H3K9me2 lin15B 26C	Fujifilm Wako MABI0307...	H3K9me2 lin15B 26C|L1	H3K9me2 lin15B 26C	ChIP-Seq
SRX5402747	SRA851254	H3K9me2_lin35_20C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me2_lin35_20C_rep1;_Caenorhabditis_elegans;...	Fujifilm Wako MABI0307, #302-32369|H3K9me2 lin35 20C	Fujifilm Wako MABI0307...	H3K9me2 lin35 20C|L1	H3K9me2 lin35 20C	ChIP-Seq
SRX5402748	SRA851254	H3K9me2_lin35_20C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me2_lin35_20C_rep2;_Caenorhabditis_elegans;...	Fujifilm Wako MABI0307, #302-32369|H3K9me2 lin35 20C	Fujifilm Wako MABI0307...	H3K9me2 lin35 20C|L1	H3K9me2 lin35 20C	ChIP-Seq
SRX5402749	SRA851254	H3K9me2_lin35_26C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me2_lin35_26C_rep1;_Caenorhabditis_elegans;...	Fujifilm Wako MABI0307, #302-32369|H3K9me2 lin35 26C	Fujifilm Wako MABI0307...	H3K9me2 lin35 26C|L1	H3K9me2 lin35 26C	ChIP-Seq
SRX5402750	SRA851254	H3K9me2_lin35_26C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me2_lin35_26C_rep2;_Caenorhabditis_elegans;...	Fujifilm Wako MABI0307, #302-32369|H3K9me2 lin35 26C	Fujifilm Wako MABI0307...	H3K9me2 lin35 26C|L1	H3K9me2 lin35 26C	ChIP-Seq
SRX5402751	SRA851254	H3K9me2_lin37_20C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me2_lin37_20C_rep1;_Caenorhabditis_elegans;...	Fujifilm Wako MABI0307, #302-32369|H3K9me2 lin37 20C	Fujifilm Wako MABI0307...	H3K9me2 lin37 20C|L1	H3K9me2 lin37 20C	ChIP-Seq
SRX5402752	SRA851254	H3K9me2_lin37_20C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me2_lin37_20C_rep2;_Caenorhabditis_elegans;...	Fujifilm Wako MABI0307, #302-32369|H3K9me2 lin37 20C	Fujifilm Wako MABI0307...	H3K9me2 lin37 20C|L1	H3K9me2 lin37 20C	ChIP-Seq
SRX5402753	SRA851254	H3K9me2_lin37_26C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me2_lin37_26C_rep1;_Caenorhabditis_elegans;...	Fujifilm Wako MABI0307, #302-32369|H3K9me2 lin37 26C	Fujifilm Wako MABI0307...	H3K9me2 lin37 26C|L1	H3K9me2 lin37 26C	ChIP-Seq
SRX5402754	SRA851254	H3K9me2_lin37_26C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me2_lin37_26C_rep2;_Caenorhabditis_elegans;...	Fujifilm Wako MABI0307, #302-32369|H3K9me2 lin37 26C	Fujifilm Wako MABI0307...	H3K9me2 lin37 26C|L1	H3K9me2 lin37 26C	ChIP-Seq
SRX5402755	SRA851254	Input_N2_20C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	Input_N2_20C_rep1;_Caenorhabditis_elegans;_ChIP...	none|Input N2 20C	none	Input N2 20C|L1	Input N2 20C	ChIP-Seq
SRX5402756	SRA851254	Input_N2_20C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	Input_N2_20C_rep2;_Caenorhabditis_elegans;_ChIP...	none|Input N2 20C	none	Input N2 20C|L1	Input N2 20C	ChIP-Seq
SRX5402757	SRA851254	Input_N2_26C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	Input_N2_26C_rep1;_Caenorhabditis_elegans;_ChIP...	none|Input N2 26C	none	Input N2 26C|L1	Input N2 26C	ChIP-Seq
SRX5402758	SRA851254	Input_N2_26C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	Input_N2_26C_rep2;_Caenorhabditis_elegans;_ChIP...	none|Input N2 26C	none	Input N2 26C|L1	Input N2 26C	ChIP-Seq
SRX5402759	SRA851254	Input_lin15B_20C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	Input_lin15B_20C_rep1;_Caenorhabditis_elegans;_...	none|Input lin15B 20C	none	Input lin15B 20C|L1	Input lin15B 20C	ChIP-Seq
SRX5402760	SRA851254	Input_lin15B_20C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	Input_lin15B_20C_rep2;_Caenorhabditis_elegans;_...	none|Input lin15B 20C	none	Input lin15B 20C|L1	Input lin15B 20C	ChIP-Seq
SRX5402761	SRA851254	Input_lin15B_26C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	Input_lin15B_26C_rep1;_Caenorhabditis_elegans;_...	none|Input lin15B 26C	none	Input lin15B 26C|L1	Input lin15B 26C	ChIP-Seq
SRX5402762	SRA851254	Input_lin15B_26C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	Input_lin15B_26C_rep2;_Caenorhabditis_elegans;_...	none|Input lin15B 26C	none	Input lin15B 26C|L1	Input lin15B 26C	ChIP-Seq
SRX5402763	SRA851254	Input_lin15B_26C_rep3;_Caenorhabditis_elegans;_ChIP-Seq	Input_lin15B_26C_rep3;_Caenorhabditis_elegans;_...	none|Input lin15B 26C	none	Input lin15B 26C|L1	Input lin15B 26C	ChIP-Seq
SRX5402764	SRA851254	Input_lin35_20C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	Input_lin35_20C_rep1;_Caenorhabditis_elegans;_C...	none|Input lin35 20C	none	Input lin35 20C|L1	Input lin35 20C	ChIP-Seq
SRX5402765	SRA851254	Input_lin35_20C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	Input_lin35_20C_rep2;_Caenorhabditis_elegans;_C...	none|Input lin35 20C	none	Input lin35 20C|L1	Input lin35 20C	ChIP-Seq
SRX5402766	SRA851254	Input_lin35_20C_rep3;_Caenorhabditis_elegans;_ChIP-Seq	Input_lin35_20C_rep3;_Caenorhabditis_elegans;_C...	none|Input lin35 20C	none	Input lin35 20C|L1	Input lin35 20C	ChIP-Seq
SRX5402767	SRA851254	Input_lin35_26C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	Input_lin35_26C_rep1;_Caenorhabditis_elegans;_C...	none|Input lin35 26C	none	Input lin35 26C|L1	Input lin35 26C	ChIP-Seq
SRX5402768	SRA851254	Input_lin35_26C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	Input_lin35_26C_rep2;_Caenorhabditis_elegans;_C...	none|Input lin35 26C	none	Input lin35 26C|L1	Input lin35 26C	ChIP-Seq
SRX5402769	SRA851254	Input_lin37_20C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	Input_lin37_20C_rep1;_Caenorhabditis_elegans;_C...	none|Input lin37 20C	none	Input lin37 20C|L1	Input lin37 20C	ChIP-Seq
SRX5402770	SRA851254	Input_lin37_20C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	Input_lin37_20C_rep2;_Caenorhabditis_elegans;_C...	none|Input lin37 20C	none	Input lin37 20C|L1	Input lin37 20C	ChIP-Seq
SRX5402771	SRA851254	Input_lin37_20C_rep3;_Caenorhabditis_elegans;_ChIP-Seq	Input_lin37_20C_rep3;_Caenorhabditis_elegans;_C...	none|Input lin37 20C	none	Input lin37 20C|L1	Input lin37 20C	ChIP-Seq
SRX5402772	SRA851254	Input_lin37_26C_rep1;_Caenorhabditis_elegans;_ChIP-Seq	Input_lin37_26C_rep1;_Caenorhabditis_elegans;_C...	none|Input lin37 26C	none	Input lin37 26C|L1	Input lin37 26C	ChIP-Seq
SRX5402773	SRA851254	Input_lin37_26C_rep2;_Caenorhabditis_elegans;_ChIP-Seq	Input_lin37_26C_rep2;_Caenorhabditis_elegans;_C...	none|Input lin37 26C	none	Input lin37 26C|L1	Input lin37 26C	ChIP-Seq
SRX5402774	SRA851254	Input_lin37_26C_rep3;_Caenorhabditis_elegans;_ChIP-Seq	Input_lin37_26C_rep3;_Caenorhabditis_elegans;_C...	none|Input lin37 26C	none	Input lin37 26C|L1	Input lin37 26C	ChIP-Seq
SRX5545237	SRA862332	WT_DPY-27_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	WT_DPY-27_ChIP-seq;_Caenorhabditis_elegans;_ChI...	anti-DPY-27|mixed-stage embryos	anti-DPY-27	mixed-stage embryos	mixed-stage embryos	ChIP-Seq
SRX5545238	SRA862332	WT_SDC-3_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	WT_SDC-3_ChIP-seq;_Caenorhabditis_elegans;_ChIP...	anti-SDC-3|mixed-stage embryos	anti-SDC-3	mixed-stage embryos	mixed-stage embryos	ChIP-Seq
SRX5545239	SRA862332	WT_IgG_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	WT_IgG_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	IgG|mixed-stage embryos	IgG	mixed-stage embryos	mixed-stage embryos	ChIP-Seq
SRX5545240	SRA862332	8rexDeletion_DPY-27_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	8rexDeletion_DPY-27_ChIP-seq;_Caenorhabditis_el...	anti-DPY-27|mixed-stage embryos	anti-DPY-27	mixed-stage embryos	mixed-stage embryos	ChIP-Seq
SRX5545241	SRA862332	8rexDeletion_SDC-3_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	8rexDeletion_SDC-3_ChIP-seq;_Caenorhabditis_ele...	anti-SDC-3|mixed-stage embryos	anti-SDC-3	mixed-stage embryos	mixed-stage embryos	ChIP-Seq
SRX5545242	SRA862332	8rexDeletion_IgG_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	8rexDeletion_IgG_ChIP-seq;_Caenorhabditis_elega...	IgG|mixed-stage embryos	IgG	mixed-stage embryos	mixed-stage embryos	ChIP-Seq
SRX5545243	SRA862332	8rexDeletionPlusrex-32rex-8_DPY-27_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	8rexDeletionPlusrex-32rex-8_DPY-27_ChIP-seq;_Ca...	anti-DPY-27|mixed-stage embryos	anti-DPY-27	mixed-stage embryos	mixed-stage embryos	ChIP-Seq
SRX5545244	SRA862332	8rexDeletionPlusrex-32rex-8_SDC-3_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	8rexDeletionPlusrex-32rex-8_SDC-3_ChIP-seq;_Cae...	anti-SDC-3|mixed-stage embryos	anti-SDC-3	mixed-stage embryos	mixed-stage embryos	ChIP-Seq
SRX5545245	SRA862332	8rexDeletionPlusrex-32rex-8_IgG_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	8rexDeletionPlusrex-32rex-8_IgG_ChIP-seq;_Caeno...	IgG|mixed-stage embryos	IgG	mixed-stage embryos	mixed-stage embryos	ChIP-Seq
SRX5545246	SRA862332	rex-14rex-47rex-8insertion_SDC-3_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	rex-14rex-47rex-8insertion_SDC-3_ChIP-seq;_Caen...	anti-SDC-3|mixed-stage embryos	anti-SDC-3	mixed-stage embryos	mixed-stage embryos	ChIP-Seq
SRX5545247	SRA862332	rex-14rex-47rex-8insertion_IgG_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	rex-14rex-47rex-8insertion_IgG_ChIP-seq;_Caenor...	IgG|mixed-stage embryos	IgG	mixed-stage embryos	mixed-stage embryos	ChIP-Seq
SRX554715	SRA167554	ChIP_input_WT;_Caenorhabditis_elegans;_ChIP-Seq	ChIP_input_WT;_Caenorhabditis_elegans;_ChIP-Seq	NA|whole adult animals	NA	whole adult animals|young adult	whole adult animals	ChIP-Seq
SRX554716	SRA167554	PolII_8wg16_ChIP_WT;_Caenorhabditis_elegans;_ChIP-Seq	PolII_8wg16_ChIP_WT;_Caenorhabditis_elegans;_Ch...	anti-Pol II 8WG16 antibody (ab817, Abcam)|whole adult animals	anti-Pol II 8WG16 anti...	whole adult animals|young adult	whole adult animals	ChIP-Seq
SRX554717	SRA167554	PolII_S2_ChIP_WT;_Caenorhabditis_elegans;_ChIP-Seq	PolII_S2_ChIP_WT;_Caenorhabditis_elegans;_ChIP-Seq	anti-Pol II S2 antibody (ab5095, Abcam)|whole adult animals	anti-Pol II S2 antibod...	whole adult animals|young adult	whole adult animals	ChIP-Seq
SRX554718	SRA167554	PolII_S5_ChIP_WT;_Caenorhabditis_elegans;_ChIP-Seq	PolII_S5_ChIP_WT;_Caenorhabditis_elegans;_ChIP-Seq	anti-Pol II S5 antibody (ab5131, Abcam)|whole adult animals	anti-Pol II S5 antibod...	whole adult animals|young adult	whole adult animals	ChIP-Seq
SRX554719	SRA167554	ChIP_input_hrde1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP_input_hrde1;_Caenorhabditis_elegans;_ChIP-Seq	NA|whole adult animals	NA	whole adult animals|young adult	whole adult animals	ChIP-Seq
SRX554720	SRA167554	PolII_8wg16_ChIP_hrde1;_Caenorhabditis_elegans;_ChIP-Seq	PolII_8wg16_ChIP_hrde1;_Caenorhabditis_elegans;...	anti-Pol II 8WG16 antibody (ab817, Abcam)|whole adult animals	anti-Pol II 8WG16 anti...	whole adult animals|young adult	whole adult animals	ChIP-Seq
SRX554721	SRA167554	PolII_S2_ChIP_hrde1;_Caenorhabditis_elegans;_ChIP-Seq	PolII_S2_ChIP_hrde1;_Caenorhabditis_elegans;_Ch...	anti-Pol II S2 antibody (ab5095, Abcam)|whole adult animals	anti-Pol II S2 antibod...	whole adult animals|young adult	whole adult animals	ChIP-Seq
SRX554722	SRA167554	PolII_S5_ChIP_hrde1;_Caenorhabditis_elegans;_ChIP-Seq	PolII_S5_ChIP_hrde1;_Caenorhabditis_elegans;_Ch...	anti-Pol II S5 antibody (ab5131, Abcam)|whole adult animals	anti-Pol II S5 antibod...	whole adult animals|young adult	whole adult animals	ChIP-Seq
SRX554723	SRA167554	H3K9me3_ChIP_WT;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_ChIP_WT;_Caenorhabditis_elegans;_ChIP-Seq	anti-Pol II H3K9me3 antibody (ab8898, Abcam)|whole adult animals	anti-Pol II H3K9me3 an...	whole adult animals|young adult	whole adult animals	ChIP-Seq
SRX554724	SRA167554	H3K9me3_ChIP_hrde1;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_ChIP_hrde1;_Caenorhabditis_elegans;_ChI...	anti-Pol II H3K9me3 antibody (ab8898, Abcam)|whole adult animals	anti-Pol II H3K9me3 an...	whole adult animals|young adult	whole adult animals	ChIP-Seq
SRX554734	SRA167554	H3K9me3_ChIP_prg1_0414;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me3_ChIP_prg1_0414;_Caenorhabditis_elegans;...	anti-Pol II H3K9me3 antibody (ab8898, Abcam)|whole adult animals	anti-Pol II H3K9me3 an...	whole adult animals|young adult	whole adult animals	ChIP-Seq
SRX554735	SRA167554	PolII_S2_ChIP_prg1_0414;_Caenorhabditis_elegans;_ChIP-Seq	PolII_S2_ChIP_prg1_0414;_Caenorhabditis_elegans...	anti-Pol II S2 antibody (ab5095, Abcam)|whole adult animals	anti-Pol II S2 antibod...	whole adult animals|young adult	whole adult animals	ChIP-Seq
SRX560679	SRA168426	Input_1;_Caenorhabditis_elegans;_ChIP-Seq	Input_1;_Caenorhabditis_elegans;_ChIP-Seq	n/a|Whoel animal extract	n/a	HML214|Whoel animal extract|GFP	HML214	ChIP-Seq
SRX560680	SRA168426	Input_2;_Caenorhabditis_elegans;_ChIP-Seq	Input_2;_Caenorhabditis_elegans;_ChIP-Seq	n/a|Whoel animal extract	n/a	HML214|Whoel animal extract|GFP	HML214	ChIP-Seq
SRX560681	SRA168426	LIN-42GFP_1;_Caenorhabditis_elegans;_ChIP-Seq	LIN-42GFP_1;_Caenorhabditis_elegans;_ChIP-Seq	anti GFP (abcam 290)|Whoel animal extract	anti GFP (abcam 290)	HML214|Whoel animal extract|GFP	HML214	ChIP-Seq
SRX560682	SRA168426	LIN-42GFP_2;_Caenorhabditis_elegans;_ChIP-Seq	LIN-42GFP_2;_Caenorhabditis_elegans;_ChIP-Seq	anti GFP (abcam 290)|Whoel animal extract	anti GFP (abcam 290)	HML214|Whoel animal extract|GFP	HML214	ChIP-Seq
SRX560683	SRA168426	LIN-42;_Caenorhabditis_elegans;_ChIP-Seq	LIN-42;_Caenorhabditis_elegans;_ChIP-Seq	anti LIN-42(KEA/11 Rabbit 2, PrimmBiotech)|Whoel animal extract	anti LIN-42(KEA/11 Rab...	HML214|Whoel animal extract|GFP	HML214	ChIP-Seq
SRX5702588	SRA875555	transgen_expt_1_N2_earlygen;_Caenorhabditis_elegans;_ChIP-Seq	transgen_expt_1_N2_earlygen;_Caenorhabditis_ele...	mixed stage populations	mixed stage populations	N2|mixed stage populations|whole animal|mixed	N2	ChIP-Seq
SRX5702589	SRA875555	transgen_expt_1_N2_midgen;_Caenorhabditis_elegans;_ChIP-Seq	transgen_expt_1_N2_midgen;_Caenorhabditis_elega...	mixed stage populations	mixed stage populations	N2|mixed stage populations|whole animal|mixed	N2	ChIP-Seq
SRX5702590	SRA875555	transgen_expt_1_N2_lategen;_Caenorhabditis_elegans;_ChIP-Seq	transgen_expt_1_N2_lategen;_Caenorhabditis_eleg...	mixed stage populations	mixed stage populations	N2|mixed stage populations|whole animal|mixed	N2	ChIP-Seq
SRX5702591	SRA875555	transgen_expt_1_wdr-5_earlygen;_Caenorhabditis_elegans;_ChIP-Seq	transgen_expt_1_wdr-5_earlygen;_Caenorhabditis_...	mixed stage populations	mixed stage populations	wdr-5 (ok1417)|mixed stage populations|whole animal|mixed	wdr-5 (ok1417)	ChIP-Seq
SRX5702592	SRA875555	transgen_expt_1_wdr-5_midgen;_Caenorhabditis_elegans;_ChIP-Seq	transgen_expt_1_wdr-5_midgen;_Caenorhabditis_el...	mixed stage populations	mixed stage populations	wdr-5 (ok1417)|mixed stage populations|whole animal|mixed	wdr-5 (ok1417)	ChIP-Seq
SRX5702593	SRA875555	transgen_expt_1_wdr-5_lategen;_Caenorhabditis_elegans;_ChIP-Seq	transgen_expt_1_wdr-5_lategen;_Caenorhabditis_e...	mixed stage populations	mixed stage populations	wdr-5 (ok1417)|mixed stage populations|whole animal|mixed	wdr-5 (ok1417)	ChIP-Seq
SRX5702594	SRA875555	transgen_expt_1_input;_Caenorhabditis_elegans;_ChIP-Seq	transgen_expt_1_input;_Caenorhabditis_elegans;_...	mixed stage populations	mixed stage populations	mixed|mixed stage populations|whole animal|mixed	mixed	ChIP-Seq
SRX5702595	SRA875555	transgen_expt_2_N2_earlygen;_Caenorhabditis_elegans;_ChIP-Seq	transgen_expt_2_N2_earlygen;_Caenorhabditis_ele...	mixed stage populations	mixed stage populations	N2|mixed stage populations|whole animal|mixed	N2	ChIP-Seq
SRX5702596	SRA875555	transgen_expt_2_N2_midgen;_Caenorhabditis_elegans;_ChIP-Seq	transgen_expt_2_N2_midgen;_Caenorhabditis_elega...	mixed stage populations	mixed stage populations	N2|mixed stage populations|whole animal|mixed	N2	ChIP-Seq
SRX5702597	SRA875555	transgen_expt_2_jhdm-1_earlygen;_Caenorhabditis_elegans;_ChIP-Seq	transgen_expt_2_jhdm-1_earlygen;_Caenorhabditis...	mixed stage populations	mixed stage populations	jhdm-1 (ok2364)|mixed stage populations|whole animal|mixed	jhdm-1 (ok2364)	ChIP-Seq
SRX5702598	SRA875555	transgen_expt_2_jhdm-1_midgen;_Caenorhabditis_elegans;_ChIP-Seq	transgen_expt_2_jhdm-1_midgen;_Caenorhabditis_e...	mixed stage populations	mixed stage populations	jhdm-1 (ok2364)|mixed stage populations|whole animal|mixed	jhdm-1 (ok2364)	ChIP-Seq
SRX5702599	SRA875555	transgen_expt_2_input;_Caenorhabditis_elegans;_ChIP-Seq	transgen_expt_2_input;_Caenorhabditis_elegans;_...	mixed stage populations	mixed stage populations	mixed|mixed stage populations|whole animal|mixed	mixed	ChIP-Seq
SRX5709759	SRA876954	Input_4081_1;_Caenorhabditis_elegans;_ChIP-Seq	Input_4081_1;_Caenorhabditis_elegans;_ChIP-Seq	None|Whole organism	None	N2; Ispvha-6::klf-1-yfp|Whole organism|Whole body|First day of adulthood	N2; Ispvha-6::klf-1-yfp	ChIP-Seq
SRX5709760	SRA876954	Input_4081_2;_Caenorhabditis_elegans;_ChIP-Seq	Input_4081_2;_Caenorhabditis_elegans;_ChIP-Seq	None|Whole organism	None	N2; Ispvha-6::klf-1-yfp|Whole organism|Whole body|First day of adulthood	N2; Ispvha-6::klf-1-yfp	ChIP-Seq
SRX5709761	SRA876954	Input_4081_3;_Caenorhabditis_elegans;_ChIP-Seq	Input_4081_3;_Caenorhabditis_elegans;_ChIP-Seq	None|Whole organism	None	N2; Ispvha-6::klf-1-yfp|Whole organism|Whole body|First day of adulthood	N2; Ispvha-6::klf-1-yfp	ChIP-Seq
SRX5709762	SRA876954	4081_1;_Caenorhabditis_elegans;_ChIP-Seq	4081_1;_Caenorhabditis_elegans;_ChIP-Seq	GFP-TRAP (Chromotek; Cat. #gtma-20; Lot. 81025001MA)|Whole organism	GFP-TRAP (Chromotek; C...	N2; Ispvha-6::klf-1-yfp|Whole organism|Whole body|First day of adulthood	N2; Ispvha-6::klf-1-yfp	ChIP-Seq
SRX5709763	SRA876954	4081_2;_Caenorhabditis_elegans;_ChIP-Seq	4081_2;_Caenorhabditis_elegans;_ChIP-Seq	GFP-TRAP (Chromotek; Cat. #gtma-20; Lot. 81025001MA)|Whole organism	GFP-TRAP (Chromotek; C...	N2; Ispvha-6::klf-1-yfp|Whole organism|Whole body|First day of adulthood	N2; Ispvha-6::klf-1-yfp	ChIP-Seq
SRX5709764	SRA876954	4081_3;_Caenorhabditis_elegans;_ChIP-Seq	4081_3;_Caenorhabditis_elegans;_ChIP-Seq	GFP-TRAP (Chromotek; Cat. #gtma-20; Lot. 81025001MA)|Whole organism	GFP-TRAP (Chromotek; C...	N2; Ispvha-6::klf-1-yfp|Whole organism|Whole body|First day of adulthood	N2; Ispvha-6::klf-1-yfp	ChIP-Seq
SRX5709765	SRA876954	Input_4082_1;_Caenorhabditis_elegans;_ChIP-Seq	Input_4082_1;_Caenorhabditis_elegans;_ChIP-Seq	None|Whole organism	None	isp-1(qm150); ctb-1(qm189); Ispvha-6::klf-1-yfp|Whole organism|Whole body|First day of adulthood	isp-1(qm150); ctb-1(qm...	ChIP-Seq
SRX5709766	SRA876954	Input_4082_2;_Caenorhabditis_elegans;_ChIP-Seq	Input_4082_2;_Caenorhabditis_elegans;_ChIP-Seq	None|Whole organism	None	isp-1(qm150); ctb-1(qm189); Ispvha-6::klf-1-yfp|Whole organism|Whole body|First day of adulthood	isp-1(qm150); ctb-1(qm...	ChIP-Seq
SRX5709767	SRA876954	Input_4082_3;_Caenorhabditis_elegans;_ChIP-Seq	Input_4082_3;_Caenorhabditis_elegans;_ChIP-Seq	None|Whole organism	None	isp-1(qm150); ctb-1(qm189); Ispvha-6::klf-1-yfp|Whole organism|Whole body|First day of adulthood	isp-1(qm150); ctb-1(qm...	ChIP-Seq
SRX5709768	SRA876954	4082_1;_Caenorhabditis_elegans;_ChIP-Seq	4082_1;_Caenorhabditis_elegans;_ChIP-Seq	GFP-TRAP (Chromotek; Cat. #gtma-20; Lot. 81025001MA)|Whole organism	GFP-TRAP (Chromotek; C...	isp-1(qm150); ctb-1(qm189); Ispvha-6::klf-1-yfp|Whole organism|Whole body|First day of adulthood	isp-1(qm150); ctb-1(qm...	ChIP-Seq
SRX5709769	SRA876954	4082_2;_Caenorhabditis_elegans;_ChIP-Seq	4082_2;_Caenorhabditis_elegans;_ChIP-Seq	GFP-TRAP (Chromotek; Cat. #gtma-20; Lot. 81025001MA)|Whole organism	GFP-TRAP (Chromotek; C...	isp-1(qm150); ctb-1(qm189); Ispvha-6::klf-1-yfp|Whole organism|Whole body|First day of adulthood	isp-1(qm150); ctb-1(qm...	ChIP-Seq
SRX5709770	SRA876954	4082_3;_Caenorhabditis_elegans;_ChIP-Seq	4082_3;_Caenorhabditis_elegans;_ChIP-Seq	GFP-TRAP (Chromotek; Cat. #gtma-20; Lot. 81025001MA)|Whole organism	GFP-TRAP (Chromotek; C...	isp-1(qm150); ctb-1(qm189); Ispvha-6::klf-1-yfp|Whole organism|Whole body|First day of adulthood	isp-1(qm150); ctb-1(qm...	ChIP-Seq
SRX5729148	SRA811199	H3_N2_DPY-27_RNAi_emb_rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3_N2_DPY-27_RNAi_emb_rep1_ChIP-seq;_Caenorhabd...	H3|whole worms	H3	N2|whole worms|whole worms|mixed embryo	N2	ChIP-Seq
SRX5729149	SRA811199	H3_N2_DPY-27_RNAi_emb_rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3_N2_DPY-27_RNAi_emb_rep2_ChIP-seq;_Caenorhabd...	H3|whole worms	H3	N2|whole worms|whole worms|mixed embryo	N2	ChIP-Seq
SRX5729150	SRA811199	H3_N2_DPY-27_RNAi_emb_rep3_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3_N2_DPY-27_RNAi_emb_rep3_ChIP-seq;_Caenorhabd...	H3|whole worms	H3	N2|whole worms|whole worms|mixed embryo	N2	ChIP-Seq
SRX5729151	SRA811199	AKM39_input_N2_DPY-27_RNAi_emb_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	AKM39_input_N2_DPY-27_RNAi_emb_ChIP-seq;_Caenor...	INPUT|whole worms	INPUT	N2|whole worms|whole worms|mixed embryo	N2	ChIP-Seq
SRX5985664	SRA738939	IGN-H3K27ac_ChIP_rep1;_Caenorhabditis_elegans;_ChIP-Seq	IGN-H3K27ac_ChIP_rep1;_Caenorhabditis_elegans;_...	H3K27ac (39685, Active Motif)|Isolated germ nuclei from 2% formaldehyde pre-fixed VC2010 wild type young adult animals	H3K27ac (39685, Active...	VC2010|Isolated germ nuclei from 2% formaldehyde pre-fixed VC2010 wild type young adult animals|Isolated germ nuclei|young adult (YA)	VC2010	ChIP-Seq
SRX5985665	SRA738939	Input_DNA_control_for_IGN-H3K27ac_ChIP_rep1;_Caenorhabditis_elegans;_ChIP-Seq	Input_DNA_control_for_IGN-H3K27ac_ChIP_rep1;_Ca...	none - input|Isolated germ nuclei from 2% formaldehyde pre-fixed VC2010 wild type young adult animals	none - input	VC2010|Isolated germ nuclei from 2% formaldehyde pre-fixed VC2010 wild type young adult animals|Isolated germ nuclei|young adult (YA)	VC2010	ChIP-Seq
SRX5985666	SRA738939	IGN-H3K27ac_ChIP_rep2;_Caenorhabditis_elegans;_ChIP-Seq	IGN-H3K27ac_ChIP_rep2;_Caenorhabditis_elegans;_...	H3K27ac (39685, Active Motif)|Isolated germ nuclei from 2% formaldehyde pre-fixed VC2010 wild type young adult animals	H3K27ac (39685, Active...	VC2010|Isolated germ nuclei from 2% formaldehyde pre-fixed VC2010 wild type young adult animals|Isolated germ nuclei|young adult (YA)	VC2010	ChIP-Seq
SRX5985667	SRA738939	Input_DNA_control_for_IGN-H3K27ac_ChIP_rep2;_Caenorhabditis_elegans;_ChIP-Seq	Input_DNA_control_for_IGN-H3K27ac_ChIP_rep2;_Ca...	none - input|Isolated germ nuclei from 2% formaldehyde pre-fixed VC2010 wild type young adult animals	none - input	VC2010|Isolated germ nuclei from 2% formaldehyde pre-fixed VC2010 wild type young adult animals|Isolated germ nuclei|young adult (YA)	VC2010	ChIP-Seq
SRX5985668	SRA738939	SOM-H3K27ac_ChIP_rep1;_Caenorhabditis_elegans;_ChIP-Seq	SOM-H3K27ac_ChIP_rep1;_Caenorhabditis_elegans;_...	H3K27ac (39685, Active Motif)|2% formaldehyde pre-fixed glp-1(q224) young adult animals	H3K27ac (39685, Active...	JK1107|2% formaldehyde pre-fixed glp-1(q224) young adult animals|Soma|young adult (YA)	JK1107	ChIP-Seq
SRX5985669	SRA738939	Input_DNA_control_for_SOM-H3K27ac_ChIP_rep1;_Caenorhabditis_elegans;_ChIP-Seq	Input_DNA_control_for_SOM-H3K27ac_ChIP_rep1;_Ca...	none - input|2% formaldehyde pre-fixed glp-1(q224) young adult animals	none - input	JK1107|2% formaldehyde pre-fixed glp-1(q224) young adult animals|Soma|young adult (YA)	JK1107	ChIP-Seq
SRX5985670	SRA738939	SOM-H3K27ac_ChIP_rep2;_Caenorhabditis_elegans;_ChIP-Seq	SOM-H3K27ac_ChIP_rep2;_Caenorhabditis_elegans;_...	H3K27ac (39685, Active Motif)|2% formaldehyde pre-fixed glp-1(q224) young adult animals	H3K27ac (39685, Active...	JK1107|2% formaldehyde pre-fixed glp-1(q224) young adult animals|Soma|young adult (YA)	JK1107	ChIP-Seq
SRX5985671	SRA738939	Input_DNA_control_for_SOM-H3K27ac_ChIP_rep2;_Caenorhabditis_elegans;_ChIP-Seq	Input_DNA_control_for_SOM-H3K27ac_ChIP_rep2;_Ca...	none - input|2% formaldehyde pre-fixed glp-1(q224) young adult animals	none - input	JK1107|2% formaldehyde pre-fixed glp-1(q224) young adult animals|Soma|young adult (YA)	JK1107	ChIP-Seq
SRX5985672	SRA738939	IGN-H3K4me3_ChIP_rep1;_Caenorhabditis_elegans;_ChIP-Seq	IGN-H3K4me3_ChIP_rep1;_Caenorhabditis_elegans;_...	H3K4me3 (61379, Active Motif)|Isolated germ nuclei from 2% formaldehyde pre-fixed VC2010 wild type young adult animals	H3K4me3 (61379, Active...	VC2010|Isolated germ nuclei from 2% formaldehyde pre-fixed VC2010 wild type young adult animals|Isolated germ nuclei|young adult (YA)	VC2010	ChIP-Seq
SRX5985673	SRA738939	Input_DNA_control_for_IGN-H3K4me3_ChIP_rep1;_Caenorhabditis_elegans;_ChIP-Seq	Input_DNA_control_for_IGN-H3K4me3_ChIP_rep1;_Ca...	none - input|Isolated germ nuclei from 2% formaldehyde pre-fixed VC2010 wild type young adult animals	none - input	VC2010|Isolated germ nuclei from 2% formaldehyde pre-fixed VC2010 wild type young adult animals|Isolated germ nuclei|young adult (YA)	VC2010	ChIP-Seq
SRX5985674	SRA738939	IGN-H3K4me3_ChIP_rep2;_Caenorhabditis_elegans;_ChIP-Seq	IGN-H3K4me3_ChIP_rep2;_Caenorhabditis_elegans;_...	H3K4me3 (61379, Active Motif)|Isolated germ nuclei from 2% formaldehyde pre-fixed VC2010 wild type young adult animals	H3K4me3 (61379, Active...	VC2010|Isolated germ nuclei from 2% formaldehyde pre-fixed VC2010 wild type young adult animals|Isolated germ nuclei|young adult (YA)	VC2010	ChIP-Seq
SRX5985675	SRA738939	Input_DNA_control_for_IGN-H3K4me3_ChIP_rep2;_Caenorhabditis_elegans;_ChIP-Seq	Input_DNA_control_for_IGN-H3K4me3_ChIP_rep2;_Ca...	none - input|Isolated germ nuclei from 2% formaldehyde pre-fixed VC2010 wild type young adult animals	none - input	VC2010|Isolated germ nuclei from 2% formaldehyde pre-fixed VC2010 wild type young adult animals|Isolated germ nuclei|young adult (YA)	VC2010	ChIP-Seq
SRX5985676	SRA738939	SOM-H3K4me3_ChIP_rep1;_Caenorhabditis_elegans;_ChIP-Seq	SOM-H3K4me3_ChIP_rep1;_Caenorhabditis_elegans;_...	H3K4me3 (61379, Active Motif)|2% formaldehyde pre-fixed glp-1(q224) young adult animals	H3K4me3 (61379, Active...	JK1107|2% formaldehyde pre-fixed glp-1(q224) young adult animals|Soma|young adult (YA)	JK1107	ChIP-Seq
SRX5985677	SRA738939	Input_DNA_control_for_SOM-H3K4me3_ChIP_rep1;_Caenorhabditis_elegans;_ChIP-Seq	Input_DNA_control_for_SOM-H3K4me3_ChIP_rep1;_Ca...	none - input|2% formaldehyde pre-fixed glp-1(q224) young adult animals	none - input	JK1107|2% formaldehyde pre-fixed glp-1(q224) young adult animals|Soma|young adult (YA)	JK1107	ChIP-Seq
SRX5985678	SRA738939	SOM-H3K4me3_ChIP_rep2;_Caenorhabditis_elegans;_ChIP-Seq	SOM-H3K4me3_ChIP_rep2;_Caenorhabditis_elegans;_...	H3K4me3 (61379, Active Motif)|2% formaldehyde pre-fixed glp-1(q224) young adult animals	H3K4me3 (61379, Active...	JK1107|2% formaldehyde pre-fixed glp-1(q224) young adult animals|Soma|young adult (YA)	JK1107	ChIP-Seq
SRX5985679	SRA738939	Input_DNA_control_for_SOM-H3K4me3_ChIP_rep2;_Caenorhabditis_elegans;_ChIP-Seq	Input_DNA_control_for_SOM-H3K4me3_ChIP_rep2;_Ca...	none - input|2% formaldehyde pre-fixed glp-1(q224) young adult animals	none - input	JK1107|2% formaldehyde pre-fixed glp-1(q224) young adult animals|Soma|young adult (YA)	JK1107	ChIP-Seq
SRX657408	SRA176057	ECMB09_a8_N2-embryo_IgG-IP;_Caenorhabditis_elegans;_ChIP-Seq	ECMB09_a8_N2-embryo_IgG-IP;_Caenorhabditis_eleg...	mixed stage embryos	mixed stage embryos	N2|mixed stage embryos|embryo	N2	ChIP-Seq
SRX657409	SRA176057	ECMB09_w4_N2-embryo_SDC3-IP;_Caenorhabditis_elegans;_ChIP-Seq	ECMB09_w4_N2-embryo_SDC3-IP;_Caenorhabditis_ele...	anti-SDC-3|mixed stage embryos	anti-SDC-3	N2|mixed stage embryos|embryo	N2	ChIP-Seq
SRX657410	SRA176057	ECBM13_a6_sdc-2-y93-RNAi-embryo_IgG-IP;_Caenorhabditis_elegans;_ChIP-Seq	ECBM13_a6_sdc-2-y93-RNAi-embryo_IgG-IP;_Caenorh...	mixed stage embryos	mixed stage embryos	sdc-2(y93) with RNAi against sdc-2|mixed stage embryos|embryo	sdc-2(y93) with RNAi a...	ChIP-Seq
SRX657411	SRA176057	ECBM13_a9_sdc-2-y93-RNAi-embryo_SDC3-IP;_Caenorhabditis_elegans;_ChIP-Seq	ECBM13_a9_sdc-2-y93-RNAi-embryo_SDC3-IP;_Caenor...	anti-SDC-3|mixed stage embryos	anti-SDC-3	sdc-2(y93) with RNAi against sdc-2|mixed stage embryos|embryo	sdc-2(y93) with RNAi a...	ChIP-Seq
SRX6619530	SRA929187	tm0235-a2-H3K9me3_ChIP	tm0235-a2-H3K9me3_ChIP	NoAb	ND	baz2(tm0235)|The whole worm	baz2(tm0235)	ChIP-Seq
SRX6619531	SRA929187	tm0235-a2-H3K9me3_Input	tm0235-a2-H3K9me3_Input	NoAb	ND	baz2(tm0235)|The whole worm	baz2(tm0235)	ChIP-Seq
SRX6619532	SRA929187	tm0235-a7-H3K9me1_ChIP	tm0235-a7-H3K9me1_ChIP	NoAb	ND	baz2(tm0235)|The whole worm	baz2(tm0235)	ChIP-Seq
SRX6619533	SRA929187	tm0235-a7-H3K9me1_Input	tm0235-a7-H3K9me1_Input	NoAb	ND	baz2(tm0235)|The whole worm	baz2(tm0235)	ChIP-Seq
SRX6619534	SRA929187	tm0235-a7-H3K9me2_ChIP	tm0235-a7-H3K9me2_ChIP	NoAb	ND	baz2(tm0235)|The whole worm	baz2(tm0235)	ChIP-Seq
SRX6619535	SRA929187	tm0235-a7-H3K9me2_Input	tm0235-a7-H3K9me2_Input	NoAb	ND	baz2(tm0235)|The whole worm	baz2(tm0235)	ChIP-Seq
SRX6619536	SRA929187	tm0235-a7-H3K9me3_ChIP	tm0235-a7-H3K9me3_ChIP	NoAb	ND	baz2(tm0235)|The whole worm	baz2(tm0235)	ChIP-Seq
SRX6619537	SRA929187	tm0235-a7-H3K9me3_Input	tm0235-a7-H3K9me3_Input	NoAb	ND	baz2(tm0235)|The whole worm	baz2(tm0235)	ChIP-Seq
SRX6619538	SRA929187	VC2683-a2-H3K9me1_ChIP	VC2683-a2-H3K9me1_ChIP	NoAb	ND	set6(ok2195)|The whole worm	set6(ok2195)	ChIP-Seq
SRX6619539	SRA929187	VC2683-a2-H3K9me1_Input	VC2683-a2-H3K9me1_Input	NoAb	ND	set6(ok2195)|The whole worm	set6(ok2195)	ChIP-Seq
SRX6619540	SRA929187	VC2683-a2-H3K9me3-replicate_ChIP	VC2683-a2-H3K9me3-replicate_ChIP	NoAb	ND	set6(ok2195)|The whole worm	set6(ok2195)	ChIP-Seq
SRX6619541	SRA929187	VC2683-a2-H3K9me3-replicate_Input	VC2683-a2-H3K9me3-replicate_Input	NoAb	ND	set6(ok2195)|The whole worm	set6(ok2195)	ChIP-Seq
SRX6619542	SRA929187	N2-a7-H3K9me3-replicate_ChIP	N2-a7-H3K9me3-replicate_ChIP	NoAb	ND	Bristol N2|The whole worm	Bristol N2	ChIP-Seq
SRX6619543	SRA929187	N2-a7-H3K9me3-replicate_Input	N2-a7-H3K9me3-replicate_Input	NoAb	ND	Bristol N2|The whole worm	Bristol N2	ChIP-Seq
SRX6619544	SRA929187	tm0235-a2-H3K9me3-replicate_ChIP	tm0235-a2-H3K9me3-replicate_ChIP	NoAb	ND	baz2(tm0235)|The whole worm	baz2(tm0235)	ChIP-Seq
SRX6619545	SRA929187	tm0235-a2-H3K9me3-replicate_Input	tm0235-a2-H3K9me3-replicate_Input	NoAb	ND	baz2(tm0235)|The whole worm	baz2(tm0235)	ChIP-Seq
SRX6619546	SRA929187	vctm-a7-H3K9me1_ChIP	vctm-a7-H3K9me1_ChIP	NoAb	ND	baz2(tm0235)set6(ok2195)|The whole worm	baz2(tm0235)set6(ok2195)	ChIP-Seq
SRX6619547	SRA929187	vctm-a7-H3K9me1_Input	vctm-a7-H3K9me1_Input	NoAb	ND	baz2(tm0235)set6(ok2195)|The whole worm	baz2(tm0235)set6(ok2195)	ChIP-Seq
SRX6619548	SRA929187	vctm-a2-H3K9me3_ChIP	vctm-a2-H3K9me3_ChIP	NoAb	ND	baz2(tm0235)set6(ok2195)|The whole worm	baz2(tm0235)set6(ok2195)	ChIP-Seq
SRX6619549	SRA929187	vctm-a2-H3K9me3_Input	vctm-a2-H3K9me3_Input	NoAb	ND	baz2(tm0235)set6(ok2195)|The whole worm	baz2(tm0235)set6(ok2195)	ChIP-Seq
SRX6619550	SRA929187	vctm-a2-H3K9me2_ChIP	vctm-a2-H3K9me2_ChIP	NoAb	ND	baz2(tm0235)set6(ok2195)|The whole worm	baz2(tm0235)set6(ok2195)	ChIP-Seq
SRX6619551	SRA929187	vctm-a2-H3K9me2_Input	vctm-a2-H3K9me2_Input	NoAb	ND	baz2(tm0235)set6(ok2195)|The whole worm	baz2(tm0235)set6(ok2195)	ChIP-Seq
SRX6619552	SRA929187	vctm-a2-H3K9me1_ChIP	vctm-a2-H3K9me1_ChIP	NoAb	ND	baz2(tm0235)set6(ok2195)|The whole worm	baz2(tm0235)set6(ok2195)	ChIP-Seq
SRX6619553	SRA929187	vctm-a2-H3K9me1_Input	vctm-a2-H3K9me1_Input	NoAb	ND	baz2(tm0235)set6(ok2195)|The whole worm	baz2(tm0235)set6(ok2195)	ChIP-Seq
SRX6619554	SRA929187	VC2683-a7-H3K9me3-replicate_ChIP	VC2683-a7-H3K9me3-replicate_ChIP	NoAb	ND	set6(ok2195)|The whole worm	set6(ok2195)	ChIP-Seq
SRX6619555	SRA929187	VC2683-a7-H3K9me2_Input	VC2683-a7-H3K9me2_Input	NoAb	ND	set6(ok2195)|The whole worm	set6(ok2195)	ChIP-Seq
SRX6619556	SRA929187	vctm-a7-H3K9me2_ChIP	vctm-a7-H3K9me2_ChIP	NoAb	ND	baz2(tm0235)set6(ok2195)|The whole worm	baz2(tm0235)set6(ok2195)	ChIP-Seq
SRX6619557	SRA929187	vctm-a7-H3K9me2_Input	vctm-a7-H3K9me2_Input	NoAb	ND	baz2(tm0235)set6(ok2195)|The whole worm	baz2(tm0235)set6(ok2195)	ChIP-Seq
SRX6619558	SRA929187	vctm-a2-H3K9me3-replicate_ChIP	vctm-a2-H3K9me3-replicate_ChIP	NoAb	ND	baz2(tm0235)set6(ok2195)|The whole worm	baz2(tm0235)set6(ok2195)	ChIP-Seq
SRX6619559	SRA929187	tm0235-a7-H3K9me3-replicate_ChIP	tm0235-a7-H3K9me3-replicate_ChIP	NoAb	ND	baz2(tm0235)|The whole worm	baz2(tm0235)	ChIP-Seq
SRX6619560	SRA929187	tm0235-a7-H3K9me3-replicate_Input	tm0235-a7-H3K9me3-replicate_Input	NoAb	ND	baz2(tm0235)|The whole worm	baz2(tm0235)	ChIP-Seq
SRX6619561	SRA929187	VC2683-a7-H3K9me2_ChIP	VC2683-a7-H3K9me2_ChIP	NoAb	ND	set6(ok2195)|The whole worm	set6(ok2195)	ChIP-Seq
SRX6619562	SRA929187	tm0235-a2-H3K9me2_Input	tm0235-a2-H3K9me2_Input	NoAb	ND	baz2(tm0235)|The whole worm	baz2(tm0235)	ChIP-Seq
SRX6619563	SRA929187	tm0235-a2-H3K9me2_ChIP	tm0235-a2-H3K9me2_ChIP	NoAb	ND	baz2(tm0235)|The whole worm	baz2(tm0235)	ChIP-Seq
SRX6619564	SRA929187	VC2683-a7-H3K9me1_Input	VC2683-a7-H3K9me1_Input	NoAb	ND	set6(ok2195)|The whole worm	set6(ok2195)	ChIP-Seq
SRX6619565	SRA929187	VC2683-a7-H3K9me1_ChIP	VC2683-a7-H3K9me1_ChIP	NoAb	ND	set6(ok2195)|The whole worm	set6(ok2195)	ChIP-Seq
SRX6619566	SRA929187	VC2683-a2-H3K9me3_Input	VC2683-a2-H3K9me3_Input	NoAb	ND	set6(ok2195)|The whole worm	set6(ok2195)	ChIP-Seq
SRX6619567	SRA929187	VC2683-a2-H3K9me3_ChIP	VC2683-a2-H3K9me3_ChIP	NoAb	ND	set6(ok2195)|The whole worm	set6(ok2195)	ChIP-Seq
SRX6619568	SRA929187	VC2683-a2-H3K9me2_Input	VC2683-a2-H3K9me2_Input	NoAb	ND	set6(ok2195)|The whole worm	set6(ok2195)	ChIP-Seq
SRX6619569	SRA929187	VC2683-a2-H3K9me2_ChIP	VC2683-a2-H3K9me2_ChIP	NoAb	ND	set6(ok2195)|The whole worm	set6(ok2195)	ChIP-Seq
SRX6619570	SRA929187	N2-a7-H3K9me2_Input	N2-a7-H3K9me2_Input	NoAb	ND	Bristol N2|The whole worm	Bristol N2	ChIP-Seq
SRX6619571	SRA929187	N2-a7-H3K9me2_ChIP	N2-a7-H3K9me2_ChIP	NoAb	ND	Bristol N2|The whole worm	Bristol N2	ChIP-Seq
SRX6619572	SRA929187	N2-a7-H3K9me3_Input	N2-a7-H3K9me3_Input	NoAb	ND	Bristol N2|The whole worm	Bristol N2	ChIP-Seq
SRX6619573	SRA929187	N2-a7-H3K9me3_ChIP	N2-a7-H3K9me3_ChIP	NoAb	ND	Bristol N2|The whole worm	Bristol N2	ChIP-Seq
SRX6619574	SRA929187	SET6_Input	SET6_Input	NoAb	ND	Bristol N2|The whole worm	Bristol N2	ChIP-Seq
SRX6619575	SRA929187	SET6_ChIP	SET6_ChIP	NoAb	ND	Bristol N2|The whole worm	Bristol N2	ChIP-Seq
SRX6619576	SRA929187	tm0235-a2-H3K9me1_Input	tm0235-a2-H3K9me1_Input	NoAb	ND	baz2(tm0235)|The whole worm	baz2(tm0235)	ChIP-Seq
SRX6619577	SRA929187	tm0235-a2-H3K9me1_ChIP	tm0235-a2-H3K9me1_ChIP	NoAb	ND	baz2(tm0235)|The whole worm	baz2(tm0235)	ChIP-Seq
SRX6619582	SRA929187	vctm-a7-H3K9me3_Input	vctm-a7-H3K9me3_Input	NoAb	ND	baz2(tm0235)set6(ok2195)|The whole worm	baz2(tm0235)set6(ok2195)	ChIP-Seq
SRX6619583	SRA929187	VC2683-a7-H3K9me3_Input	VC2683-a7-H3K9me3_Input	NoAb	ND	set6(ok2195)|The whole worm	set6(ok2195)	ChIP-Seq
SRX6619586	SRA929187	VC2683-a7-H3K9me3_ChIP	VC2683-a7-H3K9me3_ChIP	NoAb	ND	set6(ok2195)|The whole worm	set6(ok2195)	ChIP-Seq
SRX6619587	SRA929187	N2-a2-H3K9me3-replicate_Input	N2-a2-H3K9me3-replicate_Input	NoAb	ND	Bristol N2|The whole worm	Bristol N2	ChIP-Seq
SRX6619588	SRA929187	N2-a2-H3K9me3-replicate_ChIP	N2-a2-H3K9me3-replicate_ChIP	NoAb	ND	Bristol N2|The whole worm	Bristol N2	ChIP-Seq
SRX6619589	SRA929187	vctm-a7-H3K9me3-replicate_Input	vctm-a7-H3K9me3-replicate_Input	NoAb	ND	baz2(tm0235)set6(ok2195)|The whole worm	baz2(tm0235)set6(ok2195)	ChIP-Seq
SRX6619590	SRA929187	vctm-a7-H3K9me3-replicate_ChIP	vctm-a7-H3K9me3-replicate_ChIP	NoAb	ND	baz2(tm0235)set6(ok2195)|The whole worm	baz2(tm0235)set6(ok2195)	ChIP-Seq
SRX6619591	SRA929187	vctm-a2-H3K9me3-replicate_Input	vctm-a2-H3K9me3-replicate_Input	NoAb	ND	baz2(tm0235)set6(ok2195)|The whole worm	baz2(tm0235)set6(ok2195)	ChIP-Seq
SRX6619592	SRA929187	N2-a2-H3K9me2_ChIP	N2-a2-H3K9me2_ChIP	NoAb	ND	Bristol N2|The whole worm	Bristol N2	ChIP-Seq
SRX6619593	SRA929187	BAZ_ChIP	BAZ_ChIP	NoAb	ND	Bristol N2|The whole worm	Bristol N2	ChIP-Seq
SRX6619594	SRA929187	BAZ_Input	BAZ_Input	NoAb	ND	Bristol N2|The whole worm	Bristol N2	ChIP-Seq
SRX6619595	SRA929187	N2-a2-H3K9me1_Input	N2-a2-H3K9me1_Input	NoAb	ND	Bristol N2|The whole worm	Bristol N2	ChIP-Seq
SRX6619596	SRA929187	N2-a2-H3K9me1_ChIP	N2-a2-H3K9me1_ChIP	NoAb	ND	Bristol N2|The whole worm	Bristol N2	ChIP-Seq
SRX6619597	SRA929187	N2-a2-H3K9me2_Input	N2-a2-H3K9me2_Input	NoAb	ND	Bristol N2|The whole worm	Bristol N2	ChIP-Seq
SRX6619598	SRA929187	N2-a2-H3K9me3_Input	N2-a2-H3K9me3_Input	NoAb	ND	Bristol N2|The whole worm	Bristol N2	ChIP-Seq
SRX6619599	SRA929187	N2-a2-H3K9me3_ChIP	N2-a2-H3K9me3_ChIP	NoAb	ND	Bristol N2|The whole worm	Bristol N2	ChIP-Seq
SRX6619600	SRA929187	N2-a7-H3K9me1_Input	N2-a7-H3K9me1_Input	NoAb	ND	Bristol N2|The whole worm	Bristol N2	ChIP-Seq
SRX6619601	SRA929187	N2-a7-H3K9me1_ChIP	N2-a7-H3K9me1_ChIP	NoAb	ND	Bristol N2|The whole worm	Bristol N2	ChIP-Seq
SRX6619602	SRA929187	VC2683-a7-H3K9me3-replicate_Input	VC2683-a7-H3K9me3-replicate_Input	NoAb	ND	set6(ok2195)|The whole worm	set6(ok2195)	ChIP-Seq
SRX6619603	SRA929187	vctm-a7-H3K9me3_ChIP	vctm-a7-H3K9me3_ChIP	NoAb	ND	baz2(tm0235)set6(ok2195)|The whole worm	baz2(tm0235)set6(ok2195)	ChIP-Seq
SRX6720161	SRA941306	daf-2_POLII_ChIP-SEQ_IP_smk-1_RNAi	daf-2_POLII_ChIP-SEQ_IP_smk-1_RNAi	NoAb	ND	CB1370_4|whole animal	CB1370_4	ChIP-Seq
SRX6720163	SRA941306	daf-2;_DAF-16::GFP_ChIP-SEQ_IP_control_RNAi	daf-2;_DAF-16::GFP_ChIP-SEQ_IP_control_RNAi	NoAb	ND	GR1895_2|whole animal	GR1895_2	ChIP-Seq
SRX6720165	SRA941306	daf-2;_DAF-16::GFP_ChIP-SEQ_IP_smk-1_RNAi	daf-2;_DAF-16::GFP_ChIP-SEQ_IP_smk-1_RNAi	NoAb	ND	GR1895_4|whole animal	GR1895_4	ChIP-Seq
SRX6720167	SRA941306	daf-2;_SMK-1::GFP_ChIP-SEQ_IP	daf-2;_SMK-1::GFP_ChIP-SEQ_IP	NoAb	ND	RIE384_2|whole animal	RIE384_2	ChIP-Seq
SRX6720169	SRA941306	daf-2;_SPT-5::GFP_ChIP-SEQ_IP_smk-1_RNAi	daf-2;_SPT-5::GFP_ChIP-SEQ_IP_smk-1_RNAi	NoAb	ND	RIE500_4|whole animal	RIE500_4	ChIP-Seq
SRX6720171	SRA941306	daf-2;_SPT-5::GFP_POLII_total_ChIP-SEQ_IP_control_RNAi	daf-2;_SPT-5::GFP_POLII_total_ChIP-SEQ_IP_contr...	NoAb	ND	RIE500_6|whole animal	RIE500_6	ChIP-Seq
SRX6720173	SRA941306	daf-2_POLII_Ser5P_ChIP-SEQ_IP_smk-1_RNAi	daf-2_POLII_Ser5P_ChIP-SEQ_IP_smk-1_RNAi	NoAb	ND	CB1370_8|whole animal	CB1370_8	ChIP-Seq
SRX6720175	SRA941306	daf-2;_SPT-5::GFP_ChIP-SEQ_IP_control_RNAi	daf-2;_SPT-5::GFP_ChIP-SEQ_IP_control_RNAi	NoAb	ND	RIE500_2|whole animal	RIE500_2	ChIP-Seq
SRX6720177	SRA941306	daf-2;_SPT-5::GFP_POLII_total_ChIP-SEQ_IP_smk-1_RNAi	daf-2;_SPT-5::GFP_POLII_total_ChIP-SEQ_IP_smk-1...	NoAb	ND	RIE500_8|whole animal	RIE500_8	ChIP-Seq
SRX6720188	SRA941306	daf-2_POLII_Ser5P_ChIP-SEQ_IP_control_RNAi	daf-2_POLII_Ser5P_ChIP-SEQ_IP_control_RNAi	NoAb	ND	CB1370_6|whole animal	CB1370_6	ChIP-Seq
SRX6720190	SRA941306	daf-2_POLII_ChIP-SEQ_IP_control_RNAi	daf-2_POLII_ChIP-SEQ_IP_control_RNAi	NoAb	ND	CB1370_2|whole animal	CB1370_2	ChIP-Seq
SRX707297	SRA185362	tdp1_CHIP-1;_Caenorhabditis_elegans;_ChIP-Seq	tdp1_CHIP-1;_Caenorhabditis_elegans;_ChIP-Seq	CHIP from whole worm extract	CHIP from whole worm e...	tdp-1(ok803)|CHIP from whole worm extract|young adult	tdp-1(ok803)	ChIP-Seq
SRX707298	SRA185362	tdp1_CHIP-2;_Caenorhabditis_elegans;_ChIP-Seq	tdp1_CHIP-2;_Caenorhabditis_elegans;_ChIP-Seq	CHIP from whole worm extract	CHIP from whole worm e...	tdp-1(ok803)|CHIP from whole worm extract|young adult	tdp-1(ok803)	ChIP-Seq
SRX707299	SRA185362	tdp1_CHIP-RNAseControl;_Caenorhabditis_elegans;_ChIP-Seq	tdp1_CHIP-RNAseControl;_Caenorhabditis_elegans;...	CHIP from whole worm extract	CHIP from whole worm e...	tdp-1(ok803)|CHIP from whole worm extract|young adult	tdp-1(ok803)	ChIP-Seq
SRX7175088	SRA997994	Lonp1_IP;_Caenorhabditis_elegans;_ChIP-Seq	Lonp1_IP;_Caenorhabditis_elegans;_ChIP-Seq	Monoclonal ANTI-FLAG M2 antibody (Sigma, F1804)|whole worm	Monoclonal ANTI-FLAG M...	whole worm|L4 stage hermaphrodite worms	whole worm	ChIP-Seq
SRX7175089	SRA997994	Lonp1_IgG;_Caenorhabditis_elegans;_ChIP-Seq	Lonp1_IgG;_Caenorhabditis_elegans;_ChIP-Seq	Mouse mAb IgG1 Isotype Control (Cell Signaling Technology, G3A1)|whole worm	Mouse mAb IgG1 Isotype...	whole worm|L4 stage hermaphrodite worms	whole worm	ChIP-Seq
SRX7202519	SRA1001286	H3K27ac_early;_Caenorhabditis_elegans;_ChIP-Seq	H3K27ac_early;_Caenorhabditis_elegans;_ChIP-Seq	H3K27ac (Abcam: ab4729)|Embryonic cells	H3K27ac (Abcam: ab4729)	CG21 egl-30(tg26) I; him-5(e1490) V|Embryonic cells	CG21 egl-30(tg26) I; h...	ChIP-Seq
SRX7202520	SRA1001286	H3K27ac_gastrula;_Caenorhabditis_elegans;_ChIP-Seq	H3K27ac_gastrula;_Caenorhabditis_elegans;_ChIP-Seq	H3K27ac (Abcam: ab4729)|Embryonic cells	H3K27ac (Abcam: ab4729)	CG21 egl-30(tg26) I; him-5(e1490) V|Embryonic cells	CG21 egl-30(tg26) I; h...	ChIP-Seq
SRX7202522	SRA1001286	H3K27ac_late;_Caenorhabditis_elegans;_ChIP-Seq	H3K27ac_late;_Caenorhabditis_elegans;_ChIP-Seq	H3K27ac (Abcam: ab4729)|Embryonic cells	H3K27ac (Abcam: ab4729)	CG21 egl-30(tg26) I; him-5(e1490) V|Embryonic cells	CG21 egl-30(tg26) I; h...	ChIP-Seq
SRX7202523	SRA1001286	H3K4me2_early;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me2_early;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me2 (Abcam: ab7766)|Embryonic cells	H3K4me2 (Abcam: ab7766)	CG21 egl-30(tg26) I; him-5(e1490) V|Embryonic cells	CG21 egl-30(tg26) I; h...	ChIP-Seq
SRX7202524	SRA1001286	H3K4me2_gastrula;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me2_gastrula;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me2 (Abcam: ab7766)|Embryonic cells	H3K4me2 (Abcam: ab7766)	CG21 egl-30(tg26) I; him-5(e1490) V|Embryonic cells	CG21 egl-30(tg26) I; h...	ChIP-Seq
SRX7202525	SRA1001286	H3K4me2_late;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me2_late;_Caenorhabditis_elegans;_ChIP-Seq	H3K4me2 (Abcam: ab7766)|Embryonic cells	H3K4me2 (Abcam: ab7766)	CG21 egl-30(tg26) I; him-5(e1490) V|Embryonic cells	CG21 egl-30(tg26) I; h...	ChIP-Seq
SRX7217778	SRA1003130	HDA-1_input_(L4440)_rep1;_Caenorhabditis_elegans;_ChIP-Seq	HDA-1_input_(L4440)_rep1;_Caenorhabditis_elegan...	none|the whole organism	none	hda-1p::hda-1::gfp; glp-4(bn2)|the whole organism|Day1 of adulthood	hda-1p::hda-1::gfp; gl...	ChIP-Seq
SRX7217779	SRA1003130	HDA-1_input_(L4440)_rep2;_Caenorhabditis_elegans;_ChIP-Seq	HDA-1_input_(L4440)_rep2;_Caenorhabditis_elegan...	none|the whole organism	none	hda-1p::hda-1::gfp; glp-4(bn2)|the whole organism|Day1 of adulthood	hda-1p::hda-1::gfp; gl...	ChIP-Seq
SRX7217780	SRA1003130	HDA-1_input__(L4440+atp-2)_rep1;_Caenorhabditis_elegans;_ChIP-Seq	HDA-1_input__(L4440+atp-2)_rep1;_Caenorhabditis...	none|the whole organism	none	hda-1p::hda-1::gfp; glp-4(bn2)|the whole organism|Day1 of adulthood	hda-1p::hda-1::gfp; gl...	ChIP-Seq
SRX7217781	SRA1003130	HDA-1_input__(L4440+atp-2)_rep2;_Caenorhabditis_elegans;_ChIP-Seq	HDA-1_input__(L4440+atp-2)_rep2;_Caenorhabditis...	none|the whole organism	none	hda-1p::hda-1::gfp; glp-4(bn2)|the whole organism|Day1 of adulthood	hda-1p::hda-1::gfp; gl...	ChIP-Seq
SRX7217782	SRA1003130	HDA-1_ChIP_(L4440)_rep1;_Caenorhabditis_elegans;_ChIP-Seq	HDA-1_ChIP_(L4440)_rep1;_Caenorhabditis_elegans...	GFP agarose (ChromoTek, gta-20)|the whole organism	GFP agarose (ChromoTek...	hda-1p::hda-1::gfp; glp-4(bn2)|the whole organism|Day1 of adulthood	hda-1p::hda-1::gfp; gl...	ChIP-Seq
SRX7217783	SRA1003130	HDA-1_ChIP_(L4440)_rep2;_Caenorhabditis_elegans;_ChIP-Seq	HDA-1_ChIP_(L4440)_rep2;_Caenorhabditis_elegans...	GFP agarose (ChromoTek, gta-20)|the whole organism	GFP agarose (ChromoTek...	hda-1p::hda-1::gfp; glp-4(bn2)|the whole organism|Day1 of adulthood	hda-1p::hda-1::gfp; gl...	ChIP-Seq
SRX7217784	SRA1003130	HDA-1_CHIP_(L4440+atp-2)_rep1;_Caenorhabditis_elegans;_ChIP-Seq	HDA-1_CHIP_(L4440+atp-2)_rep1;_Caenorhabditis_e...	GFP agarose (ChromoTek, gta-20)|the whole organism	GFP agarose (ChromoTek...	hda-1p::hda-1::gfp; glp-4(bn2)|the whole organism|Day1 of adulthood	hda-1p::hda-1::gfp; gl...	ChIP-Seq
SRX7217785	SRA1003130	HDA-1_CHIP_(L4440+atp-2)_rep2;_Caenorhabditis_elegans;_ChIP-Seq	HDA-1_CHIP_(L4440+atp-2)_rep2;_Caenorhabditis_e...	GFP agarose (ChromoTek, gta-20)|the whole organism	GFP agarose (ChromoTek...	hda-1p::hda-1::gfp; glp-4(bn2)|the whole organism|Day1 of adulthood	hda-1p::hda-1::gfp; gl...	ChIP-Seq
SRX7217786	SRA1003130	DVE-1_input_(L4440)_rep1;_Caenorhabditis_elegans;_ChIP-Seq	DVE-1_input_(L4440)_rep1;_Caenorhabditis_elegan...	none|the whole organism	none	dve-1p::dve-1::gfp; glp-4(bn2)|the whole organism|Day1 of adulthood	dve-1p::dve-1::gfp; gl...	ChIP-Seq
SRX7217787	SRA1003130	DVE-1_input_(L4440)_rep2;_Caenorhabditis_elegans;_ChIP-Seq	DVE-1_input_(L4440)_rep2;_Caenorhabditis_elegan...	none|the whole organism	none	dve-1p::dve-1::gfp; glp-4(bn2)|the whole organism|Day1 of adulthood	dve-1p::dve-1::gfp; gl...	ChIP-Seq
SRX7217788	SRA1003130	DVE-1_input__(L4440+atp-2)_rep1;_Caenorhabditis_elegans;_ChIP-Seq	DVE-1_input__(L4440+atp-2)_rep1;_Caenorhabditis...	none|the whole organism	none	dve-1p::dve-1::gfp; glp-4(bn2)|the whole organism|Day1 of adulthood	dve-1p::dve-1::gfp; gl...	ChIP-Seq
SRX7217789	SRA1003130	DVE-1_input__(L4440+atp-2)_rep2;_Caenorhabditis_elegans;_ChIP-Seq	DVE-1_input__(L4440+atp-2)_rep2;_Caenorhabditis...	none|the whole organism	none	dve-1p::dve-1::gfp; glp-4(bn2)|the whole organism|Day1 of adulthood	dve-1p::dve-1::gfp; gl...	ChIP-Seq
SRX7217790	SRA1003130	DVE-1_ChIP_(L4440)_rep1;_Caenorhabditis_elegans;_ChIP-Seq	DVE-1_ChIP_(L4440)_rep1;_Caenorhabditis_elegans...	GFP agarose (ChromoTek, gta-20)|the whole organism	GFP agarose (ChromoTek...	dve-1p::dve-1::gfp; glp-4(bn2)|the whole organism|Day1 of adulthood	dve-1p::dve-1::gfp; gl...	ChIP-Seq
SRX7217791	SRA1003130	DVE-1_ChIP_(L4440)_rep2;_Caenorhabditis_elegans;_ChIP-Seq	DVE-1_ChIP_(L4440)_rep2;_Caenorhabditis_elegans...	GFP agarose (ChromoTek, gta-20)|the whole organism	GFP agarose (ChromoTek...	dve-1p::dve-1::gfp; glp-4(bn2)|the whole organism|Day1 of adulthood	dve-1p::dve-1::gfp; gl...	ChIP-Seq
SRX7217792	SRA1003130	DVE-1_CHIP_(L4440+atp-2)_rep1;_Caenorhabditis_elegans;_ChIP-Seq	DVE-1_CHIP_(L4440+atp-2)_rep1;_Caenorhabditis_e...	GFP agarose (ChromoTek, gta-20)|the whole organism	GFP agarose (ChromoTek...	dve-1p::dve-1::gfp; glp-4(bn2)|the whole organism|Day1 of adulthood	dve-1p::dve-1::gfp; gl...	ChIP-Seq
SRX7217793	SRA1003130	DVE-1_CHIP_(L4440+atp-2)_rep2;_Caenorhabditis_elegans;_ChIP-Seq	DVE-1_CHIP_(L4440+atp-2)_rep2;_Caenorhabditis_e...	GFP agarose (ChromoTek, gta-20)|the whole organism	GFP agarose (ChromoTek...	dve-1p::dve-1::gfp; glp-4(bn2)|the whole organism|Day1 of adulthood	dve-1p::dve-1::gfp; gl...	ChIP-Seq
SRX7246255	SRA1004597	Germline_YA_ATAC_se_rep1;_Caenorhabditis_elegans;_ATAC-seq	Germline_YA_ATAC_se_rep1;_Caenorhabditis_elegan...	ATAC-seq	ATAC-seq	JA1616|Germline nuclei|YA	JA1616	ATAC-seq
SRX7246256	SRA1004597	Neurons_YA_ATAC_se_rep1;_Caenorhabditis_elegans;_ATAC-seq	Neurons_YA_ATAC_se_rep1;_Caenorhabditis_elegans...	ATAC-seq	ATAC-seq	JA1816|Neurons nuclei|YA	JA1816	ATAC-seq
SRX7246257	SRA1004597	Muscle_YA_ATAC_se_rep1;_Caenorhabditis_elegans;_ATAC-seq	Muscle_YA_ATAC_se_rep1;_Caenorhabditis_elegans;...	ATAC-seq	ATAC-seq	JA1585|Muscle nuclei|YA	JA1585	ATAC-seq
SRX7246258	SRA1004597	Hypodermis_YA_ATAC_se_rep1;_Caenorhabditis_elegans;_ATAC-seq	Hypodermis_YA_ATAC_se_rep1;_Caenorhabditis_eleg...	ATAC-seq	ATAC-seq	JA1815|Hypodermis nuclei|YA	JA1815	ATAC-seq
SRX7246259	SRA1004597	Intestine_YA_ATAC_se_rep1;_Caenorhabditis_elegans;_ATAC-seq	Intestine_YA_ATAC_se_rep1;_Caenorhabditis_elega...	ATAC-seq	ATAC-seq	JA1817|Intestine nuclei|YA	JA1817	ATAC-seq
SRX7246260	SRA1004597	Germline_YA_ATAC_se_rep2;_Caenorhabditis_elegans;_ATAC-seq	Germline_YA_ATAC_se_rep2;_Caenorhabditis_elegan...	ATAC-seq	ATAC-seq	JA1616|Germline nuclei|YA	JA1616	ATAC-seq
SRX7246261	SRA1004597	Neurons_YA_ATAC_se_rep2;_Caenorhabditis_elegans;_ATAC-seq	Neurons_YA_ATAC_se_rep2;_Caenorhabditis_elegans...	ATAC-seq	ATAC-seq	JA1816|Neurons nuclei|YA	JA1816	ATAC-seq
SRX7246262	SRA1004597	Muscle_YA_ATAC_se_rep2;_Caenorhabditis_elegans;_ATAC-seq	Muscle_YA_ATAC_se_rep2;_Caenorhabditis_elegans;...	ATAC-seq	ATAC-seq	JA1585|Muscle nuclei|YA	JA1585	ATAC-seq
SRX7246263	SRA1004597	Hypodermis_YA_ATAC_se_rep2;_Caenorhabditis_elegans;_ATAC-seq	Hypodermis_YA_ATAC_se_rep2;_Caenorhabditis_eleg...	ATAC-seq	ATAC-seq	JA1815|Hypodermis nuclei|YA	JA1815	ATAC-seq
SRX7246264	SRA1004597	Intestine_YA_ATAC_se_rep2;_Caenorhabditis_elegans;_ATAC-seq	Intestine_YA_ATAC_se_rep2;_Caenorhabditis_elega...	ATAC-seq	ATAC-seq	JA1817|Intestine nuclei|YA	JA1817	ATAC-seq
SRX7246265	SRA1004597	Germline_YA_ATAC_pe_rep1;_Caenorhabditis_elegans;_ATAC-seq	Germline_YA_ATAC_pe_rep1;_Caenorhabditis_elegan...	ATAC-seq	ATAC-seq	JA1616|Germline nuclei|YA	JA1616	ATAC-seq
SRX7246266	SRA1004597	Neurons_YA_ATAC_pe_rep1;_Caenorhabditis_elegans;_ATAC-seq	Neurons_YA_ATAC_pe_rep1;_Caenorhabditis_elegans...	ATAC-seq	ATAC-seq	JA1816|Neurons nuclei|YA	JA1816	ATAC-seq
SRX7246267	SRA1004597	Muscle_YA_ATAC_pe_rep1;_Caenorhabditis_elegans;_ATAC-seq	Muscle_YA_ATAC_pe_rep1;_Caenorhabditis_elegans;...	ATAC-seq	ATAC-seq	JA1585|Muscle nuclei|YA	JA1585	ATAC-seq
SRX7246268	SRA1004597	Hypodermis_YA_ATAC_pe_rep1;_Caenorhabditis_elegans;_ATAC-seq	Hypodermis_YA_ATAC_pe_rep1;_Caenorhabditis_eleg...	ATAC-seq	ATAC-seq	JA1815|Hypodermis nuclei|YA	JA1815	ATAC-seq
SRX7246269	SRA1004597	Intestine_YA_ATAC_pe_rep1;_Caenorhabditis_elegans;_ATAC-seq	Intestine_YA_ATAC_pe_rep1;_Caenorhabditis_elega...	ATAC-seq	ATAC-seq	JA1817|Intestine nuclei|YA	JA1817	ATAC-seq
SRX7246270	SRA1004597	Germline_YA_ATAC_pe_rep2;_Caenorhabditis_elegans;_ATAC-seq	Germline_YA_ATAC_pe_rep2;_Caenorhabditis_elegan...	ATAC-seq	ATAC-seq	JA1616|Germline nuclei|YA	JA1616	ATAC-seq
SRX7246271	SRA1004597	Neurons_YA_ATAC_pe_rep2;_Caenorhabditis_elegans;_ATAC-seq	Neurons_YA_ATAC_pe_rep2;_Caenorhabditis_elegans...	ATAC-seq	ATAC-seq	JA1816|Neurons nuclei|YA	JA1816	ATAC-seq
SRX7246272	SRA1004597	Muscle_YA_ATAC_pe_rep2;_Caenorhabditis_elegans;_ATAC-seq	Muscle_YA_ATAC_pe_rep2;_Caenorhabditis_elegans;...	ATAC-seq	ATAC-seq	JA1585|Muscle nuclei|YA	JA1585	ATAC-seq
SRX7246273	SRA1004597	Hypodermis_YA_ATAC_pe_rep2;_Caenorhabditis_elegans;_ATAC-seq	Hypodermis_YA_ATAC_pe_rep2;_Caenorhabditis_eleg...	ATAC-seq	ATAC-seq	JA1815|Hypodermis nuclei|YA	JA1815	ATAC-seq
SRX7246274	SRA1004597	Intestine_YA_ATAC_pe_rep2;_Caenorhabditis_elegans;_ATAC-seq	Intestine_YA_ATAC_pe_rep2;_Caenorhabditis_elega...	ATAC-seq	ATAC-seq	JA1817|Intestine nuclei|YA	JA1817	ATAC-seq
SRX7246275	SRA1004597	Muscle_L1_ATAC_se_rep1;_Caenorhabditis_elegans;_ATAC-seq	Muscle_L1_ATAC_se_rep1;_Caenorhabditis_elegans;...	ATAC-seq	ATAC-seq	JA1585|Muscle nuclei|fed L1	JA1585	ATAC-seq
SRX7246276	SRA1004597	Muscle_L3_ATAC_se_rep1;_Caenorhabditis_elegans;_ATAC-seq	Muscle_L3_ATAC_se_rep1;_Caenorhabditis_elegans;...	ATAC-seq	ATAC-seq	JA1585|Muscle nuclei|L3	JA1585	ATAC-seq
SRX7246277	SRA1004597	Germline_L3_ATAC_se_rep1;_Caenorhabditis_elegans;_ATAC-seq	Germline_L3_ATAC_se_rep1;_Caenorhabditis_elegan...	ATAC-seq	ATAC-seq	JA1616|Germline nuclei|L3	JA1616	ATAC-seq
SRX7262192	SRA1005994	WT_GFP_RNAi_H3K23me1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	WT_GFP_RNAi_H3K23me1_ChIP-seq;_Caenorhabditis_e...	H3K23me1, Active Motif:39388|Young adult whole animal	H3K23me1, Active Motif...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262193	SRA1005994	WT_GFP_RNAi_H3K23me2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	WT_GFP_RNAi_H3K23me2_ChIP-seq;_Caenorhabditis_e...	H3K23me2, Active Motif:39654|Young adult whole animal	H3K23me2, Active Motif...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262194	SRA1005994	WT_GFP_RNAi_H3K23me3_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	WT_GFP_RNAi_H3K23me3_ChIP-seq;_Caenorhabditis_e...	H3K23me3, Active Motif: 61500|Young adult whole animal	H3K23me3, Active Motif...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262195	SRA1005994	WT_GFP_RNAi_H3K9me3_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	WT_GFP_RNAi_H3K9me3_ChIP-seq;_Caenorhabditis_el...	H3K9me3, Abcam: ab8898|Young adult whole animal	H3K9me3, Abcam: ab8898	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262196	SRA1005994	WT_GFP_RNAi_input;_Caenorhabditis_elegans;_ChIP-Seq	WT_GFP_RNAi_input;_Caenorhabditis_elegans;_ChIP...	input|Young adult whole animal	input	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262197	SRA1005994	WT_H3K23me1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	WT_H3K23me1_ChIP-seq;_Caenorhabditis_elegans;_C...	H3K23me1, Active Motif:39388|Young adult whole animal	H3K23me1, Active Motif...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262198	SRA1005994	WT_H3K23me2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	WT_H3K23me2_ChIP-seq;_Caenorhabditis_elegans;_C...	H3K23me2, Active Motif:39654|Young adult whole animal	H3K23me2, Active Motif...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262199	SRA1005994	WT_H3K23me3_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	WT_H3K23me3_ChIP-seq;_Caenorhabditis_elegans;_C...	H3K23me3, Active Motif: 61500|Young adult whole animal	H3K23me3, Active Motif...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262200	SRA1005994	WT_H3K27me3_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	WT_H3K27me3_ChIP-seq;_Caenorhabditis_elegans;_C...	H3K27me3, Active Motif:39535|Young adult whole animal	H3K27me3, Active Motif...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262201	SRA1005994	WT_H3K9me3_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	WT_H3K9me3_ChIP-seq;_Caenorhabditis_elegans;_Ch...	H3K9me3, Abcam: ab8898|Young adult whole animal	H3K9me3, Abcam: ab8898	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262202	SRA1005994	WT_input_rep1;_Caenorhabditis_elegans;_ChIP-Seq	WT_input_rep1;_Caenorhabditis_elegans;_ChIP-Seq	input|Young adult whole animal	input	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262203	SRA1005994	WT_input_rep2;_Caenorhabditis_elegans;_ChIP-Seq	WT_input_rep2;_Caenorhabditis_elegans;_ChIP-Seq	input|Young adult whole animal	input	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262204	SRA1005994	WT_input_rep3;_Caenorhabditis_elegans;_ChIP-Seq	WT_input_rep3;_Caenorhabditis_elegans;_ChIP-Seq	input|Young adult whole animal	input	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262205	SRA1005994	oma-1_feeding,_F0,_H3K23me3_ChIP,_WT;_Caenorhabditis_elegans;_ChIP-Seq	oma-1_feeding,_F0,_H3K23me3_ChIP,_WT;_Caenorhab...	H3K23me3, Active Motif: 61500|Young adult whole animal	H3K23me3, Active Motif...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262206	SRA1005994	post_oma-1_feeding,_OP50_feeding,_F1_H3K23me3_ChIP,_WT;_Caenorhabditis_elegans;_ChIP-Seq	post_oma-1_feeding,_OP50_feeding,_F1_H3K23me3_C...	H3K23me3, Active Motif: 61500|Young adult whole animal	H3K23me3, Active Motif...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262207	SRA1005994	post_oma-1_feeding,_OP50_feeding,_F2_H3K23me3_ChIP,_WT;_Caenorhabditis_elegans;_ChIP-Seq	post_oma-1_feeding,_OP50_feeding,_F2_H3K23me3_C...	H3K23me3, Active Motif: 61500|Young adult whole animal	H3K23me3, Active Motif...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262208	SRA1005994	post_oma-1_feeding,_OP50_feeding,_F3_H3K23me3_ChIP,_WT;_Caenorhabditis_elegans;_ChIP-Seq	post_oma-1_feeding,_OP50_feeding,_F3_H3K23me3_C...	H3K23me3, Active Motif: 61500|Young adult whole animal	H3K23me3, Active Motif...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262209	SRA1005994	post_oma-1_feeding,_OP50_feeding,_F4_H3K23me3_ChIP,_WT;_Caenorhabditis_elegans;_ChIP-Seq	post_oma-1_feeding,_OP50_feeding,_F4_H3K23me3_C...	H3K23me3, Active Motif: 61500|Young adult whole animal	H3K23me3, Active Motif...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262210	SRA1005994	oma-1_feeding,_F0,_H3K9me3_ChIP,_WT;_Caenorhabditis_elegans;_ChIP-Seq	oma-1_feeding,_F0,_H3K9me3_ChIP,_WT;_Caenorhabd...	H3K9me3, Abcam: ab8898|Young adult whole animal	H3K9me3, Abcam: ab8898	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262211	SRA1005994	post_oma-1_feeding,_OP50_feeding,_F1_H3K9me3_ChIP,_WT;_Caenorhabditis_elegans;_ChIP-Seq	post_oma-1_feeding,_OP50_feeding,_F1_H3K9me3_Ch...	H3K9me3, Abcam: ab8898|Young adult whole animal	H3K9me3, Abcam: ab8898	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262212	SRA1005994	post_oma-1_feeding,_OP50_feeding,_F2_H3K9me3_ChIP,_WT;_Caenorhabditis_elegans;_ChIP-Seq	post_oma-1_feeding,_OP50_feeding,_F2_H3K9me3_Ch...	H3K9me3, Abcam: ab8898|Young adult whole animal	H3K9me3, Abcam: ab8898	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262213	SRA1005994	post_oma-1_feeding,_OP50_feeding,_F3_H3K9me3_ChIP,_WT;_Caenorhabditis_elegans;_ChIP-Seq	post_oma-1_feeding,_OP50_feeding,_F3_H3K9me3_Ch...	H3K9me3, Abcam: ab8898|Young adult whole animal	H3K9me3, Abcam: ab8898	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262214	SRA1005994	post_oma-1_feeding,_OP50_feeding,_F4_H3K9me3_ChIP,_WT;_Caenorhabditis_elegans;_ChIP-Seq	post_oma-1_feeding,_OP50_feeding,_F4_H3K9me3_Ch...	H3K9me3, Abcam: ab8898|Young adult whole animal	H3K9me3, Abcam: ab8898	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262215	SRA1005994	WT_oma-1_RNAi_H3K23me1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	WT_oma-1_RNAi_H3K23me1_ChIP-seq;_Caenorhabditis...	H3K23me1, Active Motif:39388|Young adult whole animal	H3K23me1, Active Motif...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262216	SRA1005994	WT_oma-1_RNAi_H3K23me2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	WT_oma-1_RNAi_H3K23me2_ChIP-seq;_Caenorhabditis...	H3K23me2, Active Motif:39654|Young adult whole animal	H3K23me2, Active Motif...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262217	SRA1005994	WT_oma-1_RNAi_H3K23me3_ChIP-seq_rep1;_Caenorhabditis_elegans;_ChIP-Seq	WT_oma-1_RNAi_H3K23me3_ChIP-seq_rep1;_Caenorhab...	H3K23me3, Active Motif: 61500|Young adult whole animal	H3K23me3, Active Motif...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262218	SRA1005994	WT_oma-1_RNAi_H3K23me3_ChIP-seq_rep2;_Caenorhabditis_elegans;_ChIP-Seq	WT_oma-1_RNAi_H3K23me3_ChIP-seq_rep2;_Caenorhab...	H3K23me3, Active Motif: 61500|Young adult whole animal	H3K23me3, Active Motif...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262219	SRA1005994	WT_oma-1_RNAi_H3K9me3_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	WT_oma-1_RNAi_H3K9me3_ChIP-seq;_Caenorhabditis_...	H3K9me3, Abcam: ab8898|Young adult whole animal	H3K9me3, Abcam: ab8898	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262220	SRA1005994	WT_oma-1_RNAi_input;_Caenorhabditis_elegans;_ChIP-Seq	WT_oma-1_RNAi_input;_Caenorhabditis_elegans;_Ch...	input|Young adult whole animal	input	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262221	SRA1005994	WT_smg-1_RNAi_H3K23me3_ChIP;_Caenorhabditis_elegans;_ChIP-Seq	WT_smg-1_RNAi_H3K23me3_ChIP;_Caenorhabditis_ele...	H3K23me3, Active Motif: 61500|Young adult whole animal	H3K23me3, Active Motif...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262222	SRA1005994	WT_smg-1_RNAi_H3K9me3_ChIP;_Caenorhabditis_elegans;_ChIP-Seq	WT_smg-1_RNAi_H3K9me3_ChIP;_Caenorhabditis_eleg...	H3K9me3, Abcam: ab8898|Young adult whole animal	H3K9me3, Abcam: ab8898	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262223	SRA1005994	set-32_mutant_no_RNAi_H3K23me3_ChIP;_Caenorhabditis_elegans;_ChIP-Seq	set-32_mutant_no_RNAi_H3K23me3_ChIP;_Caenorhabd...	H3K23me3, Active Motif: 61500|Young adult whole animal	H3K23me3, Active Motif...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262224	SRA1005994	set-32_mutant_no_RNAi_H3K9me3_ChIP;_Caenorhabditis_elegans;_ChIP-Seq	set-32_mutant_no_RNAi_H3K9me3_ChIP;_Caenorhabdi...	H3K9me3, Abcam: ab8898|Young adult whole animal	H3K9me3, Abcam: ab8898	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262225	SRA1005994	set-32_mutant_no_RNAi_input;_Caenorhabditis_elegans;_ChIP-Seq	set-32_mutant_no_RNAi_input;_Caenorhabditis_ele...	input|Young adult whole animal	input	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262226	SRA1005994	set-32_oma-1_RNAi_H3K23me3_ChIP_rep1;_Caenorhabditis_elegans;_ChIP-Seq	set-32_oma-1_RNAi_H3K23me3_ChIP_rep1;_Caenorhab...	H3K23me3, Active Motif: 61500|Young adult whole animal	H3K23me3, Active Motif...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262227	SRA1005994	set-32_oma-1_RNAi_H3K23me3_ChIP_rep2;_Caenorhabditis_elegans;_ChIP-Seq	set-32_oma-1_RNAi_H3K23me3_ChIP_rep2;_Caenorhab...	H3K23me3, Active Motif: 61500|Young adult whole animal	H3K23me3, Active Motif...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262228	SRA1005994	set-32_oma-1_RNAi_H3K9me3_ChIP;_Caenorhabditis_elegans;_ChIP-Seq	set-32_oma-1_RNAi_H3K9me3_ChIP;_Caenorhabditis_...	H3K9me3, Abcam: ab8898|Young adult whole animal	H3K9me3, Abcam: ab8898	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262229	SRA1005994	met-2_set-25_no_RNAi_H3K23me3_ChIP;_Caenorhabditis_elegans;_ChIP-Seq	met-2_set-25_no_RNAi_H3K23me3_ChIP;_Caenorhabdi...	H3K23me3, Active Motif: 61500|Young adult whole animal	H3K23me3, Active Motif...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262230	SRA1005994	met-2_set-25_no_RNAi_H3K9me3_ChIP_rep1;_Caenorhabditis_elegans;_ChIP-Seq	met-2_set-25_no_RNAi_H3K9me3_ChIP_rep1;_Caenorh...	H3K9me3, Abcam: ab8898|Young adult whole animal	H3K9me3, Abcam: ab8898	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262231	SRA1005994	met-2_set-25_no_RNAi_H3K9me3_ChIP_rep2;_Caenorhabditis_elegans;_ChIP-Seq	met-2_set-25_no_RNAi_H3K9me3_ChIP_rep2;_Caenorh...	H3K9me3, Abcam: ab8898|Young adult whole animal	H3K9me3, Abcam: ab8898	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262232	SRA1005994	met-2_set-25_no_RNAi_input;_Caenorhabditis_elegans;_ChIP-Seq	met-2_set-25_no_RNAi_input;_Caenorhabditis_eleg...	input|Young adult whole animal	input	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262233	SRA1005994	met-2_set-25_oma-1_RNAi_H3K23me3_ChIP_rep1;_Caenorhabditis_elegans;_ChIP-Seq	met-2_set-25_oma-1_RNAi_H3K23me3_ChIP_rep1;_Cae...	H3K23me3, Active Motif: 61500|Young adult whole animal	H3K23me3, Active Motif...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262234	SRA1005994	met-2_set-25_oma-1_RNAi_H3K23me3_ChIP_rep2;_Caenorhabditis_elegans;_ChIP-Seq	met-2_set-25_oma-1_RNAi_H3K23me3_ChIP_rep2;_Cae...	H3K23me3, Active Motif: 61500|Young adult whole animal	H3K23me3, Active Motif...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262235	SRA1005994	hrde-1_no_RNAi_H3K23me3_ChIP_rep1;_Caenorhabditis_elegans;_ChIP-Seq	hrde-1_no_RNAi_H3K23me3_ChIP_rep1;_Caenorhabdit...	H3K23me3, Active Motif: 61500|Young adult whole animal	H3K23me3, Active Motif...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262236	SRA1005994	hrde-1_no_RNAi_H3K23me3_ChIP_rep2;_Caenorhabditis_elegans;_ChIP-Seq	hrde-1_no_RNAi_H3K23me3_ChIP_rep2;_Caenorhabdit...	H3K23me3, Active Motif: 61500|Young adult whole animal	H3K23me3, Active Motif...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262237	SRA1005994	hrde-1_no_RNAi_H3K9me3_ChIP;_Caenorhabditis_elegans;_ChIP-Seq	hrde-1_no_RNAi_H3K9me3_ChIP;_Caenorhabditis_ele...	H3K9me3, Abcam: ab8898|Young adult whole animal	H3K9me3, Abcam: ab8898	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262238	SRA1005994	hrde-1_no_RNAi_input;_Caenorhabditis_elegans;_ChIP-Seq	hrde-1_no_RNAi_input;_Caenorhabditis_elegans;_C...	input|Young adult whole animal	input	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262239	SRA1005994	hrde-1_oma-1_RNAi_H3K9me3_ChIP_rep1;_Caenorhabditis_elegans;_ChIP-Seq	hrde-1_oma-1_RNAi_H3K9me3_ChIP_rep1;_Caenorhabd...	H3K23me3, Active Motif: 61500|Young adult whole animal	H3K23me3, Active Motif...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262240	SRA1005994	hrde-1_oma-1_RNAi_H3K9me3_ChIP_rep2;_Caenorhabditis_elegans;_ChIP-Seq	hrde-1_oma-1_RNAi_H3K9me3_ChIP_rep2;_Caenorhabd...	H3K9me3, Abcam: ab8898|Young adult whole animal	H3K9me3, Abcam: ab8898	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262241	SRA1005994	glp-1_no_RNAi_H3K23me3_ChIP;_Caenorhabditis_elegans;_ChIP-Seq	glp-1_no_RNAi_H3K23me3_ChIP;_Caenorhabditis_ele...	H3K23me3, Active Motif: 61500|Young adult whole animal	H3K23me3, Active Motif...	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262242	SRA1005994	glp-1_no_RNAi_H3K9me3_ChIP;_Caenorhabditis_elegans;_ChIP-Seq	glp-1_no_RNAi_H3K9me3_ChIP;_Caenorhabditis_eleg...	H3K9me3, Abcam: ab8898|Young adult whole animal	H3K9me3, Abcam: ab8898	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX7262243	SRA1005994	glp-1_no_RNAi_input;_Caenorhabditis_elegans;_ChIP-Seq	glp-1_no_RNAi_input;_Caenorhabditis_elegans;_Ch...	input|Young adult whole animal	input	Young adult whole animal	Young adult whole animal	ChIP-Seq
SRX743640	SRA196543	H3K36me3_D2_rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_D2_rep2_ChIPSeq;_Caenorhabditis_elegan...	H3K36me3|H3K36me3 (ab9050, Abcam)|whole animal	H3K36me3	glp-1(e2141)|whole animal	glp-1(e2141)	ChIP-Seq
SRX743641	SRA196543	H3K36me3_D2_rep3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_D2_rep3_ChIPSeq;_Caenorhabditis_elegan...	H3K36me3|H3K36me3 (ab9050, Abcam)|whole animal	H3K36me3	glp-1(e2141)|whole animal	glp-1(e2141)	ChIP-Seq
SRX743642	SRA196543	H3K36me3_D2_rep4_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_D2_rep4_ChIPSeq;_Caenorhabditis_elegan...	H3K36me3|H3K36me3 (ab9050, Abcam)|whole animal	H3K36me3	glp-1(e2141)|whole animal	glp-1(e2141)	ChIP-Seq
SRX743643	SRA196543	H3K36me3_D12_rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_D12_rep2_ChIPSeq;_Caenorhabditis_elega...	H3K36me3|H3K36me3 (ab9050, Abcam)|whole animal	H3K36me3	glp-1(e2141)|whole animal	glp-1(e2141)	ChIP-Seq
SRX743644	SRA196543	H3K36me3_D12_rep3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_D12_rep3_ChIPSeq;_Caenorhabditis_elega...	H3K36me3|H3K36me3 (ab9050, Abcam)|whole animal	H3K36me3	glp-1(e2141)|whole animal	glp-1(e2141)	ChIP-Seq
SRX743645	SRA196543	H3K36me3_D12_rep4_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3_D12_rep4_ChIPSeq;_Caenorhabditis_elega...	H3K36me3|H3K36me3 (ab9050, Abcam)|whole animal	H3K36me3	glp-1(e2141)|whole animal	glp-1(e2141)	ChIP-Seq
SRX743646	SRA196543	H3_D2_rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3_D2_rep2_ChIPSeq;_Caenorhabditis_elegans;_ChI...	H3|H3 (ab1791, Abcam)|whole animal	H3	glp-1(e2141)|whole animal	glp-1(e2141)	ChIP-Seq
SRX743647	SRA196543	H3_D2_rep3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3_D2_rep3_ChIPSeq;_Caenorhabditis_elegans;_ChI...	H3|H3 (ab1791, Abcam)|whole animal	H3	glp-1(e2141)|whole animal	glp-1(e2141)	ChIP-Seq
SRX743648	SRA196543	H3_D2_rep4_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3_D2_rep4_ChIPSeq;_Caenorhabditis_elegans;_ChI...	H3|H3 (ab1791, Abcam)|whole animal	H3	glp-1(e2141)|whole animal	glp-1(e2141)	ChIP-Seq
SRX743649	SRA196543	H3_D12_rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3_D12_rep2_ChIPSeq;_Caenorhabditis_elegans;_Ch...	H3|H3 (ab1791, Abcam)|whole animal	H3	glp-1(e2141)|whole animal	glp-1(e2141)	ChIP-Seq
SRX743650	SRA196543	H3_D12_rep3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3_D12_rep3_ChIPSeq;_Caenorhabditis_elegans;_Ch...	H3|H3 (ab1791, Abcam)|whole animal	H3	glp-1(e2141)|whole animal	glp-1(e2141)	ChIP-Seq
SRX743651	SRA196543	H3_D12_rep4_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H3_D12_rep4_ChIPSeq;_Caenorhabditis_elegans;_Ch...	H3|H3 (ab1791, Abcam)|whole animal	H3	glp-1(e2141)|whole animal	glp-1(e2141)	ChIP-Seq
SRX747295	SRA196965	ChIP-seq_of_H3K36me3_in_wild-type,_replicate_1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_H3K36me3_in_wild-type,_replicate_1;...	anti-H3K36me3|L3 larvae	anti-H3K36me3	N2|L3 larvae|whole larvae|L3	N2	ChIP-Seq
SRX747296	SRA196965	ChIP-seq_of_H3K36me3_in_wild-type,_replicate_2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_H3K36me3_in_wild-type,_replicate_2;...	anti-H3K36me3|L3 larvae	anti-H3K36me3	N2|L3 larvae|whole larvae|L3	N2	ChIP-Seq
SRX747297	SRA196965	ChIP-seq_of_histone_H3_in_wild-type,_replicate_1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_histone_H3_in_wild-type,_replicate_...	anti-H3|L3 larvae	anti-H3	N2|L3 larvae|whole larvae|L3	N2	ChIP-Seq
SRX747298	SRA196965	ChIP-seq_of_histone_H3_in_wild-type,_replicate_2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_histone_H3_in_wild-type,_replicate_...	anti-H3|L3 larvae	anti-H3	N2|L3 larvae|whole larvae|L3	N2	ChIP-Seq
SRX747299	SRA196965	ChIP-seq_of_histone_H3_in_lin-35_mutant,_replicate_1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_histone_H3_in_lin-35_mutant,_replic...	anti-H3|L3 larvae	anti-H3	JA1507|L3 larvae|whole larvae|L3	JA1507	ChIP-Seq
SRX747300	SRA196965	ChIP-seq_of_histone_H3_in_lin-35_mutant,_replicate_2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_histone_H3_in_lin-35_mutant,_replic...	anti-H3|L3 larvae	anti-H3	JA1507|L3 larvae|whole larvae|L3	JA1507	ChIP-Seq
SRX747301	SRA196965	ChiP-seq_of_HTZ-1_in_lin-35_mutant,_replicate_1;_Caenorhabditis_elegans;_ChIP-Seq	ChiP-seq_of_HTZ-1_in_lin-35_mutant,_replicate_1...	anti-HTZ-1|L3 larvae	anti-HTZ-1	JA1507|L3 larvae|whole larvae|L3	JA1507	ChIP-Seq
SRX747302	SRA196965	ChiP-seq_of_HTZ-1_in_lin-35_mutant,_replicate_2;_Caenorhabditis_elegans;_ChIP-Seq	ChiP-seq_of_HTZ-1_in_lin-35_mutant,_replicate_2...	anti-HTZ-1|L3 larvae	anti-HTZ-1	JA1507|L3 larvae|whole larvae|L3	JA1507	ChIP-Seq
SRX747303	SRA196965	ChiP-seq_of_H3K4me3_in_lin-35_mutant,_replicate_1;_Caenorhabditis_elegans;_ChIP-Seq	ChiP-seq_of_H3K4me3_in_lin-35_mutant,_replicate...	anti-H3K4me3|L3 larvae	anti-H3K4me3	JA1507|L3 larvae|whole larvae|L3	JA1507	ChIP-Seq
SRX747304	SRA196965	ChIP-seq_of_H3K4me3_in_lin-35_mutant,_replicate_2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_H3K4me3_in_lin-35_mutant,_replicate...	anti-H3K4me3|L3 larvae	anti-H3K4me3	JA1507|L3 larvae|whole larvae|L3	JA1507	ChIP-Seq
SRX747305	SRA196965	ChIP-seq_of_H4ac_(tetraacetyl)_in_lin-35_mutant,_replicate_1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_H4ac_(tetraacetyl)_in_lin-35_mutant...	anti-H4 tetraacetyl|L3 larvae	anti-H4 tetraacetyl	JA1507|L3 larvae|whole larvae|L3	JA1507	ChIP-Seq
SRX7574649	SRA1027677	N2_Rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	N2_Rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3|L1 larvae	H3K36me3	N2|L1 larvae|whole animal|L1 larvae	N2	ChIP-Seq
SRX7574650	SRA1027677	spr-5;_met-2_Rep1_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	spr-5;_met-2_Rep1_ChIP-seq;_Caenorhabditis_eleg...	H3K36me3|L1 larvae	H3K36me3	spr-5 (by101)(I); met-2 (n4256)(III)|L1 larvae|whole animal|L1 larvae	spr-5 (by101)(I); met-...	ChIP-Seq
SRX7574651	SRA1027677	N2_Rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	N2_Rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	H3K36me3|L1 larvae	H3K36me3	N2|L1 larvae|whole animal|L1 larvae	N2	ChIP-Seq
SRX7574652	SRA1027677	spr-5;_met-2_Rep2_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	spr-5;_met-2_Rep2_ChIP-seq;_Caenorhabditis_eleg...	H3K36me3|L1 larvae	H3K36me3	spr-5 (by101)(I); met-2 (n4256)(III)|L1 larvae|whole animal|L1 larvae	spr-5 (by101)(I); met-...	ChIP-Seq
SRX7574653	SRA1027677	N2_Rep2_Input_ChIP-seq;_Caenorhabditis_elegans;_ChIP-Seq	N2_Rep2_Input_ChIP-seq;_Caenorhabditis_elegans;...	None|L1 larvae	None	N2|L1 larvae|whole animal|L1 larvae	N2	ChIP-Seq
SRX7627551	SRA1031299	germline_LAG-1_ChIPseq_rep1;_Caenorhabditis_elegans;_ChIP-Seq	germline_LAG-1_ChIPseq_rep1;_Caenorhabditis_ele...	LAG-1|germline	LAG-1	Bristol|germline|germline	Bristol	ChIP-Seq
SRX7627552	SRA1031299	germline_LAG-1_ChIPseq_rep2;_Caenorhabditis_elegans;_ChIP-Seq	germline_LAG-1_ChIPseq_rep2;_Caenorhabditis_ele...	LAG-1|germline	LAG-1	Bristol|germline|germline	Bristol	ChIP-Seq
SRX7627553	SRA1031299	germline_LAG-1_ChIPseq_rep3;_Caenorhabditis_elegans;_ChIP-Seq	germline_LAG-1_ChIPseq_rep3;_Caenorhabditis_ele...	LAG-1|germline	LAG-1	Bristol|germline|germline	Bristol	ChIP-Seq
SRX7627554	SRA1031299	input_DNA;_Caenorhabditis_elegans;_ChIP-Seq	input_DNA;_Caenorhabditis_elegans;_ChIP-Seq	none|germline	none	Bristol|germline|germline	Bristol	ChIP-Seq
SRX7627594	SRA1031304	FLAG_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	FLAG_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	FLAG|whole animal	FLAG	Bristol|whole animal|whole animal	Bristol	ChIP-Seq
SRX7627595	SRA1031304	GFP2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	GFP2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	GFP|whole animal	GFP	Bristol|whole animal|whole animal	Bristol	ChIP-Seq
SRX7627596	SRA1031304	GFP3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	GFP3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	GFP|whole animal	GFP	Bristol|whole animal|whole animal	Bristol	ChIP-Seq
SRX7627597	SRA1031304	input_DNA_whole_animal;_Caenorhabditis_elegans;_ChIP-Seq	input_DNA_whole_animal;_Caenorhabditis_elegans;...	none|whole animal	none	Bristol|whole animal|whole animal	Bristol	ChIP-Seq
SRX7630544	SRA1031821	met2set25_1_SDC3_ChIP;_Caenorhabditis_elegans;_ChIP-Seq	met2set25_1_SDC3_ChIP;_Caenorhabditis_elegans;_...	mixed-stage embryos	mixed-stage embryos	GW0638|mixed-stage embryos|mixed-stage embryos	GW0638	ChIP-Seq
SRX7630545	SRA1031821	met2set25_1_IgG_ChIP;_Caenorhabditis_elegans;_ChIP-Seq	met2set25_1_IgG_ChIP;_Caenorhabditis_elegans;_C...	mixed-stage embryos	mixed-stage embryos	GW0638|mixed-stage embryos|mixed-stage embryos	GW0638	ChIP-Seq
SRX7630546	SRA1031821	met2set25_2_SDC3_ChIP;_Caenorhabditis_elegans;_ChIP-Seq	met2set25_2_SDC3_ChIP;_Caenorhabditis_elegans;_...	mixed-stage embryos	mixed-stage embryos	GW0638|mixed-stage embryos|mixed-stage embryos	GW0638	ChIP-Seq
SRX7630547	SRA1031821	met2set25_2_IgG_ChIP;_Caenorhabditis_elegans;_ChIP-Seq	met2set25_2_IgG_ChIP;_Caenorhabditis_elegans;_C...	mixed-stage embryos	mixed-stage embryos	GW0638|mixed-stage embryos|mixed-stage embryos	GW0638	ChIP-Seq
SRX7630548	SRA1031821	cec4_SDC3_ChIP;_Caenorhabditis_elegans;_ChIP-Seq	cec4_SDC3_ChIP;_Caenorhabditis_elegans;_ChIP-Seq	mixed-stage embryos	mixed-stage embryos	RB2301|mixed-stage embryos|mixed-stage embryos	RB2301	ChIP-Seq
SRX7630549	SRA1031821	cec4_IgG_ChIP;_Caenorhabditis_elegans;_ChIP-Seq	cec4_IgG_ChIP;_Caenorhabditis_elegans;_ChIP-Seq	mixed-stage embryos	mixed-stage embryos	RB2301|mixed-stage embryos|mixed-stage embryos	RB2301	ChIP-Seq
SRX7635313	SRA1032517	ChIP-seq_of_EGL43_(GFP_tagged)_in_wild-type,_replicate_1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_EGL43_(GFP_tagged)_in_wild-type,_re...	anti-GFP|L3	anti-GFP	egl43-gfp|L3|larvae|L3	egl43-gfp	ChIP-Seq
SRX7635314	SRA1032517	ChIP-seq_of_EGL43_(GFP_tagged)_in_wild-type,_replicate_2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_of_EGL43_(GFP_tagged)_in_wild-type,_re...	anti-GFP|L3	anti-GFP	egl43-gfp|L3|larvae|L3	egl43-gfp	ChIP-Seq
SRX7687144	SRA923501	20C_N2_ATAC_1;_Caenorhabditis_elegans;_ATAC-seq	20C_N2_ATAC_1;_Caenorhabditis_elegans;_ATAC-seq	ATAC-seq	ATAC-seq	N2 - wild-type|isolated germline nuclei|Day 1 Adult	N2 - wild-type	ATAC-seq
SRX7687145	SRA923501	20C_N2_ATAC_2;_Caenorhabditis_elegans;_ATAC-seq	20C_N2_ATAC_2;_Caenorhabditis_elegans;_ATAC-seq	ATAC-seq	ATAC-seq	N2 - wild-type|isolated germline nuclei|Day 1 Adult	N2 - wild-type	ATAC-seq
SRX7687146	SRA923501	20C_N2_ATAC_3;_Caenorhabditis_elegans;_ATAC-seq	20C_N2_ATAC_3;_Caenorhabditis_elegans;_ATAC-seq	ATAC-seq	ATAC-seq	N2 - wild-type|isolated germline nuclei|Day 1 Adult	N2 - wild-type	ATAC-seq
SRX7687147	SRA923501	20C_mut-16_ATAC_1;_Caenorhabditis_elegans;_ATAC-seq	20C_mut-16_ATAC_1;_Caenorhabditis_elegans;_ATAC...	ATAC-seq	ATAC-seq	NL1810 - mut-16(pk710) I.|isolated germline nuclei|Day 1 Adult	NL1810 - mut-16(pk710) I.	ATAC-seq
SRX7687148	SRA923501	20C_mut-16_ATAC_2;_Caenorhabditis_elegans;_ATAC-seq	20C_mut-16_ATAC_2;_Caenorhabditis_elegans;_ATAC...	ATAC-seq	ATAC-seq	NL1810 - mut-16(pk710) I.|isolated germline nuclei|Day 1 Adult	NL1810 - mut-16(pk710) I.	ATAC-seq
SRX7687149	SRA923501	20C_mut-16_ATAC_3;_Caenorhabditis_elegans;_ATAC-seq	20C_mut-16_ATAC_3;_Caenorhabditis_elegans;_ATAC...	ATAC-seq	ATAC-seq	NL1810 - mut-16(pk710) I.|isolated germline nuclei|Day 1 Adult	NL1810 - mut-16(pk710) I.	ATAC-seq
SRX7687150	SRA923501	25C_N2_ATAC_1;_Caenorhabditis_elegans;_ATAC-seq	25C_N2_ATAC_1;_Caenorhabditis_elegans;_ATAC-seq	ATAC-seq	ATAC-seq	N2 - wild-type|isolated germline nuclei|Day 1 Adult	N2 - wild-type	ATAC-seq
SRX7687151	SRA923501	25C_N2_ATAC_2;_Caenorhabditis_elegans;_ATAC-seq	25C_N2_ATAC_2;_Caenorhabditis_elegans;_ATAC-seq	ATAC-seq	ATAC-seq	N2 - wild-type|isolated germline nuclei|Day 1 Adult	N2 - wild-type	ATAC-seq
SRX7687152	SRA923501	25C_N2_ATAC_3;_Caenorhabditis_elegans;_ATAC-seq	25C_N2_ATAC_3;_Caenorhabditis_elegans;_ATAC-seq	ATAC-seq	ATAC-seq	N2 - wild-type|isolated germline nuclei|Day 1 Adult	N2 - wild-type	ATAC-seq
SRX7687153	SRA923501	25C_mut-16_ATAC_1;_Caenorhabditis_elegans;_ATAC-seq	25C_mut-16_ATAC_1;_Caenorhabditis_elegans;_ATAC...	ATAC-seq	ATAC-seq	NL1810 - mut-16(pk710) I.|isolated germline nuclei|Day 1 Adult	NL1810 - mut-16(pk710) I.	ATAC-seq
SRX7687154	SRA923501	25C_mut-16_ATAC_2;_Caenorhabditis_elegans;_ATAC-seq	25C_mut-16_ATAC_2;_Caenorhabditis_elegans;_ATAC...	ATAC-seq	ATAC-seq	NL1810 - mut-16(pk710) I.|isolated germline nuclei|Day 1 Adult	NL1810 - mut-16(pk710) I.	ATAC-seq
SRX7687155	SRA923501	25C_mut-16_ATAC_3;_Caenorhabditis_elegans;_ATAC-seq	25C_mut-16_ATAC_3;_Caenorhabditis_elegans;_ATAC...	ATAC-seq	ATAC-seq	NL1810 - mut-16(pk710) I.|isolated germline nuclei|Day 1 Adult	NL1810 - mut-16(pk710) I.	ATAC-seq
SRX796306	SRA209031	DAF-16_chip_daf-2_(e1370);_Caenorhabditis_elegans;_ChIP-Seq	DAF-16_chip_daf-2_(e1370);_Caenorhabditis_elega...	DAF-16|mix stage culture	DAF-16	daf-2 (e1370)|mix stage culture|Mix Culture	daf-2 (e1370)	ChIP-Seq
SRX796307	SRA209031	DAF-16_input_daf-2_(e1370);_Caenorhabditis_elegans;_ChIP-Seq	DAF-16_input_daf-2_(e1370);_Caenorhabditis_eleg...	input|mix stage culture	input	daf-2 (e1370)|mix stage culture|Mix Culture	daf-2 (e1370)	ChIP-Seq
SRX7971790	SRA1058268	ChIP-seq_wild-type_H3K27me3_rep_1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_wild-type_H3K27me3_rep_1;_Caenorhabdit...	H3K27me3|Isolated germ nuclei from wild-type adults	H3K27me3	N2|Isolated germ nuclei from wild-type adults|Isolated germ nuclei|Young adult	N2	ChIP-Seq
SRX7971791	SRA1058268	ChIP-seq_wild-type_H3K27me3_rep_2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_wild-type_H3K27me3_rep_2;_Caenorhabdit...	H3K27me3|Isolated germ nuclei from wild-type adults	H3K27me3	N2|Isolated germ nuclei from wild-type adults|Isolated germ nuclei|Young adult	N2	ChIP-Seq
SRX7971792	SRA1058268	ChIP-seq_wild-type_H3K36me3_rep_1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_wild-type_H3K36me3_rep_1;_Caenorhabdit...	H3K36me3|Isolated germ nuclei from wild-type adults	H3K36me3	N2|Isolated germ nuclei from wild-type adults|Isolated germ nuclei|Young adult	N2	ChIP-Seq
SRX7971793	SRA1058268	ChIP-seq_wild-type_H3K36me3_rep_2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_wild-type_H3K36me3_rep_2;_Caenorhabdit...	H3K36me3|Isolated germ nuclei from wild-type adults	H3K36me3	N2|Isolated germ nuclei from wild-type adults|Isolated germ nuclei|Young adult	N2	ChIP-Seq
SRX7971794	SRA1058268	ChIP-seq_oef-1(vr25)_H3K27me3_rep_1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_oef-1(vr25)_H3K27me3_rep_1;_Caenorhabd...	H3K27me3|Isolated germ nuclei from oef-1(vr25) mutant adults	H3K27me3	YL585|Isolated germ nuclei from oef-1(vr25) mutant adults|Isolated germ nuclei|Young adult	YL585	ChIP-Seq
SRX7971795	SRA1058268	ChIP-seq_oef-1(vr25)_H3K27me3_rep_2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_oef-1(vr25)_H3K27me3_rep_2;_Caenorhabd...	H3K27me3|Isolated germ nuclei from oef-1(vr25) mutant adults	H3K27me3	YL585|Isolated germ nuclei from oef-1(vr25) mutant adults|Isolated germ nuclei|Young adult	YL585	ChIP-Seq
SRX7971796	SRA1058268	ChIP-seq_oef-1(vr25)_H3K36me3_rep_1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_oef-1(vr25)_H3K36me3_rep_1;_Caenorhabd...	H3K36me3|Isolated germ nuclei from oef-1(vr25) mutant adults	H3K36me3	YL585|Isolated germ nuclei from oef-1(vr25) mutant adults|Isolated germ nuclei|Young adult	YL585	ChIP-Seq
SRX7971797	SRA1058268	ChIP-seq_oef-1(vr25)_H3K36me3_rep_2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_oef-1(vr25)_H3K36me3_rep_2;_Caenorhabd...	H3K36me3|Isolated germ nuclei from oef-1(vr25) mutant adults	H3K36me3	YL585|Isolated germ nuclei from oef-1(vr25) mutant adults|Isolated germ nuclei|Young adult	YL585	ChIP-Seq
SRX7971798	SRA1058268	ChIP-seq_wild-type_input_rep_1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_wild-type_input_rep_1;_Caenorhabditis_...	none|Isolated germ nuclei from wild-type adults	none	N2|Isolated germ nuclei from wild-type adults|Isolated germ nuclei|Young adult	N2	ChIP-Seq
SRX7971799	SRA1058268	ChIP-seq_wild-type_input_rep_2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_wild-type_input_rep_2;_Caenorhabditis_...	none|Isolated germ nuclei from wild-type adults	none	N2|Isolated germ nuclei from wild-type adults|Isolated germ nuclei|Young adult	N2	ChIP-Seq
SRX7971800	SRA1058268	ChIP-seq_oef-1(vr25)_input_rep_1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_oef-1(vr25)_input_rep_1;_Caenorhabditi...	none|Isolated germ nuclei from oef-1(vr25) mutant adults	none	YL585|Isolated germ nuclei from oef-1(vr25) mutant adults|Isolated germ nuclei|Young adult	YL585	ChIP-Seq
SRX7971801	SRA1058268	ChIP-seq_oef-1(vr25)_input_rep_2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_oef-1(vr25)_input_rep_2;_Caenorhabditi...	none|Isolated germ nuclei from oef-1(vr25) mutant adults	none	YL585|Isolated germ nuclei from oef-1(vr25) mutant adults|Isolated germ nuclei|Young adult	YL585	ChIP-Seq
SRX7971802	SRA1058268	ChIP-seq_glp-4(bn2)_H3K27me3_rep_1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_glp-4(bn2)_H3K27me3_rep_1;_Caenorhabdi...	H3K27me3|Staged young adults from glp-4(bn2) strain	H3K27me3	SS104|Staged young adults from glp-4(bn2) strain|Whole animal|Young adult	SS104	ChIP-Seq
SRX7971803	SRA1058268	ChIP-seq_glp-4(bn2)_H3K27me3_rep_2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_glp-4(bn2)_H3K27me3_rep_2;_Caenorhabdi...	H3K27me3|Staged young adults from glp-4(bn2) strain	H3K27me3	SS104|Staged young adults from glp-4(bn2) strain|Whole animal|Young adult	SS104	ChIP-Seq
SRX7971804	SRA1058268	ChIP-seq_glp-4(bn2)_H3K36me3_rep_1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_glp-4(bn2)_H3K36me3_rep_1;_Caenorhabdi...	H3K36me3|Staged young adults from glp-4(bn2) strain	H3K36me3	SS104|Staged young adults from glp-4(bn2) strain|Whole animal|Young adult	SS104	ChIP-Seq
SRX7971805	SRA1058268	ChIP-seq_glp-4(bn2)_H3K36me3_rep_2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_glp-4(bn2)_H3K36me3_rep_2;_Caenorhabdi...	H3K36me3|Staged young adults from glp-4(bn2) strain	H3K36me3	SS104|Staged young adults from glp-4(bn2) strain|Whole animal|Young adult	SS104	ChIP-Seq
SRX7971806	SRA1058268	ChIP-seq_glp-4;_oef-1_H3K27me3_rep_1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_glp-4;_oef-1_H3K27me3_rep_1;_Caenorhab...	H3K27me3|Staged young adults from glp-4(bn2); oef-1(vr25) strain	H3K27me3	YL679|Staged young adults from glp-4(bn2); oef-1(vr25) strain|Whole animal|Young adult	YL679	ChIP-Seq
SRX7971807	SRA1058268	ChIP-seq_glp-4;_oef-1_H3K27me3_rep_2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_glp-4;_oef-1_H3K27me3_rep_2;_Caenorhab...	H3K27me3|Staged young adults from glp-4(bn2); oef-1(vr25) strain	H3K27me3	YL679|Staged young adults from glp-4(bn2); oef-1(vr25) strain|Whole animal|Young adult	YL679	ChIP-Seq
SRX7971808	SRA1058268	ChIP-seq_glp-4;_oef-1_H3K36me3_rep_1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_glp-4;_oef-1_H3K36me3_rep_1;_Caenorhab...	H3K36me3|Staged young adults from glp-4(bn2); oef-1(vr25) strain	H3K36me3	YL679|Staged young adults from glp-4(bn2); oef-1(vr25) strain|Whole animal|Young adult	YL679	ChIP-Seq
SRX7971809	SRA1058268	ChIP-seq_glp-4;_oef-1_H3K36me3_rep_2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_glp-4;_oef-1_H3K36me3_rep_2;_Caenorhab...	H3K36me3|Staged young adults from glp-4(bn2); oef-1(vr25) strain	H3K36me3	YL679|Staged young adults from glp-4(bn2); oef-1(vr25) strain|Whole animal|Young adult	YL679	ChIP-Seq
SRX7971810	SRA1058268	ChIP-seq_glp-4(bn2)_input_rep_1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_glp-4(bn2)_input_rep_1;_Caenorhabditis...	none|Staged young adults from glp-4(bn2) strain	none	SS104|Staged young adults from glp-4(bn2) strain|Whole animal|Young adult	SS104	ChIP-Seq
SRX7971811	SRA1058268	ChIP-seq_glp-4(bn2)_input_rep_2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_glp-4(bn2)_input_rep_2;_Caenorhabditis...	none|Staged young adults from glp-4(bn2) strain	none	SS104|Staged young adults from glp-4(bn2) strain|Whole animal|Young adult	SS104	ChIP-Seq
SRX7971812	SRA1058268	ChIP-seq_glp-4;_oef-1_input_rep_1;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_glp-4;_oef-1_input_rep_1;_Caenorhabdit...	none|Staged young adults from glp-4(bn2); oef-1(vr25) strain	none	YL679|Staged young adults from glp-4(bn2); oef-1(vr25) strain|Whole animal|Young adult	YL679	ChIP-Seq
SRX7971813	SRA1058268	ChIP-seq_glp-4;_oef-1_input_rep_2;_Caenorhabditis_elegans;_ChIP-Seq	ChIP-seq_glp-4;_oef-1_input_rep_2;_Caenorhabdit...	none|Staged young adults from glp-4(bn2); oef-1(vr25) strain	none	YL679|Staged young adults from glp-4(bn2); oef-1(vr25) strain|Whole animal|Young adult	YL679	ChIP-Seq
SRX8392413	SRA1003130	DVE-1_input_(hda-1)_rep1;_Caenorhabditis_elegans;_ChIP-Seq	DVE-1_input_(hda-1)_rep1;_Caenorhabditis_elegan...	none|DVE-1_input (hda-1)	none	dve-1p::dve-1::gfp; glp-4(bn2)|DVE-1_input (hda-1)|Day1 of adulthood	dve-1p::dve-1::gfp; gl...	ChIP-Seq
SRX8392414	SRA1003130	DVE-1_input_(hda-1)_rep2;_Caenorhabditis_elegans;_ChIP-Seq	DVE-1_input_(hda-1)_rep2;_Caenorhabditis_elegan...	none|DVE-1_input (hda-1)	none	dve-1p::dve-1::gfp; glp-4(bn2)|DVE-1_input (hda-1)|Day1 of adulthood	dve-1p::dve-1::gfp; gl...	ChIP-Seq
SRX8392415	SRA1003130	DVE-1_input_(hda-1+atp-2)_rep1;_Caenorhabditis_elegans;_ChIP-Seq	DVE-1_input_(hda-1+atp-2)_rep1;_Caenorhabditis_...	none|DVE-1_input (hda-1+atp-2)	none	dve-1p::dve-1::gfp; glp-4(bn2)|DVE-1_input (hda-1+atp-2)|Day1 of adulthood	dve-1p::dve-1::gfp; gl...	ChIP-Seq
SRX8392416	SRA1003130	DVE-1_input_(hda-1+atp-2)_rep2;_Caenorhabditis_elegans;_ChIP-Seq	DVE-1_input_(hda-1+atp-2)_rep2;_Caenorhabditis_...	none|DVE-1_input (hda-1+atp-2)	none	dve-1p::dve-1::gfp; glp-4(bn2)|DVE-1_input (hda-1+atp-2)|Day1 of adulthood	dve-1p::dve-1::gfp; gl...	ChIP-Seq
SRX8392417	SRA1003130	DVE-1_ChIP_(hda-1)_rep1;_Caenorhabditis_elegans;_ChIP-Seq	DVE-1_ChIP_(hda-1)_rep1;_Caenorhabditis_elegans...	GFP agarose (ChromoTek, gta-20)|DVE-1_ChIP (hda-1)	GFP agarose (ChromoTek...	dve-1p::dve-1::gfp; glp-4(bn2)|DVE-1_ChIP (hda-1)|Day1 of adulthood	dve-1p::dve-1::gfp; gl...	ChIP-Seq
SRX8392418	SRA1003130	DVE-1_ChIP_(hda-1)_rep2;_Caenorhabditis_elegans;_ChIP-Seq	DVE-1_ChIP_(hda-1)_rep2;_Caenorhabditis_elegans...	GFP agarose (ChromoTek, gta-20)|DVE-1_ChIP (hda-1)	GFP agarose (ChromoTek...	dve-1p::dve-1::gfp; glp-4(bn2)|DVE-1_ChIP (hda-1)|Day1 of adulthood	dve-1p::dve-1::gfp; gl...	ChIP-Seq
SRX8392419	SRA1003130	DVE-1_ChIP_(hda-1+atp-2)_rep1;_Caenorhabditis_elegans;_ChIP-Seq	DVE-1_ChIP_(hda-1+atp-2)_rep1;_Caenorhabditis_e...	GFP agarose (ChromoTek, gta-20)|DVE-1_ChIP (hda-1+atp-2)	GFP agarose (ChromoTek...	dve-1p::dve-1::gfp; glp-4(bn2)|DVE-1_ChIP (hda-1+atp-2)|Day1 of adulthood	dve-1p::dve-1::gfp; gl...	ChIP-Seq
SRX8392420	SRA1003130	DVE-1_ChIP_(hda-1+atp-2)_rep2;_Caenorhabditis_elegans;_ChIP-Seq	DVE-1_ChIP_(hda-1+atp-2)_rep2;_Caenorhabditis_e...	GFP agarose (ChromoTek, gta-20)|DVE-1_ChIP (hda-1+atp-2)	GFP agarose (ChromoTek...	dve-1p::dve-1::gfp; glp-4(bn2)|DVE-1_ChIP (hda-1+atp-2)|Day1 of adulthood	dve-1p::dve-1::gfp; gl...	ChIP-Seq
SRX8392421	SRA1003130	HDA-1_input_(dve-1)_rep1;_Caenorhabditis_elegans;_ChIP-Seq	HDA-1_input_(dve-1)_rep1;_Caenorhabditis_elegan...	none|HDA-1_input (dve-1)	none	hda-1p::hda-1::gfp; glp-4(bn2)|HDA-1_input (dve-1)|Day1 of adulthood	hda-1p::hda-1::gfp; gl...	ChIP-Seq
SRX8392422	SRA1003130	HDA-1_input_(dve-1)_rep2;_Caenorhabditis_elegans;_ChIP-Seq	HDA-1_input_(dve-1)_rep2;_Caenorhabditis_elegan...	none|HDA-1_input (dve-1)	none	hda-1p::hda-1::gfp; glp-4(bn2)|HDA-1_input (dve-1)|Day1 of adulthood	hda-1p::hda-1::gfp; gl...	ChIP-Seq
SRX8392423	SRA1003130	HDA-1_input_(dve-1)_rep3;_Caenorhabditis_elegans;_ChIP-Seq	HDA-1_input_(dve-1)_rep3;_Caenorhabditis_elegan...	none|HDA-1_input (dve-1)	none	hda-1p::hda-1::gfp; glp-4(bn2)|HDA-1_input (dve-1)|Day1 of adulthood	hda-1p::hda-1::gfp; gl...	ChIP-Seq
SRX8392424	SRA1003130	HDA-1_input_(dve-1+atp-2)_rep1;_Caenorhabditis_elegans;_ChIP-Seq	HDA-1_input_(dve-1+atp-2)_rep1;_Caenorhabditis_...	none|HDA-1_input (dve-1+atp-2)	none	hda-1p::hda-1::gfp; glp-4(bn2)|HDA-1_input (dve-1+atp-2)|Day1 of adulthood	hda-1p::hda-1::gfp; gl...	ChIP-Seq
SRX8392425	SRA1003130	HDA-1_input_(dve-1+atp-2)_rep2;_Caenorhabditis_elegans;_ChIP-Seq	HDA-1_input_(dve-1+atp-2)_rep2;_Caenorhabditis_...	none|HDA-1_input (dve-1+atp-2)	none	hda-1p::hda-1::gfp; glp-4(bn2)|HDA-1_input (dve-1+atp-2)|Day1 of adulthood	hda-1p::hda-1::gfp; gl...	ChIP-Seq
SRX8392426	SRA1003130	HDA-1_input_(dve-1+atp-2)_rep3;_Caenorhabditis_elegans;_ChIP-Seq	HDA-1_input_(dve-1+atp-2)_rep3;_Caenorhabditis_...	none|HDA-1_input (dve-1+atp-2)	none	hda-1p::hda-1::gfp; glp-4(bn2)|HDA-1_input (dve-1+atp-2)|Day1 of adulthood	hda-1p::hda-1::gfp; gl...	ChIP-Seq
SRX8392427	SRA1003130	HDA-1_ChIP_(dve-1)_rep1;_Caenorhabditis_elegans;_ChIP-Seq	HDA-1_ChIP_(dve-1)_rep1;_Caenorhabditis_elegans...	GFP agarose (ChromoTek, gta-20)|HDA-1_ChIP (dve-1)	GFP agarose (ChromoTek...	hda-1p::hda-1::gfp; glp-4(bn2)|HDA-1_ChIP (dve-1)|Day1 of adulthood	hda-1p::hda-1::gfp; gl...	ChIP-Seq
SRX8392428	SRA1003130	HDA-1_ChIP_(dve-1)_rep2;_Caenorhabditis_elegans;_ChIP-Seq	HDA-1_ChIP_(dve-1)_rep2;_Caenorhabditis_elegans...	GFP agarose (ChromoTek, gta-20)|HDA-1_ChIP (dve-1)	GFP agarose (ChromoTek...	hda-1p::hda-1::gfp; glp-4(bn2)|HDA-1_ChIP (dve-1)|Day1 of adulthood	hda-1p::hda-1::gfp; gl...	ChIP-Seq
SRX8392429	SRA1003130	HDA-1_ChIP_(dve-1)_rep3;_Caenorhabditis_elegans;_ChIP-Seq	HDA-1_ChIP_(dve-1)_rep3;_Caenorhabditis_elegans...	GFP agarose (ChromoTek, gta-20)|HDA-1_ChIP (dve-1)	GFP agarose (ChromoTek...	hda-1p::hda-1::gfp; glp-4(bn2)|HDA-1_ChIP (dve-1)|Day1 of adulthood	hda-1p::hda-1::gfp; gl...	ChIP-Seq
SRX8392430	SRA1003130	HDA-1_ChIP_(dve-1+atp-2)_rep1;_Caenorhabditis_elegans;_ChIP-Seq	HDA-1_ChIP_(dve-1+atp-2)_rep1;_Caenorhabditis_e...	GFP agarose (ChromoTek, gta-20)|HDA-1_ChIP (dve-1+atp-2)	GFP agarose (ChromoTek...	hda-1p::hda-1::gfp; glp-4(bn2)|HDA-1_ChIP (dve-1+atp-2)|Day1 of adulthood	hda-1p::hda-1::gfp; gl...	ChIP-Seq
SRX8392431	SRA1003130	HDA-1_ChIP_(dve-1+atp-2)_rep2;_Caenorhabditis_elegans;_ChIP-Seq	HDA-1_ChIP_(dve-1+atp-2)_rep2;_Caenorhabditis_e...	GFP agarose (ChromoTek, gta-20)|HDA-1_ChIP (dve-1+atp-2)	GFP agarose (ChromoTek...	hda-1p::hda-1::gfp; glp-4(bn2)|HDA-1_ChIP (dve-1+atp-2)|Day1 of adulthood	hda-1p::hda-1::gfp; gl...	ChIP-Seq
SRX8392432	SRA1003130	HDA-1_ChIP_(dve-1+atp-2)_rep3;_Caenorhabditis_elegans;_ChIP-Seq	HDA-1_ChIP_(dve-1+atp-2)_rep3;_Caenorhabditis_e...	GFP agarose (ChromoTek, gta-20)|HDA-1_ChIP (dve-1+atp-2)	GFP agarose (ChromoTek...	hda-1p::hda-1::gfp; glp-4(bn2)|HDA-1_ChIP (dve-1+atp-2)|Day1 of adulthood	hda-1p::hda-1::gfp; gl...	ChIP-Seq
SRX958294	SRA247147	H3K9me2_ChIPseq_fer-1;him-8_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me2_ChIPseq_fer-1;him-8_rep1;_Caenorhabditi...	H3K9me2 (Abcam ab1220, lot#GR98362-1, 0.8mg/ml)|whole animal	H3K9me2 (Abcam ab1220,...	whole animal|whole animal|adult	whole animal	ChIP-Seq
SRX958295	SRA247147	H3K9me2_ChIPseq_fer-1;him-8_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me2_ChIPseq_fer-1;him-8_rep2;_Caenorhabditi...	H3K9me2 (Abcam ab1220, lot#GR98362-1, 0.8mg/ml)|whole animal	H3K9me2 (Abcam ab1220,...	whole animal|whole animal|adult	whole animal	ChIP-Seq
SRX958296	SRA247147	H3K9me2_ChIPseq_fer-1_rep1;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me2_ChIPseq_fer-1_rep1;_Caenorhabditis_eleg...	H3K9me2 (Abcam ab1220, lot#GR98362-1, 0.8mg/ml)|whole animal	H3K9me2 (Abcam ab1220,...	whole animal|whole animal|adult	whole animal	ChIP-Seq
SRX958297	SRA247147	H3K9me2_ChIPseq_fer-1_rep2;_Caenorhabditis_elegans;_ChIP-Seq	H3K9me2_ChIPseq_fer-1_rep2;_Caenorhabditis_eleg...	H3K9me2 (Abcam ab1220, lot#GR98362-1, 0.8mg/ml)|whole animal	H3K9me2 (Abcam ab1220,...	whole animal|whole animal|adult	whole animal	ChIP-Seq
SRX958298	SRA247147	Input_DNA;_Caenorhabditis_elegans;_ChIP-Seq	Input_DNA;_Caenorhabditis_elegans;_ChIP-Seq	none|whole animal	none	whole animal|whole animal|adult	whole animal	ChIP-Seq
SRX982060	SRA250443	DPY27_CB428_MxEmb_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	DPY27_CB428_MxEmb_Rep1_ChIPSeq;_Caenorhabditis_...	DPY-27 JL00001 Rabbit polyclonal to 1-409 aa. (Ercan et al. Nat Genet. 2007) is against the antigen 1-409 aa|whole worms	DPY-27 JL00001 Rabbit ...	CB428|whole worms|embryo	CB428	ChIP-Seq
SRX982061	SRA250443	DPY27_CB428_MxEmb_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	DPY27_CB428_MxEmb_Rep2_ChIPSeq;_Caenorhabditis_...	DPY-27 JL00001 Rabbit polyclonal to 1-409 aa. (Ercan et al. Nat Genet. 2007) is against the antigen 1-409 aa|whole worms	DPY-27 JL00001 Rabbit ...	CB428|whole worms|embryo	CB428	ChIP-Seq
SRX982062	SRA250443	DPY27_CB428_MxEmb_Rep3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	DPY27_CB428_MxEmb_Rep3_ChIPSeq;_Caenorhabditis_...	DPY-27 JL00001 Rabbit polyclonal to 1-409 aa. (Ercan et al. Nat Genet. 2007) is against the antigen 1-409 aa|whole worms	DPY-27 JL00001 Rabbit ...	CB428|whole worms|embryo	CB428	ChIP-Seq
SRX982063	SRA250443	DPY27_SET4_MxEmb_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	DPY27_SET4_MxEmb_Rep1_ChIPSeq;_Caenorhabditis_e...	DPY-27 JL00001 Rabbit polyclonal to 1-409 aa. (Ercan et al. Nat Genet. 2007) is against the antigen 1-409 aa|whole worms	DPY-27 JL00001 Rabbit ...	MT14911|whole worms|embryo	MT14911	ChIP-Seq
SRX982064	SRA250443	DPY27_SET4_MxEmb_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	DPY27_SET4_MxEmb_Rep2_ChIPSeq;_Caenorhabditis_e...	DPY-27 JL00001 Rabbit polyclonal to 1-409 aa. (Ercan et al. Nat Genet. 2007) is against the antigen 1-409 aa|whole worms	DPY-27 JL00001 Rabbit ...	MT14911|whole worms|embryo	MT14911	ChIP-Seq
SRX982065	SRA250443	DPY27_N2_L3_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	DPY27_N2_L3_Rep1_ChIPSeq;_Caenorhabditis_elegan...	DPY-27 JL00001 Rabbit polyclonal to 1-409 aa. (Ercan et al. Nat Genet. 2007) is against the antigen 1-409 aa|whole worms	DPY-27 JL00001 Rabbit ...	N2|whole worms|L3	N2	ChIP-Seq
SRX982066	SRA250443	DPY27_N2_L3_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	DPY27_N2_L3_Rep2_ChIPSeq;_Caenorhabditis_elegan...	DPY-27 JL00001 Rabbit polyclonal to 1-409 aa. (Ercan et al. Nat Genet. 2007) is against the antigen 1-409 aa|whole worms	DPY-27 JL00001 Rabbit ...	N2|whole worms|L3	N2	ChIP-Seq
SRX982067	SRA250443	DPY27_N2_YA_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	DPY27_N2_YA_Rep1_ChIPSeq;_Caenorhabditis_elegan...	DPY-27 JL00001 Rabbit polyclonal to 1-409 aa. (Ercan et al. Nat Genet. 2007) is against the antigen 1-409 aa|whole worms	DPY-27 JL00001 Rabbit ...	N2|whole worms|YA	N2	ChIP-Seq
SRX982068	SRA250443	DPY27_N2_YA_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	DPY27_N2_YA_Rep2_ChIPSeq;_Caenorhabditis_elegan...	DPY-27 JL00001 Rabbit polyclonal to 1-409 aa. (Ercan et al. Nat Genet. 2007) is against the antigen 1-409 aa|whole worms	DPY-27 JL00001 Rabbit ...	N2|whole worms|YA	N2	ChIP-Seq
SRX982069	SRA250443	H4K20me1_N2_MxEmb_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H4K20me1_N2_MxEmb_Rep1_ChIPSeq;_Caenorhabditis_...	H4K20me1 Abcam (ab9051)|whole worms	H4K20me1 Abcam (ab9051)	N2|whole worms|embryo	N2	ChIP-Seq
SRX982070	SRA250443	H4K20me1_N2_MxEmb_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H4K20me1_N2_MxEmb_Rep2_ChIPSeq;_Caenorhabditis_...	H4K20me1 Abcam (ab9051)|whole worms	H4K20me1 Abcam (ab9051)	N2|whole worms|embryo	N2	ChIP-Seq
SRX982071	SRA250443	H4K20me1_N2_MxEmb_Rep3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H4K20me1_N2_MxEmb_Rep3_ChIPSeq;_Caenorhabditis_...	H4K20me1 Abcam (ab9051)|whole worms	H4K20me1 Abcam (ab9051)	N2|whole worms|embryo	N2	ChIP-Seq
SRX982072	SRA250443	H4K20me1_CB428_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H4K20me1_CB428_Rep1_ChIPSeq;_Caenorhabditis_ele...	H4K20me1 Abcam (ab9051)|whole worms	H4K20me1 Abcam (ab9051)	CB428|whole worms|embryo	CB428	ChIP-Seq
SRX982073	SRA250443	H4K20me1_CB428_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H4K20me1_CB428_Rep2_ChIPSeq;_Caenorhabditis_ele...	H4K20me1 Abcam (ab9051)|whole worms	H4K20me1 Abcam (ab9051)	CB428|whole worms|embryo	CB428	ChIP-Seq
SRX982074	SRA250443	H4K20me1_CB428_Rep3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H4K20me1_CB428_Rep3_ChIPSeq;_Caenorhabditis_ele...	H4K20me1 Abcam (ab9051)|whole worms	H4K20me1 Abcam (ab9051)	CB428|whole worms|embryo	CB428	ChIP-Seq
SRX982075	SRA250443	H4K20me1_SET4_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H4K20me1_SET4_Rep1_ChIPSeq;_Caenorhabditis_eleg...	H4K20me1 Abcam (ab9051)|whole worms	H4K20me1 Abcam (ab9051)	MT14911|whole worms|embryo	MT14911	ChIP-Seq
SRX982076	SRA250443	H4K20me1_SET4_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H4K20me1_SET4_Rep2_ChIPSeq;_Caenorhabditis_eleg...	H4K20me1 Abcam (ab9051)|whole worms	H4K20me1 Abcam (ab9051)	MT14911|whole worms|embryo	MT14911	ChIP-Seq
SRX982077	SRA250443	H4K20me1_SET4_Rep3_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H4K20me1_SET4_Rep3_ChIPSeq;_Caenorhabditis_eleg...	H4K20me1 Abcam (ab9051)|whole worms	H4K20me1 Abcam (ab9051)	MT14911|whole worms|embryo	MT14911	ChIP-Seq
SRX982078	SRA250443	H4K20me1_N2_L3_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H4K20me1_N2_L3_Rep1_ChIPSeq;_Caenorhabditis_ele...	H4K20me1 Abcam (ab9051)|whole worms	H4K20me1 Abcam (ab9051)	N2|whole worms|L3	N2	ChIP-Seq
SRX982079	SRA250443	H4K20me1_N2_L3_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H4K20me1_N2_L3_Rep2_ChIPSeq;_Caenorhabditis_ele...	H4K20me1 Abcam (ab9051)|whole worms	H4K20me1 Abcam (ab9051)	N2|whole worms|L3	N2	ChIP-Seq
SRX982080	SRA250443	H4K20me1_CB428_L3_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H4K20me1_CB428_L3_Rep1_ChIPSeq;_Caenorhabditis_...	H4K20me1 Abcam (ab9051)|whole worms	H4K20me1 Abcam (ab9051)	CB428|whole worms|L3	CB428	ChIP-Seq
SRX982081	SRA250443	H4K20me1_CB428_L3_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H4K20me1_CB428_L3_Rep2_ChIPSeq;_Caenorhabditis_...	H4K20me1 Abcam (ab9051)|whole worms	H4K20me1 Abcam (ab9051)	CB428|whole worms|L3	CB428	ChIP-Seq
SRX982082	SRA250443	H4K20me1_SET4_L3_Rep1_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H4K20me1_SET4_L3_Rep1_ChIPSeq;_Caenorhabditis_e...	H4K20me1 Abcam (ab9051)|whole worms	H4K20me1 Abcam (ab9051)	MT14911|whole worms|L3	MT14911	ChIP-Seq
SRX982083	SRA250443	H4K20me1_SET4_L3_Rep2_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H4K20me1_SET4_L3_Rep2_ChIPSeq;_Caenorhabditis_e...	H4K20me1 Abcam (ab9051)|whole worms	H4K20me1 Abcam (ab9051)	MT14911|whole worms|L3	MT14911	ChIP-Seq
SRX982084	SRA250443	H4K20me1_N2_MxEmb_Rep1_spike-in_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H4K20me1_N2_MxEmb_Rep1_spike-in_ChIPSeq;_Caenor...	H4K20me1 Abcam (ab9051)|whole worms	H4K20me1 Abcam (ab9051)	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX982085	SRA250443	H4K20me1_SET4_MxEmb_Rep1_spike-in_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H4K20me1_SET4_MxEmb_Rep1_spike-in_ChIPSeq;_Caen...	H4K20me1 Abcam (ab9051)|whole worms	H4K20me1 Abcam (ab9051)	MT14911|whole worms|mixed embryo	MT14911	ChIP-Seq
SRX982086	SRA250443	H4K20me1_N2_L3_Rep1_spike-in_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H4K20me1_N2_L3_Rep1_spike-in_ChIPSeq;_Caenorhab...	H4K20me1 Abcam (ab9051)|whole worms	H4K20me1 Abcam (ab9051)	N2|whole worms|L3	N2	ChIP-Seq
SRX982087	SRA250443	H4K20me1_SET4_L3_Rep1_spike-in_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H4K20me1_SET4_L3_Rep1_spike-in_ChIPSeq;_Caenorh...	H4K20me1 Abcam (ab9051)|whole worms	H4K20me1 Abcam (ab9051)	MT14911|whole worms|L3	MT14911	ChIP-Seq
SRX982088	SRA250443	H4K20me1_SET4_L3_Rep2_spike-in_ChIPSeq;_Caenorhabditis_elegans;_ChIP-Seq	H4K20me1_SET4_L3_Rep2_spike-in_ChIPSeq;_Caenorh...	H4K20me1 Abcam (ab9051)|whole worms	H4K20me1 Abcam (ab9051)	MT14911|whole worms|L3	MT14911	ChIP-Seq
SRX982089	SRA250443	Input_CB428_MxEmb_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Input_CB428_MxEmb_Rep1;_Caenorhabditis_elegans;...	none (input)|whole worms	none (input)	CB428|whole worms|mixed embryo	CB428	ChIP-Seq
SRX982090	SRA250443	Input_CB428_MxEmb_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Input_CB428_MxEmb_Rep2;_Caenorhabditis_elegans;...	none (input)|whole worms	none (input)	CB428|whole worms|mixed embryo	CB428	ChIP-Seq
SRX982091	SRA250443	Input_CB428_MxEmb_Rep3;_Caenorhabditis_elegans;_ChIP-Seq	Input_CB428_MxEmb_Rep3;_Caenorhabditis_elegans;...	none (input)|whole worms	none (input)	CB428|whole worms|mixed embryo	CB428	ChIP-Seq
SRX982092	SRA250443	Input_SET4_MxEmb_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Input_SET4_MxEmb_Rep1;_Caenorhabditis_elegans;_...	none (input)|whole worms	none (input)	MT14911|whole worms|mixed embryo	MT14911	ChIP-Seq
SRX982093	SRA250443	Input_SET4_MxEmb_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Input_SET4_MxEmb_Rep2;_Caenorhabditis_elegans;_...	none (input)|whole worms	none (input)	MT14911|whole worms|mixed embryo	MT14911	ChIP-Seq
SRX982094	SRA250443	Input_N2_L3_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Input_N2_L3_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	none (input)|whole worms	none (input)	N2|whole worms|L3	N2	ChIP-Seq
SRX982095	SRA250443	Input_N2_L3_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Input_N2_L3_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	none (input)|whole worms	none (input)	N2|whole worms|L3	N2	ChIP-Seq
SRX982096	SRA250443	Input_N2_YA_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Input_N2_YA_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	none (input)|whole worms	none (input)	N2|whole worms|YA	N2	ChIP-Seq
SRX982097	SRA250443	GSM1111824_input_N2_embryo;_Caenorhabditis_elegans;_ChIP-Seq	GSM1111824_input_N2_embryo;_Caenorhabditis_eleg...	none (input)|whole worms	none (input)	N2|whole worms|embryo	N2	ChIP-Seq
SRX982098	SRA250443	Input_N2_MxEmb_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Input_N2_MxEmb_Rep1;_Caenorhabditis_elegans;_Ch...	none (input)|whole worms	none (input)	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX982099	SRA250443	Input_N2_MxEmb_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Input_N2_MxEmb_Rep2;_Caenorhabditis_elegans;_Ch...	none (input)|whole worms	none (input)	N2|whole worms|mixed embryo	N2	ChIP-Seq
SRX982100	SRA250443	Input_SET4_MxEmb_Rep3;_Caenorhabditis_elegans;_ChIP-Seq	Input_SET4_MxEmb_Rep3;_Caenorhabditis_elegans;_...	none (input)|whole worms	none (input)	MT14911|whole worms|mixed embryo	MT14911	ChIP-Seq
SRX982101	SRA250443	Input_N2_L3_Rep3;_Caenorhabditis_elegans;_ChIP-Seq	Input_N2_L3_Rep3;_Caenorhabditis_elegans;_ChIP-Seq	none (input)|whole worms	none (input)	N2|whole worms|L3	N2	ChIP-Seq
SRX982102	SRA250443	Input_N2_L3_Rep4;_Caenorhabditis_elegans;_ChIP-Seq	Input_N2_L3_Rep4;_Caenorhabditis_elegans;_ChIP-Seq	none (input)|whole worms	none (input)	N2|whole worms|L3	N2	ChIP-Seq
SRX982103	SRA250443	Input_CB428_L3_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Input_CB428_L3_Rep1;_Caenorhabditis_elegans;_Ch...	none (input)|whole worms	none (input)	CB428|whole worms|L3	CB428	ChIP-Seq
SRX982104	SRA250443	Input_CB428_L3_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Input_CB428_L3_Rep2;_Caenorhabditis_elegans;_Ch...	none (input)|whole worms	none (input)	CB428|whole worms|L3	CB428	ChIP-Seq
SRX982105	SRA250443	Input_SET4_L3_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Input_SET4_L3_Rep1;_Caenorhabditis_elegans;_ChI...	none (input)|whole worms	none (input)	MT14911|whole worms|L3	MT14911	ChIP-Seq
SRX982106	SRA250443	Input_SET4_L3_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Input_SET4_L3_Rep2;_Caenorhabditis_elegans;_ChI...	none (input)|whole worms	none (input)	MT14911|whole worms|L3	MT14911	ChIP-Seq
SRX982107	SRA250443	Input_N2_embryo_spikein_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Input_N2_embryo_spikein_Rep1;_Caenorhabditis_el...	none (input)|whole worms	none (input)	N2|whole worms|embryo	N2	ChIP-Seq
SRX982108	SRA250443	Input_SET4_embryo_spikein_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Input_SET4_embryo_spikein_Rep1;_Caenorhabditis_...	none (input)|whole worms	none (input)	MT14911|whole worms|embryo	MT14911	ChIP-Seq
SRX982109	SRA250443	Input_N2_L3_spikein_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Input_N2_L3_spikein_Rep1;_Caenorhabditis_elegan...	none (input)|whole worms	none (input)	N2|whole worms|L3	N2	ChIP-Seq
SRX982110	SRA250443	Input_SET4_L3_spikein_Rep1;_Caenorhabditis_elegans;_ChIP-Seq	Input_SET4_L3_spikein_Rep1;_Caenorhabditis_eleg...	none (input)|whole worms	none (input)	MT14911|whole worms|L3	MT14911	ChIP-Seq
SRX982111	SRA250443	Input_SET4_L3_spikein_Rep2;_Caenorhabditis_elegans;_ChIP-Seq	Input_SET4_L3_spikein_Rep2;_Caenorhabditis_eleg...	none (input)|whole worms	none (input)	MT14911|whole worms|L3	MT14911	ChIP-Seq
SRX997747	SRA209031	DAF-16_chip_wild-type_(N2);_Caenorhabditis_elegans;_ChIP-Seq	DAF-16_chip_wild-type_(N2);_Caenorhabditis_eleg...	mix stage culture	mix stage culture	mix stage culture|Mix Culture	mix stage culture	ChIP-Seq
SRX997748	SRA209031	DAF-16_input_wild-type_(N2);_Caenorhabditis_elegans;_ChIP-Seq	DAF-16_input_wild-type_(N2);_Caenorhabditis_ele...	mix stage culture	mix stage culture	mix stage culture|Mix Culture	mix stage culture	ChIP-Seq
SRX997749	SRA209031	DAF-16_chip_daf-16(-);daf-2(-);_Caenorhabditis_elegans;_ChIP-Seq	DAF-16_chip_daf-16(-);daf-2(-);_Caenorhabditis_...	mix stage culture	mix stage culture	mix stage culture|Mix Culture	mix stage culture	ChIP-Seq
SRX997750	SRA209031	DAF-16_input_daf-16(-);daf-2(-);_Caenorhabditis_elegans;_ChIP-Seq	DAF-16_input_daf-16(-);daf-2(-);_Caenorhabditis...	mix stage culture	mix stage culture	mix stage culture|Mix Culture	mix stage culture	ChIP-Seq
SRX997751	SRA209031	DAF-16_chip_daf-16(-);_Caenorhabditis_elegans;_ChIP-Seq	DAF-16_chip_daf-16(-);_Caenorhabditis_elegans;_...	mix stage culture	mix stage culture	mix stage culture|Mix Culture	mix stage culture	ChIP-Seq
SRX997752	SRA209031	DAF-16_input_daf-16(-);_Caenorhabditis_elegans;_ChIP-Seq	DAF-16_input_daf-16(-);_Caenorhabditis_elegans;...	mix stage culture	mix stage culture	mix stage culture|Mix Culture	mix stage culture	ChIP-Seq