MTD mzTab-version 1.0 MTD mzTab-mode Complete MTD mzTab-type Identification MTD description 120118ry_201B7-32_JPST000081 MTD ms_run[1]-location D:\JobRequest\ResultFiles\20191003\20191003151125701841^10.242.103.245^taba@jp\Psearch.ProteinPilotExecV5\120118ry_201B7-32_1_1.pilotFin.txt MTD software[1] [MS, MS:1000663, ProteinPilot, 5.0.0.0, 4767] MTD software[1]-setting FASTA=sprot_human_20181121.fasta MTD software[1]-setting PARAGON_VERSION=5.0.0.0, 4767 MTD software[1]-setting UI_SAMPLE_TYPE=Identification MTD software[1]-setting UI_CYS_ALKYLATION=Iodoacetamide MTD software[1]-setting UI_DIGESTION=Trypsin + Lys C MTD software[1]-setting UI_INSTRUMENT=TripleTOF 5600 MTD software[1]-setting UI_SEARCH_EFFORT=Thorough MTD software[1]-setting UI_ID_FOCUS=Biological modifications MTD software[1]-setting UI_MIN_UNUSED_PROTSCORE=0.0458 MTD software[1]-setting MSTOLERANCE=0.05 MTD software[1]-setting MSTOLERANCE_U=Daltons MTD software[1]-setting MSMSTOLERANCE=0.1 MTD software[1]-setting MSMSTOLERANCE_U=Daltons MTD software[2] [MS, MS:1001207, Mascot, 2.6.1] MTD software[2]-setting DB=sprot_human_mix MTD software[2]-setting DTAXONOMYB=All entries MTD software[2]-setting CLE=Trypsin+Lys-C MTD software[2]-setting MODS=Carbamidomethyl (C) MTD software[2]-setting IT_MODS=Oxidation (M) MTD software[2]-setting CHARGE=2+ and 3+ MTD software[2]-setting TOL=20 MTD software[2]-setting TOLU=ppm MTD software[2]-setting ITOL=0.1 MTD software[2]-setting ITOLU=Da MTD software[2]-setting PEP_ISOTOPE_ERRORLE=0 MTD software[2]-setting PFA=1 MTD software[2]-setting MASS=Monoisotopic MTD software[2]-setting INSTRUMENT=ESI-QUAD-TOF MTD software[3] [MS, MS:1001476, X!Tandem, 2015.04.01.1] MTD software[3]-setting DB=userFasta.sprot_human_mix_20181121 MTD software[3]-setting CLE=[R]|{P},[K]|{} MTD software[3]-setting MODS=Carbamidomethyl (C) MTD software[3]-setting IT_MODS=Oxidation (M) MTD software[3]-setting TOL(-)=20 MTD software[3]-setting TOL(+)=20 MTD software[3]-setting TOLU=ppm MTD software[3]-setting ITOL=0.1 MTD software[3]-setting ITOLU=Daltons MTD software[3]-setting PEP_ISOTOPE_ERROR=yes MTD software[3]-setting PFA=1 MTD software[4] [MS, MS:1002251, Comet, 2015.02 rev. 0] MTD software[4]-setting Taxon=userFasta.sprot_human_mix_20181121 MTD software[4]-setting search_enzyme_number=2 MTD software[4]-setting FixMod=Carbamidomethyl (C) MTD software[4]-setting VarMod=Oxidation (M) MTD software[4]-setting max_variable_mods_in_peptide=5 MTD software[4]-setting allowed_missed_cleavage=1 MTD software[4]-setting peptide_mass_tolerance=20 MTD software[4]-setting peptide_mass_units=2 MTD software[4]-setting fragment_bin_tol=0.02 MTD software[4]-setting fragment_bin_offset=0.0 MTD fixed_mod[1] [UNIMOD, UNIMOD:4, Carbamidomethyl,] MTD fixed_mod[1]-site C MTD fixed_mod[1]-position Anywhere MTD variable_mod[1] [UNIMOD, UNIMOD:35, Oxidation,] MTD variable_mod[1]-site M MTD variable_mod[1]-position Anywhere MTD protein_search_engine_score[1] [http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore] MTD psm_search_engine_score[1] [http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore] PRH accession description taxid species database database_version search_engine best_search_engine_score[1] ambiguity_members modifications protein_coverage search_engine_score[1]_ms_run[1] num_psms_ms_run[1] num_peptides_distinct_ms_run[1] num_peptides_unique_ms_run[1] PRT sp|P51991|ROA3_HUMAN Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ] 53.0 null 196-UNIMOD:4,1-UNIMOD:1 0.24 53.0 15 6 2 PRT sp|Q92945|FUBP2_HUMAN Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 44.0 null 0.12 44.0 8 5 3 PRT sp|P14866|HNRPL_HUMAN Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 43.0 null 151-UNIMOD:4,452-UNIMOD:4,581-UNIMOD:4 0.20 43.0 13 6 4 PRT sp|P60709|ACTB_HUMAN Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ] 41.0 null 217-UNIMOD:4,44-UNIMOD:35,47-UNIMOD:35,360-UNIMOD:28,325-UNIMOD:35 0.23 41.0 45 7 1 PRT sp|P17096|HMGA1_HUMAN High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 41.0 null 0.24 41.0 27 2 0 PRT sp|O43670-2|ZN207_HUMAN Isoform 2 of BUB3-interacting and GLEBS motif-containing protein ZNF207 OS=Homo sapiens OX=9606 GN=ZNF207 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 41.0 null 0.05 41.0 2 2 2 PRT sp|P09651-2|ROA1_HUMAN Isoform A1-A of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 41.0 null 175-UNIMOD:4 0.28 41.0 16 6 2 PRT sp|P35637|FUS_HUMAN RNA-binding protein FUS OS=Homo sapiens OX=9606 GN=FUS PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 41.0 null 0.05 41.0 2 1 0 PRT sp|P21333-2|FLNA_HUMAN Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 40.0 null 2535-UNIMOD:4,1018-UNIMOD:4,623-UNIMOD:4,631-UNIMOD:4,1157-UNIMOD:4,2574-UNIMOD:4 0.08 40.0 33 19 9 PRT sp|P29966|MARCS_HUMAN Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 40.0 null 0.36 40.0 20 7 2 PRT sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens OX=9606 GN=HCFC1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 40.0 null 0.01 40.0 1 1 1 PRT sp|P05783|K1C18_HUMAN Keratin, type I cytoskeletal 18 OS=Homo sapiens OX=9606 GN=KRT18 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ] 40.0 null 0.18 40.0 11 8 6 PRT sp|Q9BQA1|MEP50_HUMAN Methylosome protein 50 OS=Homo sapiens OX=9606 GN=WDR77 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 39.0 null 208-UNIMOD:4 0.20 39.0 2 2 2 PRT sp|P67809|YBOX1_HUMAN Nuclease-sensitive element-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 39.0 null 0.25 39.0 10 4 1 PRT sp|Q5T4S7-2|UBR4_HUMAN Isoform 2 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 39.0 null 3864-UNIMOD:4,4946-UNIMOD:4 0.01 39.0 3 3 3 PRT sp|Q15691|MARE1_HUMAN Microtubule-associated protein RP/EB family member 1 OS=Homo sapiens OX=9606 GN=MAPRE1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 38.0 null 0.07 38.0 2 1 0 PRT sp|P54727|RD23B_HUMAN UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 38.0 null 0.11 38.0 6 4 2 PRT sp|P18124|RL7_HUMAN 60S ribosomal protein L7 OS=Homo sapiens OX=9606 GN=RPL7 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 38.0 null 0.13 38.0 6 3 2 PRT sp|P80723|BASP1_HUMAN Brain acid soluble protein 1 OS=Homo sapiens OX=9606 GN=BASP1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 38.0 null 0.52 38.0 17 7 3 PRT sp|P30050-2|RL12_HUMAN Isoform 2 of 60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 38.0 null 17-UNIMOD:4 0.12 38.0 6 1 0 PRT sp|Q9P2E9|RRBP1_HUMAN Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1 PE=1 SV=5 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 37.0 null 0.09 37.0 12 10 8 PRT sp|P49006|MRP_HUMAN MARCKS-related protein OS=Homo sapiens OX=9606 GN=MARCKSL1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 37.0 null 0.08 37.0 6 1 0 PRT sp|O00264-2|PGRC1_HUMAN Isoform 2 of Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 37.0 null 0.22 37.0 3 2 1 PRT sp|O75367-3|H2AY_HUMAN Isoform 3 of Core histone macro-H2A.1 OS=Homo sapiens OX=9606 GN=H2AFY null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 36.0 null 296-UNIMOD:4 0.08 36.0 5 3 1 PRT sp|Q9UQE7|SMC3_HUMAN Structural maintenance of chromosomes protein 3 OS=Homo sapiens OX=9606 GN=SMC3 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 36.0 null 0.05 36.0 6 5 4 PRT sp|P52597|HNRPF_HUMAN Heterogeneous nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=HNRNPF PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 36.0 null 0.06 36.0 6 2 0 PRT sp|P15531-2|NDKA_HUMAN Isoform 2 of Nucleoside diphosphate kinase A OS=Homo sapiens OX=9606 GN=NME1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 36.0 null 0.08 36.0 2 1 0 PRT sp|P04264|K2C1_HUMAN Keratin, type II cytoskeletal 1 OS=Homo sapiens OX=9606 GN=KRT1 PE=1 SV=6 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 36.0 null 0.09 36.0 4 3 2 PRT sp|Q9UKY7|CDV3_HUMAN Protein CDV3 homolog OS=Homo sapiens OX=9606 GN=CDV3 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 36.0 null 0.19 36.0 1 1 1 PRT sp|P31943|HNRH1_HUMAN Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens OX=9606 GN=HNRNPH1 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 35.0 null 0.15 35.0 13 4 2 PRT sp|P06748-2|NPM_HUMAN Isoform 2 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 35.0 null 0.25 35.0 17 4 0 PRT sp|O60216|RAD21_HUMAN Double-strand-break repair protein rad21 homolog OS=Homo sapiens OX=9606 GN=RAD21 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 35.0 null 0.06 35.0 2 2 2 PRT sp|O95671-2|ASML_HUMAN Isoform 2 of N-acetylserotonin O-methyltransferase-like protein OS=Homo sapiens OX=9606 GN=ASMTL null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 35.0 null 258-UNIMOD:4,317-UNIMOD:4 0.06 35.0 3 3 3 PRT sp|Q9NZI8|IF2B1_HUMAN Insulin-like growth factor 2 mRNA-binding protein 1 OS=Homo sapiens OX=9606 GN=IGF2BP1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 35.0 null 253-UNIMOD:4,257-UNIMOD:4 0.15 35.0 15 7 2 PRT sp|Q9H9Z2|LN28A_HUMAN Protein lin-28 homolog A OS=Homo sapiens OX=9606 GN=LIN28A PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ] 35.0 null 2-UNIMOD:1,13-UNIMOD:4,139-UNIMOD:385,139-UNIMOD:4,142-UNIMOD:4 0.21 35.0 9 3 0 PRT sp|Q13618|CUL3_HUMAN Cullin-3 OS=Homo sapiens OX=9606 GN=CUL3 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 35.0 null 0.03 35.0 1 1 1 PRT sp|P25490|TYY1_HUMAN Transcriptional repressor protein YY1 OS=Homo sapiens OX=9606 GN=YY1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 35.0 null 0.05 35.0 1 1 1 PRT sp|O95182|NDUA7_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 OS=Homo sapiens OX=9606 GN=NDUFA7 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 35.0 null 0.17 35.0 1 1 1 PRT sp|P38646|GRP75_HUMAN Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 35.0 null 0.11 35.0 18 6 1 PRT sp|Q2Q1W2|LIN41_HUMAN E3 ubiquitin-protein ligase TRIM71 OS=Homo sapiens OX=9606 GN=TRIM71 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 35.0 null 212-UNIMOD:4,215-UNIMOD:4,220-UNIMOD:4,223-UNIMOD:4 0.03 35.0 2 2 2 PRT sp|P62888|RL30_HUMAN 60S ribosomal protein L30 OS=Homo sapiens OX=9606 GN=RPL30 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 35.0 null 85-UNIMOD:4 0.25 35.0 9 2 1 PRT sp|O95831|AIFM1_HUMAN Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=AIFM1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 35.0 null 256-UNIMOD:4 0.10 35.0 7 5 3 PRT sp|P14868|SYDC_HUMAN Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=DARS PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 35.0 null 130-UNIMOD:4 0.10 35.0 5 4 3 PRT sp|Q15102|PA1B3_HUMAN Platelet-activating factor acetylhydrolase IB subunit gamma OS=Homo sapiens OX=9606 GN=PAFAH1B3 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ],[MS, MS:1001207, Mascot, ] 35.0 null 2-UNIMOD:1,205-UNIMOD:4 0.19 35.0 5 3 1 PRT sp|O75533|SF3B1_HUMAN Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34.0 null 0.05 34.0 7 5 3 PRT sp|Q00610-2|CLH1_HUMAN Isoform 2 of Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34.0 null 870-UNIMOD:4,918-UNIMOD:4,617-UNIMOD:4 0.06 34.0 16 8 4 PRT sp|P02768|ALBU_HUMAN Serum albumin OS=Homo sapiens OX=9606 GN=ALB PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 34.0 null 591-UNIMOD:4,384-UNIMOD:4,385-UNIMOD:4,393-UNIMOD:4,384-UNIMOD:385,192-UNIMOD:4,193-UNIMOD:4,289-UNIMOD:4,77-UNIMOD:4,86-UNIMOD:4,111-UNIMOD:35,114-UNIMOD:4,115-UNIMOD:4,500-UNIMOD:4,501-UNIMOD:4,125-UNIMOD:4,99-UNIMOD:4,201-UNIMOD:4 0.27 34.0 77 17 3 PRT sp|Q9Y4L1|HYOU1_HUMAN Hypoxia up-regulated protein 1 OS=Homo sapiens OX=9606 GN=HYOU1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34.0 null 0.05 34.0 9 5 2 PRT sp|Q13409-2|DC1I2_HUMAN Isoform 2B of Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34.0 null 0.06 34.0 2 2 2 PRT sp|P0DN79|CBSL_HUMAN Cystathionine beta-synthase-like protein OS=Homo sapiens OX=9606 GN=CBSL PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34.0 null 15-UNIMOD:4 0.05 34.0 3 2 1 PRT sp|Q9GZL7|WDR12_HUMAN Ribosome biogenesis protein WDR12 OS=Homo sapiens OX=9606 GN=WDR12 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34.0 null 0.06 34.0 3 2 1 PRT sp|Q9P258|RCC2_HUMAN Protein RCC2 OS=Homo sapiens OX=9606 GN=RCC2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 34.0 null 337-UNIMOD:4 0.12 34.0 13 4 0 PRT sp|O75475|PSIP1_HUMAN PC4 and SFRS1-interacting protein OS=Homo sapiens OX=9606 GN=PSIP1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ] 34.0 null 101-UNIMOD:28 0.11 34.0 14 5 2 PRT sp|P04632|CPNS1_HUMAN Calpain small subunit 1 OS=Homo sapiens OX=9606 GN=CAPNS1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34.0 null 0.06 34.0 2 1 0 PRT sp|P45880-1|VDAC2_HUMAN Isoform 1 of Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens OX=9606 GN=VDAC2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34.0 null 62-UNIMOD:4 0.06 34.0 2 1 0 PRT sp|P29762|RABP1_HUMAN Cellular retinoic acid-binding protein 1 OS=Homo sapiens OX=9606 GN=CRABP1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34.0 null 96-UNIMOD:4 0.22 34.0 2 2 2 PRT sp|P0DMV8-2|HS71A_HUMAN Isoform 2 of Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34.0 null 0.05 34.0 3 2 1 PRT sp|P35580-3|MYH10_HUMAN Isoform 3 of Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34.0 null 1032-UNIMOD:4,844-UNIMOD:4 0.13 34.0 35 22 14 PRT sp|P17987|TCPA_HUMAN T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34.0 null 147-UNIMOD:4 0.09 34.0 9 5 2 PRT sp|Q9Y5S9|RBM8A_HUMAN RNA-binding protein 8A OS=Homo sapiens OX=9606 GN=RBM8A PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34.0 null 0.17 34.0 2 2 2 PRT sp|P14625|ENPL_HUMAN Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34.0 null 0.10 34.0 11 8 5 PRT sp|P05114|HMGN1_HUMAN Non-histone chromosomal protein HMG-14 OS=Homo sapiens OX=9606 GN=HMGN1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ] 34.0 null 0.35 34.0 3 2 1 PRT sp|P16401|H15_HUMAN Histone H1.5 OS=Homo sapiens OX=9606 GN=HIST1H1B PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ],[MS, MS:1001207, Mascot, ] 34.0 null 2-UNIMOD:1 0.13 34.0 13 2 0 PRT sp|P16104|H2AX_HUMAN Histone H2AX OS=Homo sapiens OX=9606 GN=H2AFX PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33.0 null 0.27 33.0 14 3 1 PRT sp|Q13151|ROA0_HUMAN Heterogeneous nuclear ribonucleoprotein A0 OS=Homo sapiens OX=9606 GN=HNRNPA0 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ] 33.0 null 1-UNIMOD:1,7-UNIMOD:4 0.13 33.0 7 3 1 PRT sp|P52926|HMGA2_HUMAN High mobility group protein HMGI-C OS=Homo sapiens OX=9606 GN=HMGA2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33.0 null 0.30 33.0 4 2 1 PRT sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens OX=9606 GN=TXNDC5 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33.0 null 121-UNIMOD:4,128-UNIMOD:4,381-UNIMOD:4 0.09 33.0 3 3 3 PRT sp|P35637-2|FUS_HUMAN Isoform Short of RNA-binding protein FUS OS=Homo sapiens OX=9606 GN=FUS null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33.0 null 0.06 33.0 3 2 1 PRT sp|Q9UBC3-8|DNM3B_HUMAN Isoform 8 of DNA (cytosine-5)-methyltransferase 3B OS=Homo sapiens OX=9606 GN=DNMT3B null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33.0 null 331-UNIMOD:4,373-UNIMOD:4,376-UNIMOD:4 0.04 33.0 5 2 0 PRT sp|P00367|DHE3_HUMAN Glutamate dehydrogenase 1, mitochondrial OS=Homo sapiens OX=9606 GN=GLUD1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33.0 null 0.07 33.0 5 3 1 PRT sp|P51858|HDGF_HUMAN Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33.0 null 108-UNIMOD:4 0.13 33.0 7 3 0 PRT sp|P31939-2|PUR9_HUMAN Isoform 2 of Bifunctional purine biosynthesis protein PURH OS=Homo sapiens OX=9606 GN=ATIC null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33.0 null 433-UNIMOD:4 0.12 33.0 8 5 3 PRT sp|Q96GM5-2|SMRD1_HUMAN Isoform 2 of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 OS=Homo sapiens OX=9606 GN=SMARCD1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33.0 null 0.07 33.0 2 2 2 PRT sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens OX=9606 GN=APOE PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33.0 null 0.15 33.0 10 5 2 PRT sp|P49321|NASP_HUMAN Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 33.0 null 254-UNIMOD:4 0.09 33.0 12 8 4 PRT sp|Q969G3-2|SMCE1_HUMAN Isoform 2 of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 OS=Homo sapiens OX=9606 GN=SMARCE1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33.0 null 0.09 33.0 4 2 0 PRT sp|P26196|DDX6_HUMAN Probable ATP-dependent RNA helicase DDX6 OS=Homo sapiens OX=9606 GN=DDX6 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33.0 null 0.05 33.0 2 1 0 PRT sp|P09493-3|TPM1_HUMAN Isoform 3 of Tropomyosin alpha-1 chain OS=Homo sapiens OX=9606 GN=TPM1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33.0 null 0.16 33.0 7 4 2 PRT sp|P61978|HNRPK_HUMAN Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 33.0 null 184-UNIMOD:4,185-UNIMOD:4,27-UNIMOD:35 0.17 33.0 25 7 1 PRT sp|P10412|H14_HUMAN Histone H1.4 OS=Homo sapiens OX=9606 GN=HIST1H1E PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ],[MS, MS:1001207, Mascot, ] 33.0 null 2-UNIMOD:1 0.24 33.0 16 4 1 PRT sp|O75717|WDHD1_HUMAN WD repeat and HMG-box DNA-binding protein 1 OS=Homo sapiens OX=9606 GN=WDHD1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32.0 null 0.02 32.0 2 2 2 PRT sp|P19338|NUCL_HUMAN Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32.0 null 0.09 32.0 13 5 2 PRT sp|Q8WW12|PCNP_HUMAN PEST proteolytic signal-containing nuclear protein OS=Homo sapiens OX=9606 GN=PCNP PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32.0 null 0.10 32.0 1 1 1 PRT sp|P23381|SYWC_HUMAN Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32.0 null 0.03 32.0 1 1 1 PRT sp|P33993|MCM7_HUMAN DNA replication licensing factor MCM7 OS=Homo sapiens OX=9606 GN=MCM7 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32.0 null 0.02 32.0 3 1 0 PRT sp|P35579|MYH9_HUMAN Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 32.0 null 896-UNIMOD:4 0.08 32.0 15 12 10 PRT sp|Q9UK76-2|JUPI1_HUMAN Isoform 2 of Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32.0 null 0.09 32.0 5 2 1 PRT sp|O60763-2|USO1_HUMAN Isoform 2 of General vesicular transport factor p115 OS=Homo sapiens OX=9606 GN=USO1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32.0 null 0.06 32.0 4 4 4 PRT sp|P52272|HNRPM_HUMAN Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32.0 null 653-UNIMOD:4 0.18 32.0 15 11 9 PRT sp|P47914|RL29_HUMAN 60S ribosomal protein L29 OS=Homo sapiens OX=9606 GN=RPL29 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32.0 null 0.10 32.0 6 1 0 PRT sp|P62269|RS18_HUMAN 40S ribosomal protein S18 OS=Homo sapiens OX=9606 GN=RPS18 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32.0 null 0.20 32.0 10 4 2 PRT sp|P18206|VINC_HUMAN Vinculin OS=Homo sapiens OX=9606 GN=VCL PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32.0 null 422-UNIMOD:4,313-UNIMOD:4 0.08 32.0 19 9 3 PRT sp|O00231-2|PSD11_HUMAN Isoform 2 of 26S proteasome non-ATPase regulatory subunit 11 OS=Homo sapiens OX=9606 GN=PSMD11 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32.0 null 0.11 32.0 5 4 3 PRT sp|P42704|LPPRC_HUMAN Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 32.0 null 930-UNIMOD:4 0.05 32.0 15 6 1 PRT sp|P60174|TPIS_HUMAN Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32.0 null 104-UNIMOD:4 0.08 32.0 6 2 0 PRT sp|P26583|HMGB2_HUMAN High mobility group protein B2 OS=Homo sapiens OX=9606 GN=HMGB2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32.0 null 0.12 32.0 4 3 2 PRT sp|P23246|SFPQ_HUMAN Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 32.0 null 0.12 32.0 17 7 2 PRT sp|P27348|1433T_HUMAN 14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32.0 null 134-UNIMOD:4,25-UNIMOD:4 0.19 32.0 8 4 1 PRT sp|P63104|1433Z_HUMAN 14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 32.0 null 25-UNIMOD:4,22-UNIMOD:35,26-UNIMOD:35 0.15 32.0 17 4 0 PRT sp|O43396|TXNL1_HUMAN Thioredoxin-like protein 1 OS=Homo sapiens OX=9606 GN=TXNL1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32.0 null 0.06 32.0 2 1 0 PRT sp|P09874|PARP1_HUMAN Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32.0 null 429-UNIMOD:4 0.07 32.0 12 7 5 PRT sp|Q9NTK5|OLA1_HUMAN Obg-like ATPase 1 OS=Homo sapiens OX=9606 GN=OLA1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32.0 null 0.06 32.0 2 2 2 PRT sp|Q14165|MLEC_HUMAN Malectin OS=Homo sapiens OX=9606 GN=MLEC PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32.0 null 0.06 32.0 1 1 1 PRT sp|P16422|EPCAM_HUMAN Epithelial cell adhesion molecule OS=Homo sapiens OX=9606 GN=EPCAM PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32.0 null 46-UNIMOD:4,48-UNIMOD:4,59-UNIMOD:4 0.06 32.0 3 1 0 PRT sp|P11387|TOP1_HUMAN DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32.0 null 504-UNIMOD:4,505-UNIMOD:4,630-UNIMOD:4 0.08 32.0 6 5 4 PRT sp|Q9Y266|NUDC_HUMAN Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 32.0 null 0.21 32.0 6 5 4 PRT sp|P23526-2|SAHH_HUMAN Isoform 2 of Adenosylhomocysteinase OS=Homo sapiens OX=9606 GN=AHCY null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32.0 null 0.06 32.0 5 2 1 PRT sp|P14618-2|KPYM_HUMAN Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32.0 null 0.07 32.0 8 4 1 PRT sp|P11142|HSP7C_HUMAN Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32.0 null 603-UNIMOD:4 0.11 32.0 15 6 3 PRT sp|P09651|ROA1_HUMAN Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=5 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 32.0 null 175-UNIMOD:4 0.09 32.0 7 3 1 PRT sp|P16403|H12_HUMAN Histone H1.2 OS=Homo sapiens OX=9606 GN=HIST1H1C PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ],[MS, MS:1000663, ProteinPilot, ] 32.0 null 2-UNIMOD:1 0.08 32.0 7 1 0 PRT sp|Q02978|M2OM_HUMAN Mitochondrial 2-oxoglutarate/malate carrier protein OS=Homo sapiens OX=9606 GN=SLC25A11 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 32.0 null 2-UNIMOD:1 0.05 32.0 2 1 0 PRT sp|Q71DI3|H32_HUMAN Histone H3.2 OS=Homo sapiens OX=9606 GN=HIST2H3A PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1000663, ProteinPilot, ],[MS, MS:1001207, Mascot, ] 31.0 null 111-UNIMOD:4 0.32 31.0 14 3 2 PRT sp|Q9UN86-2|G3BP2_HUMAN Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31.0 null 0.06 31.0 3 2 1 PRT sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens OX=9606 GN=KRT9 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31.0 null 0.09 31.0 3 3 3 PRT sp|Q14697|GANAB_HUMAN Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31.0 null 41-UNIMOD:4,47-UNIMOD:4 0.08 31.0 10 7 4 PRT sp|P46013|KI67_HUMAN Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31.0 null 0.01 31.0 3 3 3 PRT sp|P34932|HSP74_HUMAN Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31.0 null 779-UNIMOD:4 0.07 31.0 3 3 3 PRT sp|P27797|CALR_HUMAN Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31.0 null 105-UNIMOD:4 0.09 31.0 6 3 2 PRT sp|O95373|IPO7_HUMAN Importin-7 OS=Homo sapiens OX=9606 GN=IPO7 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31.0 null 736-UNIMOD:4 0.02 31.0 1 1 1 PRT sp|Q8IWS0-3|PHF6_HUMAN Isoform 3 of PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31.0 null 211-UNIMOD:4,214-UNIMOD:4 0.09 31.0 2 2 2 PRT sp|Q02952-2|AKA12_HUMAN Isoform 2 of A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31.0 null 0.06 31.0 8 6 4 PRT sp|Q04917|1433F_HUMAN 14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ] 31.0 null 2-UNIMOD:1,112-UNIMOD:4 0.18 31.0 11 4 0 PRT sp|Q92841-1|DDX17_HUMAN Isoform 2 of Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31.0 null 505-UNIMOD:4,198-UNIMOD:4 0.15 31.0 15 8 6 PRT sp|Q96AE4-2|FUBP1_HUMAN Isoform 2 of Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31.0 null 0.10 31.0 13 6 3 PRT sp|Q5VTR2|BRE1A_HUMAN E3 ubiquitin-protein ligase BRE1A OS=Homo sapiens OX=9606 GN=RNF20 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31.0 null 0.03 31.0 2 2 2 PRT sp|Q01844-2|EWS_HUMAN Isoform EWS-B of RNA-binding protein EWS OS=Homo sapiens OX=9606 GN=EWSR1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31.0 null 0.05 31.0 4 2 1 PRT sp|Q7L190|DPPA4_HUMAN Developmental pluripotency-associated protein 4 OS=Homo sapiens OX=9606 GN=DPPA4 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31.0 null 0.05 31.0 3 1 0 PRT sp|Q9H0S4-2|DDX47_HUMAN Isoform 2 of Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens OX=9606 GN=DDX47 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31.0 null 0.04 31.0 1 1 1 PRT sp|Q9NP81|SYSM_HUMAN Serine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=SARS2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31.0 null 0.09 31.0 4 3 2 PRT sp|P27695|APEX1_HUMAN DNA-(apurinic or apyrimidinic site) lyase OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31.0 null 0.09 31.0 5 4 3 PRT sp|Q9Y295|DRG1_HUMAN Developmentally-regulated GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=DRG1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31.0 null 0.04 31.0 1 1 1 PRT sp|Q9Y2X3|NOP58_HUMAN Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31.0 null 439-UNIMOD:4 0.13 31.0 9 5 2 PRT sp|P67936|TPM4_HUMAN Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 31.0 null 0.14 31.0 8 3 0 PRT sp|P62917|RL8_HUMAN 60S ribosomal protein L8 OS=Homo sapiens OX=9606 GN=RPL8 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 31.0 null 0.15 31.0 9 4 1 PRT sp|Q01650|LAT1_HUMAN Large neutral amino acids transporter small subunit 1 OS=Homo sapiens OX=9606 GN=SLC7A5 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31.0 null 0.04 31.0 2 1 0 PRT sp|Q9P0T7|TMEM9_HUMAN Transmembrane protein 9 OS=Homo sapiens OX=9606 GN=TMEM9 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31.0 null 0.11 31.0 1 1 1 PRT sp|Q9BYX7|ACTBM_HUMAN Putative beta-actin-like protein 3 OS=Homo sapiens OX=9606 GN=POTEKP PE=5 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 31.0 null 0.04 31.0 2 1 0 PRT sp|P22626-2|ROA2_HUMAN Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30.0 null 181-UNIMOD:35,38-UNIMOD:4 0.19 30.0 13 5 1 PRT sp|Q9Y3E5|PTH2_HUMAN Peptidyl-tRNA hydrolase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PTRH2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30.0 null 86-UNIMOD:4 0.08 30.0 1 1 1 PRT sp|P10809|CH60_HUMAN 60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30.0 null 0.07 30.0 9 4 1 PRT sp|O75874|IDHC_HUMAN Isocitrate dehydrogenase [NADP] cytoplasmic OS=Homo sapiens OX=9606 GN=IDH1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30.0 null 0.03 30.0 2 1 0 PRT sp|P13010|XRCC5_HUMAN X-ray repair cross-complementing protein 5 OS=Homo sapiens OX=9606 GN=XRCC5 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30.0 null 0.06 30.0 6 5 4 PRT sp|P31946-2|1433B_HUMAN Isoform Short of 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30.0 null 0.15 30.0 4 3 2 PRT sp|Q9BRP8-2|PYM1_HUMAN Isoform 2 of Partner of Y14 and mago OS=Homo sapiens OX=9606 GN=PYM1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30.0 null 0.15 30.0 2 2 2 PRT sp|P49411|EFTU_HUMAN Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 30.0 null 290-UNIMOD:4 0.16 30.0 10 6 3 PRT sp|Q02878|RL6_HUMAN 60S ribosomal protein L6 OS=Homo sapiens OX=9606 GN=RPL6 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30.0 null 0.16 30.0 8 4 2 PRT sp|P04075-2|ALDOA_HUMAN Isoform 2 of Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30.0 null 393-UNIMOD:4,294-UNIMOD:4,256-UNIMOD:4 0.20 30.0 17 9 5 PRT sp|P78371-2|TCPB_HUMAN Isoform 2 of T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30.0 null 0.08 30.0 5 3 0 PRT sp|P00441|SODC_HUMAN Superoxide dismutase [Cu-Zn] OS=Homo sapiens OX=9606 GN=SOD1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30.0 null 0.08 30.0 3 1 0 PRT sp|Q01581|HMCS1_HUMAN Hydroxymethylglutaryl-CoA synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=HMGCS1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30.0 null 0.05 30.0 3 2 1 PRT sp|O76094|SRP72_HUMAN Signal recognition particle subunit SRP72 OS=Homo sapiens OX=9606 GN=SRP72 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30.0 null 0.06 30.0 4 3 2 PRT sp|P13804|ETFA_HUMAN Electron transfer flavoprotein subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ETFA PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30.0 null 0.12 30.0 3 3 3 PRT sp|P07195|LDHB_HUMAN L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30.0 null 164-UNIMOD:4 0.10 30.0 8 3 1 PRT sp|Q13200|PSMD2_HUMAN 26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30.0 null 0.09 30.0 11 6 2 PRT sp|Q9NR30|DDX21_HUMAN Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21 PE=1 SV=5 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30.0 null 0.07 30.0 8 5 3 PRT sp|Q13838-2|DX39B_HUMAN Isoform 2 of Spliceosome RNA helicase DDX39B OS=Homo sapiens OX=9606 GN=DDX39B null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30.0 null 180-UNIMOD:4 0.05 30.0 4 2 1 PRT sp|P12268|IMDH2_HUMAN Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30.0 null 0.08 30.0 5 4 3 PRT sp|P08133-2|ANXA6_HUMAN Isoform 2 of Annexin A6 OS=Homo sapiens OX=9606 GN=ANXA6 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30.0 null 0.06 30.0 4 3 2 PRT sp|Q13162|PRDX4_HUMAN Peroxiredoxin-4 OS=Homo sapiens OX=9606 GN=PRDX4 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 30.0 null 0.11 30.0 6 4 3 PRT sp|Q01105-2|SET_HUMAN Isoform 2 of Protein SET OS=Homo sapiens OX=9606 GN=SET null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30.0 null 0.11 30.0 5 2 1 PRT sp|P22102|PUR2_HUMAN Trifunctional purine biosynthetic protein adenosine-3 OS=Homo sapiens OX=9606 GN=GART PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30.0 null 41-UNIMOD:4 0.03 30.0 3 2 1 PRT sp|Q8IY81|SPB1_HUMAN pre-rRNA processing protein FTSJ3 OS=Homo sapiens OX=9606 GN=FTSJ3 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30.0 null 0.02 30.0 1 1 1 PRT sp|Q9BXP5-2|SRRT_HUMAN Isoform 2 of Serrate RNA effector molecule homolog OS=Homo sapiens OX=9606 GN=SRRT null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30.0 null 490-UNIMOD:4 0.06 30.0 5 4 3 PRT sp|Q12906-7|ILF3_HUMAN Isoform 7 of Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1000663, ProteinPilot, ] 30.0 null 0.11 30.0 16 8 3 PRT sp|Q13813|SPTN1_HUMAN Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30.0 null 0.08 30.0 21 16 12 PRT sp|P22314|UBA1_HUMAN Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30.0 null 0.02 30.0 6 2 1 PRT sp|P60866-2|RS20_HUMAN Isoform 2 of 40S ribosomal protein S20 OS=Homo sapiens OX=9606 GN=RPS20 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30.0 null 0.08 30.0 4 1 0 PRT sp|P30041|PRDX6_HUMAN Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30.0 null 91-UNIMOD:4 0.11 30.0 5 2 0 PRT sp|P52292|IMA1_HUMAN Importin subunit alpha-1 OS=Homo sapiens OX=9606 GN=KPNA2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30.0 null 0.03 30.0 3 1 0 PRT sp|Q06546|GABPA_HUMAN GA-binding protein alpha chain OS=Homo sapiens OX=9606 GN=GABPA PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30.0 null 0.04 30.0 1 1 1 PRT sp|Q9NVA2-2|SEP11_HUMAN Isoform 2 of Septin-11 OS=Homo sapiens OX=9606 GN=SEPT11 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30.0 null 0.07 30.0 2 2 2 PRT sp|P62736|ACTA_HUMAN Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 30.0 null 0.03 30.0 4 1 0 PRT sp|Q7Z3K3|POGZ_HUMAN Pogo transposable element with ZNF domain OS=Homo sapiens OX=9606 GN=POGZ PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 30.0 null 0.01 30.0 1 1 1 PRT sp|O95747|OXSR1_HUMAN Serine/threonine-protein kinase OSR1 OS=Homo sapiens OX=9606 GN=OXSR1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ] 30.0 null 0.05 30.0 3 2 1 PRT sp|P0C0S5|H2AZ_HUMAN Histone H2A.Z OS=Homo sapiens OX=9606 GN=H2AFZ PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29.0 null 0.14 29.0 5 1 0 PRT sp|P18621-3|RL17_HUMAN Isoform 3 of 60S ribosomal protein L17 OS=Homo sapiens OX=9606 GN=RPL17 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29.0 null 0.14 29.0 6 2 1 PRT sp|Q5TFE4-2|NT5D1_HUMAN Isoform 2 of 5'-nucleotidase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NT5DC1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29.0 null 0.03 29.0 1 1 1 PRT sp|Q9BVJ6-3|UT14A_HUMAN Isoform 3 of U3 small nucleolar RNA-associated protein 14 homolog A OS=Homo sapiens OX=9606 GN=UTP14A null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29.0 null 0.05 29.0 2 2 2 PRT sp|P05388-2|RLA0_HUMAN Isoform 2 of 60S acidic ribosomal protein P0 OS=Homo sapiens OX=9606 GN=RPLP0 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29.0 null 0.05 29.0 3 1 0 PRT sp|P27635|RL10_HUMAN 60S ribosomal protein L10 OS=Homo sapiens OX=9606 GN=RPL10 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29.0 null 195-UNIMOD:4 0.15 29.0 4 3 2 PRT sp|P62258|1433E_HUMAN 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 29.0 null 0.18 29.0 9 5 4 PRT sp|P35998|PRS7_HUMAN 26S proteasome regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMC2 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29.0 null 0.08 29.0 3 3 3 PRT sp|Q07666|KHDR1_HUMAN KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens OX=9606 GN=KHDRBS1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29.0 null 0.06 29.0 5 2 0 PRT sp|P37108|SRP14_HUMAN Signal recognition particle 14 kDa protein OS=Homo sapiens OX=9606 GN=SRP14 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 29.0 null 0.10 29.0 4 2 0 PRT sp|Q99808|S29A1_HUMAN Equilibrative nucleoside transporter 1 OS=Homo sapiens OX=9606 GN=SLC29A1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29.0 null 0.07 29.0 2 2 2 PRT sp|O00592-2|PODXL_HUMAN Isoform 2 of Podocalyxin OS=Homo sapiens OX=9606 GN=PODXL null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29.0 null 312-UNIMOD:4 0.07 29.0 6 3 0 PRT sp|Q8IZL8|PELP1_HUMAN Proline-, glutamic acid- and leucine-rich protein 1 OS=Homo sapiens OX=9606 GN=PELP1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29.0 null 522-UNIMOD:4 0.04 29.0 4 3 2 PRT sp|P43243|MATR3_HUMAN Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29.0 null 0.10 29.0 12 8 5 PRT sp|Q92598-4|HS105_HUMAN Isoform 4 of Heat shock protein 105 kDa OS=Homo sapiens OX=9606 GN=HSPH1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29.0 null 798-UNIMOD:4 0.04 29.0 2 2 2 PRT sp|Q16643-3|DREB_HUMAN Isoform 3 of Drebrin OS=Homo sapiens OX=9606 GN=DBN1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29.0 null 0.07 29.0 7 4 2 PRT sp|P29692-3|EF1D_HUMAN Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29.0 null 0.14 29.0 2 2 2 PRT sp|P41252|SYIC_HUMAN Isoleucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=IARS PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29.0 null 120-UNIMOD:4 0.02 29.0 3 2 1 PRT sp|Q96EP5-2|DAZP1_HUMAN Isoform 2 of DAZ-associated protein 1 OS=Homo sapiens OX=9606 GN=DAZAP1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29.0 null 0.04 29.0 3 1 0 PRT sp|Q14683|SMC1A_HUMAN Structural maintenance of chromosomes protein 1A OS=Homo sapiens OX=9606 GN=SMC1A PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29.0 null 0.09 29.0 11 10 9 PRT sp|P24928|RPB1_HUMAN DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens OX=9606 GN=POLR2A PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29.0 null 0.02 29.0 3 3 3 PRT sp|P07355-2|ANXA2_HUMAN Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29.0 null 0.12 29.0 7 4 3 PRT sp|Q9Y3I0|RTCB_HUMAN tRNA-splicing ligase RtcB homolog OS=Homo sapiens OX=9606 GN=RTCB PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29.0 null 255-UNIMOD:4 0.05 29.0 3 2 1 PRT sp|Q92804-2|RBP56_HUMAN Isoform Short of TATA-binding protein-associated factor 2N OS=Homo sapiens OX=9606 GN=TAF15 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29.0 null 0.05 29.0 1 1 1 PRT sp|P49756|RBM25_HUMAN RNA-binding protein 25 OS=Homo sapiens OX=9606 GN=RBM25 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29.0 null 0.02 29.0 1 1 1 PRT sp|P13639|EF2_HUMAN Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 29.0 null 693-UNIMOD:4,697-UNIMOD:35 0.11 29.0 18 10 3 PRT sp|O60749-2|SNX2_HUMAN Isoform 2 of Sorting nexin-2 OS=Homo sapiens OX=9606 GN=SNX2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29.0 null 0.07 29.0 2 2 2 PRT sp|Q14980|NUMA1_HUMAN Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 29.0 null 1367-UNIMOD:4,80-UNIMOD:4 0.09 29.0 21 18 16 PRT sp|P63244|RACK1_HUMAN Receptor of activated protein C kinase 1 OS=Homo sapiens OX=9606 GN=RACK1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ] 29.0 null 272-UNIMOD:28 0.08 29.0 4 2 1 PRT sp|P22695|QCR2_HUMAN Cytochrome b-c1 complex subunit 2, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC2 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29.0 null 0.06 29.0 3 2 1 PRT sp|P46821|MAP1B_HUMAN Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29.0 null 2041-UNIMOD:4 0.02 29.0 4 4 4 PRT sp|P18754-2|RCC1_HUMAN Isoform 2 of Regulator of chromosome condensation OS=Homo sapiens OX=9606 GN=RCC1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29.0 null 0.07 29.0 3 2 1 PRT sp|Q7Z4V5-3|HDGR2_HUMAN Isoform 3 of Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29.0 null 636-UNIMOD:4 0.06 29.0 4 3 2 PRT sp|Q9H307|PININ_HUMAN Pinin OS=Homo sapiens OX=9606 GN=PNN PE=1 SV=5 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 29.0 null 0.05 29.0 5 3 2 PRT sp|P12814|ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 29.0 null 0.02 29.0 1 1 0 PRT sp|Q9UQ80|PA2G4_HUMAN Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ] 29.0 null 149-UNIMOD:4 0.17 29.0 8 5 2 PRT sp|A6NHR9|SMHD1_HUMAN Structural maintenance of chromosomes flexible hinge domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SMCHD1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 29.0 null 2-UNIMOD:1 0.01 29.0 1 1 1 PRT sp|P38919|IF4A3_HUMAN Eukaryotic initiation factor 4A-III OS=Homo sapiens OX=9606 GN=EIF4A3 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 0.10 28.0 7 4 1 PRT sp|Q9BXF3|CECR2_HUMAN Cat eye syndrome critical region protein 2 OS=Homo sapiens OX=9606 GN=CECR2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 0.02 28.0 2 2 2 PRT sp|P08670|VIME_HUMAN Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 0.10 28.0 3 3 3 PRT sp|P38159-2|RBMX_HUMAN Isoform 2 of RNA-binding motif protein, X chromosome OS=Homo sapiens OX=9606 GN=RBMX null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 0.13 28.0 10 4 1 PRT sp|Q8NC51-3|PAIRB_HUMAN Isoform 3 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 0.19 28.0 13 8 6 PRT sp|Q06830|PRDX1_HUMAN Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 0.12 28.0 3 2 1 PRT sp|P08238|HS90B_HUMAN Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 564-UNIMOD:4 0.08 28.0 12 6 4 PRT sp|P36578|RL4_HUMAN 60S ribosomal protein L4 OS=Homo sapiens OX=9606 GN=RPL4 PE=1 SV=5 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 96-UNIMOD:4,284-UNIMOD:35 0.10 28.0 18 4 1 PRT sp|Q9HC38-2|GLOD4_HUMAN Isoform 2 of Glyoxalase domain-containing protein 4 OS=Homo sapiens OX=9606 GN=GLOD4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 41-UNIMOD:4 0.07 28.0 2 2 2 PRT sp|Q93008-1|USP9X_HUMAN Isoform 2 of Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Homo sapiens OX=9606 GN=USP9X null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 2293-UNIMOD:4,1908-UNIMOD:4,864-UNIMOD:4,540-UNIMOD:4,1061-UNIMOD:4 0.05 28.0 15 12 9 PRT sp|Q9H1E3-2|NUCKS_HUMAN Isoform 2 of Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 0.14 28.0 3 2 1 PRT sp|Q07065|CKAP4_HUMAN Cytoskeleton-associated protein 4 OS=Homo sapiens OX=9606 GN=CKAP4 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 0.07 28.0 4 3 2 PRT sp|P49368|TCPG_HUMAN T-complex protein 1 subunit gamma OS=Homo sapiens OX=9606 GN=CCT3 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 0.04 28.0 4 2 1 PRT sp|Q5T7N2|LITD1_HUMAN LINE-1 type transposase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=L1TD1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 744-UNIMOD:4 0.09 28.0 8 7 6 PRT sp|Q00688|FKBP3_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Homo sapiens OX=9606 GN=FKBP3 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 0.05 28.0 3 1 0 PRT sp|P08195-2|4F2_HUMAN Isoform 2 of 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 0.03 28.0 2 1 0 PRT sp|P60891|PRPS1_HUMAN Ribose-phosphate pyrophosphokinase 1 OS=Homo sapiens OX=9606 GN=PRPS1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 165-UNIMOD:4 0.09 28.0 5 2 0 PRT sp|O75369-2|FLNB_HUMAN Isoform 2 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 604-UNIMOD:4,1326-UNIMOD:4,2477-UNIMOD:4 0.06 28.0 16 12 8 PRT sp|Q8NE71-2|ABCF1_HUMAN Isoform 2 of ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 0.05 28.0 6 4 3 PRT sp|Q7L4I2-2|RSRC2_HUMAN Isoform 2 of Arginine/serine-rich coiled-coil protein 2 OS=Homo sapiens OX=9606 GN=RSRC2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 334-UNIMOD:4 0.04 28.0 1 1 1 PRT sp|Q8WXF1|PSPC1_HUMAN Paraspeckle component 1 OS=Homo sapiens OX=9606 GN=PSPC1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 0.04 28.0 3 2 1 PRT sp|O60832|DKC1_HUMAN H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 0.12 28.0 6 6 6 PRT sp|Q14974|IMB1_HUMAN Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 0.06 28.0 11 4 2 PRT sp|Q96DI7-2|SNR40_HUMAN Isoform 2 of U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens OX=9606 GN=SNRNP40 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 168-UNIMOD:4 0.04 28.0 2 1 0 PRT sp|P83916|CBX1_HUMAN Chromobox protein homolog 1 OS=Homo sapiens OX=9606 GN=CBX1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 0.06 28.0 4 1 0 PRT sp|Q5JXB2|UE2NL_HUMAN Putative ubiquitin-conjugating enzyme E2 N-like OS=Homo sapiens OX=9606 GN=UBE2NL PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 0.14 28.0 6 2 1 PRT sp|P84103-2|SRSF3_HUMAN Isoform 2 of Serine/arginine-rich splicing factor 3 OS=Homo sapiens OX=9606 GN=SRSF3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 0.10 28.0 1 1 1 PRT sp|Q9Y6M1-1|IF2B2_HUMAN Isoform 2 of Insulin-like growth factor 2 mRNA-binding protein 2 OS=Homo sapiens OX=9606 GN=IGF2BP2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 255-UNIMOD:4 0.07 28.0 3 3 3 PRT sp|P62701|RS4X_HUMAN 40S ribosomal protein S4, X isoform OS=Homo sapiens OX=9606 GN=RPS4X PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 28.0 null 0.28 28.0 14 8 5 PRT sp|O43707|ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 0.08 28.0 13 7 3 PRT sp|P04179-2|SODM_HUMAN Isoform 2 of Superoxide dismutase [Mn], mitochondrial OS=Homo sapiens OX=9606 GN=SOD2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 0.09 28.0 1 1 1 PRT sp|P33176|KINH_HUMAN Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 294-UNIMOD:4 0.07 28.0 5 5 5 PRT sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 28.0 null 2202-UNIMOD:4,223-UNIMOD:4 0.05 28.0 19 12 8 PRT sp|P31942-2|HNRH3_HUMAN Isoform 2 of Heterogeneous nuclear ribonucleoprotein H3 OS=Homo sapiens OX=9606 GN=HNRNPH3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 0.11 28.0 7 3 1 PRT sp|P05023-4|AT1A1_HUMAN Isoform 4 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 0.03 28.0 5 2 1 PRT sp|P62910|RL32_HUMAN 60S ribosomal protein L32 OS=Homo sapiens OX=9606 GN=RPL32 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 96-UNIMOD:4 0.24 28.0 5 3 2 PRT sp|O14745|NHRF1_HUMAN Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Homo sapiens OX=9606 GN=SLC9A3R1 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 28.0 null 211-UNIMOD:28 0.18 28.0 13 5 2 PRT sp|Q14566|MCM6_HUMAN DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 0.05 28.0 9 3 0 PRT sp|P30419|NMT1_HUMAN Glycylpeptide N-tetradecanoyltransferase 1 OS=Homo sapiens OX=9606 GN=NMT1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 0.03 28.0 1 1 1 PRT sp|P07954-2|FUMH_HUMAN Isoform Cytoplasmic of Fumarate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=FH null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 0.03 28.0 3 1 0 PRT sp|P62424|RL7A_HUMAN 60S ribosomal protein L7a OS=Homo sapiens OX=9606 GN=RPL7A PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 199-UNIMOD:4 0.18 28.0 7 5 4 PRT sp|P07900-2|HS90A_HUMAN Isoform 2 of Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 694-UNIMOD:4 0.10 28.0 27 9 2 PRT sp|Q8TCT9-2|HM13_HUMAN Isoform 2 of Minor histocompatibility antigen H13 OS=Homo sapiens OX=9606 GN=HM13 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 0.03 28.0 3 1 0 PRT sp|Q9UJZ1-2|STML2_HUMAN Isoform 2 of Stomatin-like protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=STOML2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 0.09 28.0 6 2 0 PRT sp|P06753-2|TPM3_HUMAN Isoform 2 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ] 28.0 null 0.21 28.0 11 5 2 PRT sp|P49588|SYAC_HUMAN Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 773-UNIMOD:4 0.05 28.0 7 4 2 PRT sp|Q96HS1-2|PGAM5_HUMAN Isoform 2 of Serine/threonine-protein phosphatase PGAM5, mitochondrial OS=Homo sapiens OX=9606 GN=PGAM5 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 0.09 28.0 3 3 3 PRT sp|P0C0S8|H2A1_HUMAN Histone H2A type 1 OS=Homo sapiens OX=9606 GN=HIST1H2AG PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 0.15 28.0 2 1 0 PRT sp|Q9Y5K6|CD2AP_HUMAN CD2-associated protein OS=Homo sapiens OX=9606 GN=CD2AP PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 0.02 28.0 1 1 1 PRT sp|P63220|RS21_HUMAN 40S ribosomal protein S21 OS=Homo sapiens OX=9606 GN=RPS21 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 62-UNIMOD:35 0.14 28.0 4 2 1 PRT sp|P50914|RL14_HUMAN 60S ribosomal protein L14 OS=Homo sapiens OX=9606 GN=RPL14 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28.0 null 42-UNIMOD:4 0.06 28.0 7 1 0 PRT sp|Q6IBS0|TWF2_HUMAN Twinfilin-2 OS=Homo sapiens OX=9606 GN=TWF2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ] 28.0 null 141-UNIMOD:4,2-UNIMOD:1 0.09 28.0 3 2 1 PRT sp|Q9Y2Z0|SGT1_HUMAN Protein SGT1 homolog OS=Homo sapiens OX=9606 GN=SUGT1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 28.0 null 2-UNIMOD:1 0.04 28.0 1 1 1 PRT sp|P62807|H2B1C_HUMAN Histone H2B type 1-C/E/F/G/I OS=Homo sapiens OX=9606 GN=HIST1H2BC PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 28.0 null 48-UNIMOD:28 0.10 28.0 5 1 0 PRT sp|Q8IWB7|WDFY1_HUMAN WD repeat and FYVE domain-containing protein 1 OS=Homo sapiens OX=9606 GN=WDFY1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ] 28.0 null 344-UNIMOD:4,347-UNIMOD:4 0.07 28.0 2 2 2 PRT sp|P49755|TMEDA_HUMAN Transmembrane emp24 domain-containing protein 10 OS=Homo sapiens OX=9606 GN=TMED10 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ] 28.0 null 0.06 28.0 3 1 0 PRT sp|Q8WWM7-3|ATX2L_HUMAN Isoform 3 of Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 0.03 27.0 2 2 2 PRT sp|Q99880|H2B1L_HUMAN Histone H2B type 1-L OS=Homo sapiens OX=9606 GN=HIST1H2BL PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 0.10 27.0 5 1 0 PRT sp|Q9Y467|SALL2_HUMAN Sal-like protein 2 OS=Homo sapiens OX=9606 GN=SALL2 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 0.05 27.0 3 3 3 PRT sp|Q13492-2|PICAL_HUMAN Isoform 2 of Phosphatidylinositol-binding clathrin assembly protein OS=Homo sapiens OX=9606 GN=PICALM null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 0.03 27.0 1 1 1 PRT sp|P60981-2|DEST_HUMAN Isoform 2 of Destrin OS=Homo sapiens OX=9606 GN=DSTN null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 118-UNIMOD:4,29-UNIMOD:4 0.16 27.0 4 2 1 PRT sp|P37837|TALDO_HUMAN Transaldolase OS=Homo sapiens OX=9606 GN=TALDO1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 0.03 27.0 1 1 1 PRT sp|P60468|SC61B_HUMAN Protein transport protein Sec61 subunit beta OS=Homo sapiens OX=9606 GN=SEC61B PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 0.29 27.0 3 2 1 PRT sp|Q9Y696|CLIC4_HUMAN Chloride intracellular channel protein 4 OS=Homo sapiens OX=9606 GN=CLIC4 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 234-UNIMOD:4 0.10 27.0 5 2 1 PRT sp|Q14103-3|HNRPD_HUMAN Isoform 3 of Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 0.18 27.0 9 5 2 PRT sp|P28074|PSB5_HUMAN Proteasome subunit beta type-5 OS=Homo sapiens OX=9606 GN=PSMB5 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 0.13 27.0 6 4 2 PRT sp|P62070-4|RRAS2_HUMAN Isoform 4 of Ras-related protein R-Ras2 OS=Homo sapiens OX=9606 GN=RRAS2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 0.12 27.0 3 2 1 PRT sp|P05455|LA_HUMAN Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ] 27.0 null 245-UNIMOD:4,215-UNIMOD:28 0.12 27.0 12 5 1 PRT sp|P32969|RL9_HUMAN 60S ribosomal protein L9 OS=Homo sapiens OX=9606 GN=RPL9 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 134-UNIMOD:4 0.08 27.0 1 1 1 PRT sp|P02786|TFR1_HUMAN Transferrin receptor protein 1 OS=Homo sapiens OX=9606 GN=TFRC PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 0.03 27.0 2 2 2 PRT sp|P48735|IDHP_HUMAN Isocitrate dehydrogenase [NADP], mitochondrial OS=Homo sapiens OX=9606 GN=IDH2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 113-UNIMOD:4 0.08 27.0 6 4 2 PRT sp|P30101|PDIA3_HUMAN Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 27.0 null 0.19 27.0 31 10 2 PRT sp|Q86VP6|CAND1_HUMAN Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens OX=9606 GN=CAND1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 356-UNIMOD:4,954-UNIMOD:4 0.04 27.0 6 5 4 PRT sp|Q99439|CNN2_HUMAN Calponin-2 OS=Homo sapiens OX=9606 GN=CNN2 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 215-UNIMOD:4,175-UNIMOD:4 0.09 27.0 2 2 2 PRT sp|O43684-2|BUB3_HUMAN Isoform 2 of Mitotic checkpoint protein BUB3 OS=Homo sapiens OX=9606 GN=BUB3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 129-UNIMOD:4 0.09 27.0 6 2 0 PRT sp|P08727|K1C19_HUMAN Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 27.0 null 0.18 27.0 10 7 4 PRT sp|O00161-2|SNP23_HUMAN Isoform SNAP-23b of Synaptosomal-associated protein 23 OS=Homo sapiens OX=9606 GN=SNAP23 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 0.09 27.0 2 2 2 PRT sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 27.0 null 583-UNIMOD:35 0.17 27.0 17 9 5 PRT sp|P25205-2|MCM3_HUMAN Isoform 2 of DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 0.08 27.0 9 7 5 PRT sp|P07237|PDIA1_HUMAN Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 425-UNIMOD:35 0.07 27.0 7 3 1 PRT sp|P39023|RL3_HUMAN 60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 27.0 null 114-UNIMOD:4 0.07 27.0 6 2 0 PRT sp|Q6IA86-2|ELP2_HUMAN Isoform 2 of Elongator complex protein 2 OS=Homo sapiens OX=9606 GN=ELP2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 0.02 27.0 1 1 0 PRT sp|Q16851|UGPA_HUMAN UTP--glucose-1-phosphate uridylyltransferase OS=Homo sapiens OX=9606 GN=UGP2 PE=1 SV=5 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 27.0 null 123-UNIMOD:4 0.14 27.0 13 7 4 PRT sp|Q9Y6E2|BZW2_HUMAN Basic leucine zipper and W2 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=BZW2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 0.03 27.0 1 1 1 PRT sp|Q08380|LG3BP_HUMAN Galectin-3-binding protein OS=Homo sapiens OX=9606 GN=LGALS3BP PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 0.02 27.0 1 1 1 PRT sp|Q9NY93-2|DDX56_HUMAN Isoform 2 of Probable ATP-dependent RNA helicase DDX56 OS=Homo sapiens OX=9606 GN=DDX56 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 0.03 27.0 1 1 1 PRT sp|Q06210|GFPT1_HUMAN Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 638-UNIMOD:4 0.06 27.0 3 3 3 PRT sp|P20962|PTMS_HUMAN Parathymosin OS=Homo sapiens OX=9606 GN=PTMS PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 27.0 null 0.12 27.0 6 1 0 PRT sp|P12236|ADT3_HUMAN ADP/ATP translocase 3 OS=Homo sapiens OX=9606 GN=SLC25A6 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 129-UNIMOD:4 0.16 27.0 5 3 2 PRT sp|Q9Y5A9-2|YTHD2_HUMAN Isoform 2 of YTH domain-containing family protein 2 OS=Homo sapiens OX=9606 GN=YTHDF2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 0.04 27.0 3 2 1 PRT sp|O43290|SNUT1_HUMAN U4/U6.U5 tri-snRNP-associated protein 1 OS=Homo sapiens OX=9606 GN=SART1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 0.06 27.0 4 3 2 PRT sp|P55735-2|SEC13_HUMAN Isoform 2 of Protein SEC13 homolog OS=Homo sapiens OX=9606 GN=SEC13 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 173-UNIMOD:4 0.07 27.0 2 2 2 PRT sp|O15042-2|SR140_HUMAN Isoform 2 of U2 snRNP-associated SURP motif-containing protein OS=Homo sapiens OX=9606 GN=U2SURP null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 0.04 27.0 3 3 3 PRT sp|Q9Y530|OARD1_HUMAN O-acetyl-ADP-ribose deacetylase 1 OS=Homo sapiens OX=9606 GN=OARD1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ] 27.0 null 33-UNIMOD:4,38-UNIMOD:4,2-UNIMOD:1 0.18 27.0 2 2 2 PRT sp|Q16629-4|SRSF7_HUMAN Isoform 4 of Serine/arginine-rich splicing factor 7 OS=Homo sapiens OX=9606 GN=SRSF7 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 0.10 27.0 3 2 1 PRT sp|P08865|RSSA_HUMAN 40S ribosomal protein SA OS=Homo sapiens OX=9606 GN=RPSA PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 0.05 27.0 4 1 0 PRT sp|Q9Y5B9|SP16H_HUMAN FACT complex subunit SPT16 OS=Homo sapiens OX=9606 GN=SUPT16H PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 0.02 27.0 3 2 1 PRT sp|Q14444-2|CAPR1_HUMAN Isoform 2 of Caprin-1 OS=Homo sapiens OX=9606 GN=CAPRIN1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 0.02 27.0 2 1 0 PRT sp|P78347-2|GTF2I_HUMAN Isoform 2 of General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 0.04 27.0 4 3 2 PRT sp|P18065|IBP2_HUMAN Insulin-like growth factor-binding protein 2 OS=Homo sapiens OX=9606 GN=IGFBP2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 98-UNIMOD:4 0.04 27.0 1 1 1 PRT sp|O75439|MPPB_HUMAN Mitochondrial-processing peptidase subunit beta OS=Homo sapiens OX=9606 GN=PMPCB PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 389-UNIMOD:4 0.03 27.0 1 1 1 PRT sp|Q08211|DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 27.0 null 438-UNIMOD:4 0.05 27.0 14 7 4 PRT sp|Q00325-2|MPCP_HUMAN Isoform B of Phosphate carrier protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 0.06 27.0 4 2 1 PRT sp|P30049|ATPD_HUMAN ATP synthase subunit delta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1D PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 0.15 27.0 6 2 0 PRT sp|P14314-2|GLU2B_HUMAN Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 468-UNIMOD:4,70-UNIMOD:4,77-UNIMOD:4 0.12 27.0 7 4 3 PRT sp|Q9P2M7|CING_HUMAN Cingulin OS=Homo sapiens OX=9606 GN=CGN PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 0.04 27.0 4 4 4 PRT sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens OX=9606 GN=PAFAH1B1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27.0 null 0.04 27.0 1 1 1 PRT sp|P21333|FLNA_HUMAN Filamin-A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 27.0 null 1018-UNIMOD:4 0.01 27.0 3 3 0 PRT sp|O00231|PSD11_HUMAN 26S proteasome non-ATPase regulatory subunit 11 OS=Homo sapiens OX=9606 GN=PSMD11 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 27.0 null 0.04 27.0 1 1 0 PRT sp|Q15020|SART3_HUMAN Squamous cell carcinoma antigen recognized by T-cells 3 OS=Homo sapiens OX=9606 GN=SART3 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 27.0 null 2-UNIMOD:1 0.02 27.0 1 1 1 PRT sp|O43583|DENR_HUMAN Density-regulated protein OS=Homo sapiens OX=9606 GN=DENR PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ],[MS, MS:1001207, Mascot, ] 27.0 null 2-UNIMOD:1,13-UNIMOD:4 0.17 27.0 2 2 2 PRT sp|Q71UI9|H2AV_HUMAN Histone H2A.V OS=Homo sapiens OX=9606 GN=H2AFV PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 27.0 null 0.14 27.0 1 1 0 PRT sp|P50552|VASP_HUMAN Vasodilator-stimulated phosphoprotein OS=Homo sapiens OX=9606 GN=VASP PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 26.0 null 2-UNIMOD:1,7-UNIMOD:4 0.06 26.0 3 2 1 PRT sp|P0DP23|CALM1_HUMAN Calmodulin-1 OS=Homo sapiens OX=9606 GN=CALM1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.08 26.0 2 2 2 PRT sp|Q8N339|MT1M_HUMAN Metallothionein-1M OS=Homo sapiens OX=9606 GN=MT1M PE=3 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 33-UNIMOD:4,34-UNIMOD:4,36-UNIMOD:4,37-UNIMOD:4,41-UNIMOD:4 0.21 26.0 2 1 0 PRT sp|Q9BQI0-3|AIF1L_HUMAN Isoform 3 of Allograft inflammatory factor 1-like OS=Homo sapiens OX=9606 GN=AIF1L null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.19 26.0 2 2 2 PRT sp|P09622|DLDH_HUMAN Dihydrolipoyl dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=DLD PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.02 26.0 1 1 1 PRT sp|P61956-2|SUMO2_HUMAN Isoform 2 of Small ubiquitin-related modifier 2 OS=Homo sapiens OX=9606 GN=SUMO2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.15 26.0 3 1 0 PRT sp|Q8IY67-2|RAVR1_HUMAN Isoform 2 of Ribonucleoprotein PTB-binding 1 OS=Homo sapiens OX=9606 GN=RAVER1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.02 26.0 1 1 1 PRT sp|Q13428-3|TCOF_HUMAN Isoform 3 of Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.04 26.0 6 5 4 PRT sp|Q8N1G4|LRC47_HUMAN Leucine-rich repeat-containing protein 47 OS=Homo sapiens OX=9606 GN=LRRC47 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.05 26.0 3 2 1 PRT sp|Q12789-3|TF3C1_HUMAN Isoform 2 of General transcription factor 3C polypeptide 1 OS=Homo sapiens OX=9606 GN=GTF3C1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.03 26.0 4 4 4 PRT sp|O75380|NDUS6_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS6 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 87-UNIMOD:4 0.13 26.0 1 1 1 PRT sp|Q16555-2|DPYL2_HUMAN Isoform 2 of Dihydropyrimidinase-related protein 2 OS=Homo sapiens OX=9606 GN=DPYSL2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.02 26.0 1 1 0 PRT sp|O95202|LETM1_HUMAN Mitochondrial proton/calcium exchanger protein OS=Homo sapiens OX=9606 GN=LETM1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 26.0 null 0.02 26.0 2 1 0 PRT sp|P84090|ERH_HUMAN Enhancer of rudimentary homolog OS=Homo sapiens OX=9606 GN=ERH PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.12 26.0 3 1 0 PRT sp|P27816-6|MAP4_HUMAN Isoform 6 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.06 26.0 7 5 3 PRT sp|P08754|GNAI3_HUMAN Guanine nucleotide-binding protein G(k) subunit alpha OS=Homo sapiens OX=9606 GN=GNAI3 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 66-UNIMOD:4,139-UNIMOD:4 0.07 26.0 2 2 2 PRT sp|P04899-4|GNAI2_HUMAN Isoform sGi2 of Guanine nucleotide-binding protein G(i) subunit alpha-2 OS=Homo sapiens OX=9606 GN=GNAI2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 66-UNIMOD:4 0.04 26.0 2 1 0 PRT sp|P27694|RFA1_HUMAN Replication protein A 70 kDa DNA-binding subunit OS=Homo sapiens OX=9606 GN=RPA1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.06 26.0 4 3 2 PRT sp|O15067|PUR4_HUMAN Phosphoribosylformylglycinamidine synthase OS=Homo sapiens OX=9606 GN=PFAS PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 270-UNIMOD:4 0.01 26.0 1 1 1 PRT sp|Q15459|SF3A1_HUMAN Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.05 26.0 3 3 3 PRT sp|Q9Y3Y2-3|CHTOP_HUMAN Isoform 2 of Chromatin target of PRMT1 protein OS=Homo sapiens OX=9606 GN=CHTOP null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.06 26.0 2 1 0 PRT sp|Q9NYF8-2|BCLF1_HUMAN Isoform 2 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.04 26.0 4 3 2 PRT sp|P98175-5|RBM10_HUMAN Isoform 5 of RNA-binding protein 10 OS=Homo sapiens OX=9606 GN=RBM10 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.03 26.0 2 2 2 PRT sp|P55060-3|XPO2_HUMAN Isoform 3 of Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 842-UNIMOD:4 0.06 26.0 6 5 4 PRT sp|P20700|LMNB1_HUMAN Lamin-B1 OS=Homo sapiens OX=9606 GN=LMNB1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.20 26.0 18 11 6 PRT sp|Q9UKX7-2|NUP50_HUMAN Isoform 2 of Nuclear pore complex protein Nup50 OS=Homo sapiens OX=9606 GN=NUP50 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.03 26.0 1 1 1 PRT sp|P25398|RS12_HUMAN 40S ribosomal protein S12 OS=Homo sapiens OX=9606 GN=RPS12 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 106-UNIMOD:4,108-UNIMOD:4 0.17 26.0 5 2 0 PRT sp|Q03252|LMNB2_HUMAN Lamin-B2 OS=Homo sapiens OX=9606 GN=LMNB2 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.09 26.0 6 5 4 PRT sp|Q5VYK3|ECM29_HUMAN Proteasome adapter and scaffold protein ECM29 OS=Homo sapiens OX=9606 GN=ECPAS PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.01 26.0 1 1 1 PRT sp|Q7Z6Z7-2|HUWE1_HUMAN Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 467-UNIMOD:4 0.01 26.0 5 5 5 PRT sp|P29401-2|TKT_HUMAN Isoform 2 of Transketolase OS=Homo sapiens OX=9606 GN=TKT null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.08 26.0 11 5 1 PRT sp|Q7LBC6|KDM3B_HUMAN Lysine-specific demethylase 3B OS=Homo sapiens OX=9606 GN=KDM3B PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.02 26.0 2 2 2 PRT sp|Q9Y5J9|TIM8B_HUMAN Mitochondrial import inner membrane translocase subunit Tim8 B OS=Homo sapiens OX=9606 GN=TIMM8B PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 55-UNIMOD:4,59-UNIMOD:4 0.14 26.0 1 1 1 PRT sp|P62841|RS15_HUMAN 40S ribosomal protein S15 OS=Homo sapiens OX=9606 GN=RPS15 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.19 26.0 4 2 1 PRT sp|P18615-3|NELFE_HUMAN Isoform 2 of Negative elongation factor E OS=Homo sapiens OX=9606 GN=NELFE null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.04 26.0 1 1 1 PRT sp|P04843|RPN1_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Homo sapiens OX=9606 GN=RPN1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 26.0 null 0.07 26.0 9 5 3 PRT sp|P23528|COF1_HUMAN Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 139-UNIMOD:4 0.14 26.0 6 2 1 PRT sp|P62306|RUXF_HUMAN Small nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=SNRPF PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 84-UNIMOD:35 0.16 26.0 4 1 0 PRT sp|Q9Y383-3|LC7L2_HUMAN Isoform 3 of Putative RNA-binding protein Luc7-like 2 OS=Homo sapiens OX=9606 GN=LUC7L2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.12 26.0 8 4 2 PRT sp|Q15637-4|SF01_HUMAN Isoform 4 of Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ] 26.0 null 282-UNIMOD:385,282-UNIMOD:4,292-UNIMOD:4 0.05 26.0 3 2 1 PRT sp|P22570-3|ADRO_HUMAN Isoform 3 of NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=FDXR null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.04 26.0 2 2 2 PRT sp|Q9BYT8|NEUL_HUMAN Neurolysin, mitochondrial OS=Homo sapiens OX=9606 GN=NLN PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.03 26.0 2 2 2 PRT sp|Q9UHB9-4|SRP68_HUMAN Isoform 4 of Signal recognition particle subunit SRP68 OS=Homo sapiens OX=9606 GN=SRP68 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.02 26.0 1 1 1 PRT sp|P42766|RL35_HUMAN 60S ribosomal protein L35 OS=Homo sapiens OX=9606 GN=RPL35 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.09 26.0 11 1 0 PRT sp|Q01085-2|TIAR_HUMAN Isoform 2 of Nucleolysin TIAR OS=Homo sapiens OX=9606 GN=TIAL1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.06 26.0 2 2 2 PRT sp|Q66K74-2|MAP1S_HUMAN Isoform 2 of Microtubule-associated protein 1S OS=Homo sapiens OX=9606 GN=MAP1S null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.01 26.0 1 1 1 PRT sp|P40121-2|CAPG_HUMAN Isoform 2 of Macrophage-capping protein OS=Homo sapiens OX=9606 GN=CAPG null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.11 26.0 4 3 2 PRT sp|P05198|IF2A_HUMAN Eukaryotic translation initiation factor 2 subunit 1 OS=Homo sapiens OX=9606 GN=EIF2S1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 70-UNIMOD:4 0.07 26.0 3 2 1 PRT sp|Q53FT3|HIKES_HUMAN Protein Hikeshi OS=Homo sapiens OX=9606 GN=HIKESHI PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.07 26.0 1 1 1 PRT sp|Q10570|CPSF1_HUMAN Cleavage and polyadenylation specificity factor subunit 1 OS=Homo sapiens OX=9606 GN=CPSF1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 26.0 null 1044-UNIMOD:4 0.02 26.0 2 2 2 PRT sp|Q5QJE6|TDIF2_HUMAN Deoxynucleotidyltransferase terminal-interacting protein 2 OS=Homo sapiens OX=9606 GN=DNTTIP2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.05 26.0 2 2 2 PRT sp|Q7RTV0|PHF5A_HUMAN PHD finger-like domain-containing protein 5A OS=Homo sapiens OX=9606 GN=PHF5A PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 46-UNIMOD:4,49-UNIMOD:4 0.13 26.0 2 1 0 PRT sp|P09417-2|DHPR_HUMAN Isoform 2 of Dihydropteridine reductase OS=Homo sapiens OX=9606 GN=QDPR null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 130-UNIMOD:4 0.07 26.0 2 1 0 PRT sp|P05787-2|K2C8_HUMAN Isoform 2 of Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.21 26.0 15 11 9 PRT sp|O00541-2|PESC_HUMAN Isoform 2 of Pescadillo homolog OS=Homo sapiens OX=9606 GN=PES1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 153-UNIMOD:4,161-UNIMOD:4 0.05 26.0 3 2 1 PRT sp|P28072|PSB6_HUMAN Proteasome subunit beta type-6 OS=Homo sapiens OX=9606 GN=PSMB6 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.10 26.0 3 2 1 PRT sp|P49790-2|NU153_HUMAN Isoform 2 of Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.03 26.0 3 3 3 PRT sp|Q15293-2|RCN1_HUMAN Isoform 2 of Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.08 26.0 3 2 1 PRT sp|P62873-2|GBB1_HUMAN Isoform 2 of Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homo sapiens OX=9606 GN=GNB1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 204-UNIMOD:4,148-UNIMOD:4,149-UNIMOD:4 0.15 26.0 6 4 2 PRT sp|Q13148|TADBP_HUMAN TAR DNA-binding protein 43 OS=Homo sapiens OX=9606 GN=TARDBP PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.08 26.0 4 3 2 PRT sp|Q9Y3C6|PPIL1_HUMAN Peptidyl-prolyl cis-trans isomerase-like 1 OS=Homo sapiens OX=9606 GN=PPIL1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.11 26.0 1 1 1 PRT sp|Q14157-1|UBP2L_HUMAN Isoform 2 of Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.04 26.0 5 3 1 PRT sp|P35080-2|PROF2_HUMAN Isoform IIb of Profilin-2 OS=Homo sapiens OX=9606 GN=PFN2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.11 26.0 2 1 0 PRT sp|O43765|SGTA_HUMAN Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Homo sapiens OX=9606 GN=SGTA PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 148-UNIMOD:4 0.12 26.0 3 3 3 PRT sp|Q13153-2|PAK1_HUMAN Isoform 2 of Serine/threonine-protein kinase PAK 1 OS=Homo sapiens OX=9606 GN=PAK1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.05 26.0 2 2 2 PRT sp|O00410-3|IPO5_HUMAN Isoform 3 of Importin-5 OS=Homo sapiens OX=9606 GN=IPO5 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.02 26.0 3 2 1 PRT sp|Q14061|COX17_HUMAN Cytochrome c oxidase copper chaperone OS=Homo sapiens OX=9606 GN=COX17 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.27 26.0 2 1 0 PRT sp|Q8WVV9-5|HNRLL_HUMAN Isoform 5 of Heterogeneous nuclear ribonucleoprotein L-like OS=Homo sapiens OX=9606 GN=HNRNPLL null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.11 26.0 4 4 4 PRT sp|Q9BQ39|DDX50_HUMAN ATP-dependent RNA helicase DDX50 OS=Homo sapiens OX=9606 GN=DDX50 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 417-UNIMOD:4 0.07 26.0 4 4 4 PRT sp|P33991|MCM4_HUMAN DNA replication licensing factor MCM4 OS=Homo sapiens OX=9606 GN=MCM4 PE=1 SV=5 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.03 26.0 2 2 2 PRT sp|Q96P70|IPO9_HUMAN Importin-9 OS=Homo sapiens OX=9606 GN=IPO9 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 0.01 26.0 1 1 1 PRT sp|P08134|RHOC_HUMAN Rho-related GTP-binding protein RhoC OS=Homo sapiens OX=9606 GN=RHOC PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26.0 null 16-UNIMOD:4 0.07 26.0 2 1 0 PRT sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 26.0 null 140-UNIMOD:385,140-UNIMOD:4,150-UNIMOD:4,161-UNIMOD:385,161-UNIMOD:4 0.14 26.0 2 2 1 PRT sp|O00592|PODXL_HUMAN Podocalyxin OS=Homo sapiens OX=9606 GN=PODXL PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 26.0 null 0.03 26.0 1 1 0 PRT sp|P62942|FKB1A_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ],[MS, MS:1001207, Mascot, ] 26.0 null 0.13 26.0 3 1 0 PRT sp|Q58FF8|H90B2_HUMAN Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens OX=9606 GN=HSP90AB2P PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 26.0 null 0.03 26.0 2 1 0 PRT sp|P04406|G3P_HUMAN Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1000663, ProteinPilot, ],[MS, MS:1001476, X!Tandem, ] 25.0 null 264-UNIMOD:28 0.12 25.0 5 4 3 PRT sp|P35221-2|CTNA1_HUMAN Isoform 2 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 767-UNIMOD:4,772-UNIMOD:4 0.05 25.0 5 5 5 PRT sp|Q99615|DNJC7_HUMAN DnaJ homolog subfamily C member 7 OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.03 25.0 1 1 1 PRT sp|O75531|BAF_HUMAN Barrier-to-autointegration factor OS=Homo sapiens OX=9606 GN=BANF1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.15 25.0 1 1 1 PRT sp|P53618|COPB_HUMAN Coatomer subunit beta OS=Homo sapiens OX=9606 GN=COPB1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.04 25.0 3 3 3 PRT sp|Q14195-2|DPYL3_HUMAN Isoform LCRMP-4 of Dihydropyrimidinase-related protein 3 OS=Homo sapiens OX=9606 GN=DPYSL3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.04 25.0 2 2 2 PRT sp|P61026|RAB10_HUMAN Ras-related protein Rab-10 OS=Homo sapiens OX=9606 GN=RAB10 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.07 25.0 1 1 1 PRT sp|Q9BYG3|MK67I_HUMAN MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Homo sapiens OX=9606 GN=NIFK PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.09 25.0 2 2 2 PRT sp|P46779|RL28_HUMAN 60S ribosomal protein L28 OS=Homo sapiens OX=9606 GN=RPL28 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ] 25.0 null 23-UNIMOD:28 0.23 25.0 8 3 1 PRT sp|P06454-2|PTMA_HUMAN Isoform 2 of Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.25 25.0 6 4 2 PRT sp|P48431|SOX2_HUMAN Transcription factor SOX-2 OS=Homo sapiens OX=9606 GN=SOX2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 265-UNIMOD:4 0.09 25.0 2 2 2 PRT sp|P84085|ARF5_HUMAN ADP-ribosylation factor 5 OS=Homo sapiens OX=9606 GN=ARF5 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.06 25.0 1 1 1 PRT sp|P52434-4|RPAB3_HUMAN Isoform 4 of DNA-directed RNA polymerases I, II, and III subunit RPABC3 OS=Homo sapiens OX=9606 GN=POLR2H null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.08 25.0 1 1 1 PRT sp|P07814|SYEP_HUMAN Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS PE=1 SV=5 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 25.0 null 336-UNIMOD:4,337-UNIMOD:4,1377-UNIMOD:4 0.08 25.0 12 9 7 PRT sp|O43768-4|ENSA_HUMAN Isoform 4 of Alpha-endosulfine OS=Homo sapiens OX=9606 GN=ENSA null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.11 25.0 1 1 1 PRT sp|Q96PK6|RBM14_HUMAN RNA-binding protein 14 OS=Homo sapiens OX=9606 GN=RBM14 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.05 25.0 3 3 3 PRT sp|Q9Y6D6|BIG1_HUMAN Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Homo sapiens OX=9606 GN=ARFGEF1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 1729-UNIMOD:4 0.02 25.0 4 4 4 PRT sp|P07737|PROF1_HUMAN Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 128-UNIMOD:4 0.15 25.0 8 3 0 PRT sp|P62263|RS14_HUMAN 40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.08 25.0 2 1 0 PRT sp|P35232|PHB_HUMAN Prohibitin OS=Homo sapiens OX=9606 GN=PHB PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 25.0 null 0.12 25.0 6 3 0 PRT sp|Q92896|GSLG1_HUMAN Golgi apparatus protein 1 OS=Homo sapiens OX=9606 GN=GLG1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 118-UNIMOD:4,984-UNIMOD:4,324-UNIMOD:4 0.05 25.0 7 5 3 PRT sp|P16949|STMN1_HUMAN Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ] 25.0 null 2-UNIMOD:1 0.13 25.0 3 2 1 PRT sp|P61201-2|CSN2_HUMAN Isoform 2 of COP9 signalosome complex subunit 2 OS=Homo sapiens OX=9606 GN=COPS2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 186-UNIMOD:4 0.04 25.0 1 1 1 PRT sp|Q92900-2|RENT1_HUMAN Isoform 2 of Regulator of nonsense transcripts 1 OS=Homo sapiens OX=9606 GN=UPF1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.02 25.0 2 2 2 PRT sp|Q9Y6K1|DNM3A_HUMAN DNA (cytosine-5)-methyltransferase 3A OS=Homo sapiens OX=9606 GN=DNMT3A PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 387-UNIMOD:4 0.03 25.0 3 2 1 PRT sp|Q9BXW7-2|HDHD5_HUMAN Isoform 1 of Haloacid dehalogenase-like hydrolase domain-containing 5 OS=Homo sapiens OX=9606 GN=HDHD5 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.04 25.0 1 1 1 PRT sp|Q5UIP0|RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 25.0 null 1155-UNIMOD:4 0.03 25.0 6 6 6 PRT sp|Q16527|CSRP2_HUMAN Cysteine and glycine-rich protein 2 OS=Homo sapiens OX=9606 GN=CSRP2 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 25-UNIMOD:4,122-UNIMOD:4 0.30 25.0 5 4 3 PRT sp|Q92552-2|RT27_HUMAN Isoform 2 of 28S ribosomal protein S27, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS27 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.06 25.0 1 1 1 PRT sp|Q15061|WDR43_HUMAN WD repeat-containing protein 43 OS=Homo sapiens OX=9606 GN=WDR43 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.02 25.0 2 1 0 PRT sp|P00338-3|LDHA_HUMAN Isoform 3 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.09 25.0 5 3 1 PRT sp|P46777|RL5_HUMAN 60S ribosomal protein L5 OS=Homo sapiens OX=9606 GN=RPL5 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.07 25.0 4 2 1 PRT sp|P27708|PYR1_HUMAN CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 25.0 null 280-UNIMOD:4 0.03 25.0 6 5 4 PRT sp|Q9BVA1|TBB2B_HUMAN Tubulin beta-2B chain OS=Homo sapiens OX=9606 GN=TUBB2B PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 354-UNIMOD:4,1-UNIMOD:35,12-UNIMOD:4,330-UNIMOD:35,303-UNIMOD:4,201-UNIMOD:4,211-UNIMOD:4,299-UNIMOD:35,300-UNIMOD:35 0.23 25.0 44 6 3 PRT sp|Q9Y3F4-2|STRAP_HUMAN Isoform 2 of Serine-threonine kinase receptor-associated protein OS=Homo sapiens OX=9606 GN=STRAP null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.09 25.0 5 3 1 PRT sp|Q9P2T1-2|GMPR2_HUMAN Isoform 2 of GMP reductase 2 OS=Homo sapiens OX=9606 GN=GMPR2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 240-UNIMOD:4,242-UNIMOD:4 0.05 25.0 1 1 1 PRT sp|O00422|SAP18_HUMAN Histone deacetylase complex subunit SAP18 OS=Homo sapiens OX=9606 GN=SAP18 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.08 25.0 1 1 1 PRT sp|P31930|QCR1_HUMAN Cytochrome b-c1 complex subunit 1, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 380-UNIMOD:4 0.05 25.0 2 2 2 PRT sp|P61247|RS3A_HUMAN 40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.09 25.0 3 2 1 PRT sp|Q9NQ29|LUC7L_HUMAN Putative RNA-binding protein Luc7-like 1 OS=Homo sapiens OX=9606 GN=LUC7L PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.04 25.0 1 1 1 PRT sp|O95232|LC7L3_HUMAN Luc7-like protein 3 OS=Homo sapiens OX=9606 GN=LUC7L3 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.04 25.0 1 1 1 PRT sp|Q9NZ01|TECR_HUMAN Very-long-chain enoyl-CoA reductase OS=Homo sapiens OX=9606 GN=TECR PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.07 25.0 3 2 1 PRT sp|Q15233-2|NONO_HUMAN Isoform 2 of Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 56-UNIMOD:4 0.15 25.0 12 6 3 PRT sp|P49959-3|MRE11_HUMAN Isoform 3 of Double-strand break repair protein MRE11 OS=Homo sapiens OX=9606 GN=MRE11 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.02 25.0 1 1 1 PRT sp|P18669|PGAM1_HUMAN Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.09 25.0 8 3 0 PRT sp|O43175|SERA_HUMAN D-3-phosphoglycerate dehydrogenase OS=Homo sapiens OX=9606 GN=PHGDH PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.06 25.0 7 3 0 PRT sp|P78527|PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 25.0 null 974-UNIMOD:4,1312-UNIMOD:4,491-UNIMOD:4,111-UNIMOD:4 0.03 25.0 15 10 6 PRT sp|Q14966-3|ZN638_HUMAN Isoform 3 of Zinc finger protein 638 OS=Homo sapiens OX=9606 GN=ZNF638 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.01 25.0 1 1 1 PRT sp|P50402|EMD_HUMAN Emerin OS=Homo sapiens OX=9606 GN=EMD PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.09 25.0 4 2 0 PRT sp|P45973|CBX5_HUMAN Chromobox protein homolog 5 OS=Homo sapiens OX=9606 GN=CBX5 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.06 25.0 2 1 0 PRT sp|Q9UKD2|MRT4_HUMAN mRNA turnover protein 4 homolog OS=Homo sapiens OX=9606 GN=MRTO4 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.05 25.0 2 1 0 PRT sp|P46060|RAGP1_HUMAN Ran GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RANGAP1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.02 25.0 2 1 0 PRT sp|Q15365|PCBP1_HUMAN Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 25.0 null 54-UNIMOD:4 0.10 25.0 11 3 0 PRT sp|O00299|CLIC1_HUMAN Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 24-UNIMOD:4 0.13 25.0 5 3 1 PRT sp|P07951-2|TPM2_HUMAN Isoform 2 of Tropomyosin beta chain OS=Homo sapiens OX=9606 GN=TPM2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.04 25.0 1 1 1 PRT sp|P23588|IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.04 25.0 3 2 1 PRT sp|O94979-2|SC31A_HUMAN Isoform 2 of Protein transport protein Sec31A OS=Homo sapiens OX=9606 GN=SEC31A null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.03 25.0 3 3 3 PRT sp|Q99460-2|PSMD1_HUMAN Isoform 2 of 26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 112-UNIMOD:4 0.02 25.0 1 1 1 PRT sp|O00116|ADAS_HUMAN Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Homo sapiens OX=9606 GN=AGPS PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.04 25.0 2 2 2 PRT sp|P15121|ALDR_HUMAN Aldose reductase OS=Homo sapiens OX=9606 GN=AKR1B1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 299-UNIMOD:4,304-UNIMOD:4 0.10 25.0 4 3 2 PRT sp|O95239-2|KIF4A_HUMAN Isoform 2 of Chromosome-associated kinesin KIF4A OS=Homo sapiens OX=9606 GN=KIF4A null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.02 25.0 2 2 2 PRT sp|P60660-2|MYL6_HUMAN Isoform Smooth muscle of Myosin light polypeptide 6 OS=Homo sapiens OX=9606 GN=MYL6 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.07 25.0 2 1 0 PRT sp|P32322-3|P5CR1_HUMAN Isoform 3 of Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PYCR1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.10 25.0 3 2 1 PRT sp|P28838-2|AMPL_HUMAN Isoform 2 of Cytosol aminopeptidase OS=Homo sapiens OX=9606 GN=LAP3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.06 25.0 2 2 2 PRT sp|Q9P2R7-2|SUCB1_HUMAN Isoform 2 of Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLA2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.02 25.0 1 1 1 PRT sp|P39748-2|FEN1_HUMAN Isoform FENMIT of Flap endonuclease 1 OS=Homo sapiens OX=9606 GN=FEN1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.05 25.0 2 1 0 PRT sp|Q9Y520-4|PRC2C_HUMAN Isoform 4 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 620-UNIMOD:4 0.02 25.0 3 3 3 PRT sp|P25788-2|PSA3_HUMAN Isoform 2 of Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.05 25.0 3 1 0 PRT sp|P11388-4|TOP2A_HUMAN Isoform 4 of DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 473-UNIMOD:4 0.01 25.0 3 3 2 PRT sp|Q6VMQ6-2|MCAF1_HUMAN Isoform 2 of Activating transcription factor 7-interacting protein 1 OS=Homo sapiens OX=9606 GN=ATF7IP null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.02 25.0 1 1 1 PRT sp|Q9UGP8|SEC63_HUMAN Translocation protein SEC63 homolog OS=Homo sapiens OX=9606 GN=SEC63 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 490-UNIMOD:4 0.03 25.0 1 1 1 PRT sp|O15355|PPM1G_HUMAN Protein phosphatase 1G OS=Homo sapiens OX=9606 GN=PPM1G PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.09 25.0 5 4 3 PRT sp|Q05682|CALD1_HUMAN Caldesmon OS=Homo sapiens OX=9606 GN=CALD1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 25.0 null 0.06 25.0 3 3 3 PRT sp|P22087|FBRL_HUMAN rRNA 2'-O-methyltransferase fibrillarin OS=Homo sapiens OX=9606 GN=FBL PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.05 25.0 3 1 0 PRT sp|Q96PZ0-2|PUS7_HUMAN Isoform 2 of Pseudouridylate synthase 7 homolog OS=Homo sapiens OX=9606 GN=PUS7 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.02 25.0 1 1 1 PRT sp|Q9UBF2-2|COPG2_HUMAN Isoform 2 of Coatomer subunit gamma-2 OS=Homo sapiens OX=9606 GN=COPG2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.04 25.0 3 3 3 PRT sp|Q6P1J9|CDC73_HUMAN Parafibromin OS=Homo sapiens OX=9606 GN=CDC73 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.04 25.0 3 2 1 PRT sp|Q9NY33-4|DPP3_HUMAN Isoform 4 of Dipeptidyl peptidase 3 OS=Homo sapiens OX=9606 GN=DPP3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.02 25.0 1 1 1 PRT sp|P31937|3HIDH_HUMAN 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HIBADH PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.04 25.0 1 1 1 PRT sp|O60610|DIAP1_HUMAN Protein diaphanous homolog 1 OS=Homo sapiens OX=9606 GN=DIAPH1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.01 25.0 1 1 1 PRT sp|P09525-2|ANXA4_HUMAN Isoform 2 of Annexin A4 OS=Homo sapiens OX=9606 GN=ANXA4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.05 25.0 1 1 1 PRT sp|Q6P2Q9|PRP8_HUMAN Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens OX=9606 GN=PRPF8 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.02 25.0 17 4 2 PRT sp|P00738|HPT_HUMAN Haptoglobin OS=Homo sapiens OX=9606 GN=HP PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.10 25.0 5 4 3 PRT sp|Q96FW1|OTUB1_HUMAN Ubiquitin thioesterase OTUB1 OS=Homo sapiens OX=9606 GN=OTUB1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 91-UNIMOD:4 0.09 25.0 3 2 1 PRT sp|P08574|CY1_HUMAN Cytochrome c1, heme protein, mitochondrial OS=Homo sapiens OX=9606 GN=CYC1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 139-UNIMOD:4 0.04 25.0 3 1 0 PRT sp|P28370|SMCA1_HUMAN Probable global transcription activator SNF2L1 OS=Homo sapiens OX=9606 GN=SMARCA1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.03 25.0 2 2 2 PRT sp|Q14152-2|EIF3A_HUMAN Isoform 2 of Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 44-UNIMOD:4 0.03 25.0 5 3 1 PRT sp|Q9UJS0-2|CMC2_HUMAN Isoform 2 of Calcium-binding mitochondrial carrier protein Aralar2 OS=Homo sapiens OX=9606 GN=SLC25A13 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.02 25.0 1 1 1 PRT sp|Q15813-2|TBCE_HUMAN Isoform 2 of Tubulin-specific chaperone E OS=Homo sapiens OX=9606 GN=TBCE null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25.0 null 0.02 25.0 1 1 1 PRT sp|P02787|TRFE_HUMAN Serotransferrin OS=Homo sapiens OX=9606 GN=TF PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 25.0 null 596-UNIMOD:4,260-UNIMOD:4 0.04 25.0 2 2 2 PRT sp|P27824|CALX_HUMAN Calnexin OS=Homo sapiens OX=9606 GN=CANX PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 25.0 null 0.02 25.0 2 1 0 PRT sp|Q14244|MAP7_HUMAN Ensconsin OS=Homo sapiens OX=9606 GN=MAP7 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 25.0 null 2-UNIMOD:1 0.02 25.0 1 1 1 PRT sp|Q96EP5|DAZP1_HUMAN DAZ-associated protein 1 OS=Homo sapiens OX=9606 GN=DAZAP1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 25.0 null 1-UNIMOD:1 0.03 25.0 1 1 1 PRT sp|Q99436|PSB7_HUMAN Proteasome subunit beta type-7 OS=Homo sapiens OX=9606 GN=PSMB7 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ] 25.0 null 0.08 25.0 2 2 2 PRT sp|P30626|SORCN_HUMAN Sorcin OS=Homo sapiens OX=9606 GN=SRI PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 25.0 null 0.06 25.0 1 1 0 PRT sp|Q5T280|CI114_HUMAN Putative methyltransferase C9orf114 OS=Homo sapiens OX=9606 GN=SPOUT1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 25.0 null 0.03 25.0 1 1 1 PRT sp|P29144|TPP2_HUMAN Tripeptidyl-peptidase 2 OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ] 25.0 null 209-UNIMOD:4 0.03 25.0 2 2 2 PRT sp|Q7Z3K3-2|POGZ_HUMAN Isoform 2 of Pogo transposable element with ZNF domain OS=Homo sapiens OX=9606 GN=POGZ null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.02 24.0 3 2 1 PRT sp|P62195-2|PRS8_HUMAN Isoform 2 of 26S proteasome regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMC5 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.04 24.0 1 1 1 PRT sp|P30153|2AAA_HUMAN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.06 24.0 4 3 2 PRT sp|P40227-2|TCPZ_HUMAN Isoform 2 of T-complex protein 1 subunit zeta OS=Homo sapiens OX=9606 GN=CCT6A null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.02 24.0 2 2 2 PRT sp|Q92616|GCN1_HUMAN eIF-2-alpha kinase activator GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=6 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.01 24.0 2 2 2 PRT sp|P62633-2|CNBP_HUMAN Isoform 2 of Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 133-UNIMOD:4,143-UNIMOD:4,151-UNIMOD:4 0.13 24.0 2 2 1 PRT sp|P40938-2|RFC3_HUMAN Isoform 2 of Replication factor C subunit 3 OS=Homo sapiens OX=9606 GN=RFC3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.10 24.0 2 2 1 PRT sp|P62805|H4_HUMAN Histone H4 OS=Homo sapiens OX=9606 GN=HIST1H4A PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 24.0 null 85-UNIMOD:35 0.58 24.0 15 7 4 PRT sp|Q96SQ9-2|CP2S1_HUMAN Isoform 2 of Cytochrome P450 2S1 OS=Homo sapiens OX=9606 GN=CYP2S1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.03 24.0 2 1 0 PRT sp|Q9H6K5-2|PRR36_HUMAN Isoform 2 of Proline-rich protein 36 OS=Homo sapiens OX=9606 GN=PRR36 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.01 24.0 1 1 1 PRT sp|Q99623|PHB2_HUMAN Prohibitin-2 OS=Homo sapiens OX=9606 GN=PHB2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.12 24.0 7 3 0 PRT sp|Q99798|ACON_HUMAN Aconitate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ACO2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.02 24.0 1 1 1 PRT sp|Q9NRX1|PNO1_HUMAN RNA-binding protein PNO1 OS=Homo sapiens OX=9606 GN=PNO1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.07 24.0 1 1 1 PRT sp|P15311|EZRI_HUMAN Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 24.0 null 0.09 24.0 6 6 6 PRT sp|P61006|RAB8A_HUMAN Ras-related protein Rab-8A OS=Homo sapiens OX=9606 GN=RAB8A PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.06 24.0 1 1 1 PRT sp|P61916|NPC2_HUMAN NPC intracellular cholesterol transporter 2 OS=Homo sapiens OX=9606 GN=NPC2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 99-UNIMOD:4 0.07 24.0 1 1 1 PRT sp|Q5VTE0|EF1A3_HUMAN Putative elongation factor 1-alpha-like 3 OS=Homo sapiens OX=9606 GN=EEF1A1P5 PE=5 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.09 24.0 11 4 0 PRT sp|Q86UE4|LYRIC_HUMAN Protein LYRIC OS=Homo sapiens OX=9606 GN=MTDH PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.07 24.0 3 3 3 PRT sp|Q01082-3|SPTB2_HUMAN Isoform 2 of Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 99-UNIMOD:4,1887-UNIMOD:4 0.08 24.0 18 16 14 PRT sp|Q07157-2|ZO1_HUMAN Isoform Short of Tight junction protein ZO-1 OS=Homo sapiens OX=9606 GN=TJP1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.03 24.0 3 3 3 PRT sp|P49915|GUAA_HUMAN GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.03 24.0 3 2 1 PRT sp|P31040-2|SDHA_HUMAN Isoform 2 of Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHA null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 488-UNIMOD:4 0.02 24.0 2 1 0 PRT sp|P26373|RL13_HUMAN 60S ribosomal protein L13 OS=Homo sapiens OX=9606 GN=RPL13 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.06 24.0 2 1 0 PRT sp|Q15020-4|SART3_HUMAN Isoform 4 of Squamous cell carcinoma antigen recognized by T-cells 3 OS=Homo sapiens OX=9606 GN=SART3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.03 24.0 2 2 2 PRT sp|P99999|CYC_HUMAN Cytochrome c OS=Homo sapiens OX=9606 GN=CYCS PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.14 24.0 2 1 0 PRT sp|Q9UQ35|SRRM2_HUMAN Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.01 24.0 3 2 1 PRT sp|Q12788|TBL3_HUMAN Transducin beta-like protein 3 OS=Homo sapiens OX=9606 GN=TBL3 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.02 24.0 1 1 1 PRT sp|P22061|PIMT_HUMAN Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Homo sapiens OX=9606 GN=PCMT1 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1000663, ProteinPilot, ] 24.0 null 0.07 24.0 1 1 0 PRT sp|P61604|CH10_HUMAN 10 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPE1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.27 24.0 4 3 2 PRT sp|P12956-2|XRCC6_HUMAN Isoform 2 of X-ray repair cross-complementing protein 6 OS=Homo sapiens OX=9606 GN=XRCC6 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.04 24.0 4 2 0 PRT sp|Q9ULD0|OGDHL_HUMAN 2-oxoglutarate dehydrogenase-like, mitochondrial OS=Homo sapiens OX=9606 GN=OGDHL PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.01 24.0 1 1 1 PRT sp|Q15418-4|KS6A1_HUMAN Isoform 4 of Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens OX=9606 GN=RPS6KA1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.02 24.0 1 1 1 PRT sp|Q96KR1|ZFR_HUMAN Zinc finger RNA-binding protein OS=Homo sapiens OX=9606 GN=ZFR PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.03 24.0 2 2 2 PRT sp|P12270|TPR_HUMAN Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 1127-UNIMOD:4 0.02 24.0 5 5 5 PRT sp|O00425|IF2B3_HUMAN Insulin-like growth factor 2 mRNA-binding protein 3 OS=Homo sapiens OX=9606 GN=IGF2BP3 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 194-UNIMOD:4 0.08 24.0 6 4 2 PRT sp|Q9UBM7|DHCR7_HUMAN 7-dehydrocholesterol reductase OS=Homo sapiens OX=9606 GN=DHCR7 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 24.0 null 380-UNIMOD:4 0.05 24.0 2 2 2 PRT sp|Q5JNZ5|RS26L_HUMAN Putative 40S ribosomal protein S26-like 1 OS=Homo sapiens OX=9606 GN=RPS26P11 PE=5 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 74-UNIMOD:4,77-UNIMOD:4 0.20 24.0 4 2 1 PRT sp|Q07020-2|RL18_HUMAN Isoform 2 of 60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.07 24.0 2 1 0 PRT sp|P53396|ACLY_HUMAN ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 229-UNIMOD:4 0.04 24.0 6 4 2 PRT sp|O95292|VAPB_HUMAN Vesicle-associated membrane protein-associated protein B/C OS=Homo sapiens OX=9606 GN=VAPB PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.06 24.0 1 1 1 PRT sp|Q06203|PUR1_HUMAN Amidophosphoribosyltransferase OS=Homo sapiens OX=9606 GN=PPAT PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.03 24.0 1 1 1 PRT sp|P17302|CXA1_HUMAN Gap junction alpha-1 protein OS=Homo sapiens OX=9606 GN=GJA1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.04 24.0 2 1 0 PRT sp|Q9UJQ4|SALL4_HUMAN Sal-like protein 4 OS=Homo sapiens OX=9606 GN=SALL4 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 568-UNIMOD:4,571-UNIMOD:4 0.01 24.0 1 1 1 PRT sp|Q9H4A3-2|WNK1_HUMAN Isoform 2 of Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.01 24.0 2 2 2 PRT sp|P61981|1433G_HUMAN 14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ] 24.0 null 2-UNIMOD:1 0.13 24.0 7 3 0 PRT sp|P07910-2|HNRPC_HUMAN Isoform C1 of Heterogeneous nuclear ribonucleoproteins C1/C2 OS=Homo sapiens OX=9606 GN=HNRNPC null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.16 24.0 7 4 2 PRT sp|Q07812-2|BAX_HUMAN Isoform Beta of Apoptosis regulator BAX OS=Homo sapiens OX=9606 GN=BAX null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.06 24.0 1 1 1 PRT sp|Q9UHX1-2|PUF60_HUMAN Isoform 2 of Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.02 24.0 2 1 0 PRT sp|Q9NPJ6|MED4_HUMAN Mediator of RNA polymerase II transcription subunit 4 OS=Homo sapiens OX=9606 GN=MED4 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.06 24.0 1 1 1 PRT sp|P19367-4|HXK1_HUMAN Isoform 4 of Hexokinase-1 OS=Homo sapiens OX=9606 GN=HK1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 811-UNIMOD:4 0.04 24.0 5 3 2 PRT sp|P37802-2|TAGL2_HUMAN Isoform 2 of Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.05 24.0 1 1 1 PRT sp|Q13242|SRSF9_HUMAN Serine/arginine-rich splicing factor 9 OS=Homo sapiens OX=9606 GN=SRSF9 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 138-UNIMOD:4,80-UNIMOD:4 0.19 24.0 8 4 2 PRT sp|O95218-2|ZRAB2_HUMAN Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 74-UNIMOD:4 0.11 24.0 3 3 3 PRT sp|Q96C86|DCPS_HUMAN m7GpppX diphosphatase OS=Homo sapiens OX=9606 GN=DCPS PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.08 24.0 3 2 1 PRT sp|Q02880-2|TOP2B_HUMAN Isoform Beta-1 of DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 GN=TOP2B null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 266-UNIMOD:4 0.02 24.0 3 3 3 PRT sp|Q5T0N5-2|FBP1L_HUMAN Isoform 2 of Formin-binding protein 1-like OS=Homo sapiens OX=9606 GN=FNBP1L null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.02 24.0 1 1 1 PRT sp|Q8NFI4|F10A5_HUMAN Putative protein FAM10A5 OS=Homo sapiens OX=9606 GN=ST13P5 PE=5 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.04 24.0 2 1 0 PRT sp|Q9H583|HEAT1_HUMAN HEAT repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=HEATR1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 1143-UNIMOD:4 0.01 24.0 2 2 2 PRT sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens OX=9606 GN=NLE1 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 251-UNIMOD:4 0.03 24.0 1 1 1 PRT sp|Q14498-2|RBM39_HUMAN Isoform 2 of RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.06 24.0 4 3 2 PRT sp|Q14696|MESD_HUMAN LRP chaperone MESD OS=Homo sapiens OX=9606 GN=MESD PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.10 24.0 3 2 1 PRT sp|Q16651|PRSS8_HUMAN Prostasin OS=Homo sapiens OX=9606 GN=PRSS8 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.04 24.0 1 1 1 PRT sp|Q9UNM6-2|PSD13_HUMAN Isoform 2 of 26S proteasome non-ATPase regulatory subunit 13 OS=Homo sapiens OX=9606 GN=PSMD13 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 116-UNIMOD:4 0.06 24.0 2 2 2 PRT sp|P49591|SYSC_HUMAN Serine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=SARS PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 395-UNIMOD:4,398-UNIMOD:4 0.03 24.0 1 1 1 PRT sp|Q9Y2W1|TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 24.0 null 0.08 24.0 7 6 5 PRT sp|Q14677-2|EPN4_HUMAN Isoform 2 of Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=CLINT1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.06 24.0 3 3 3 PRT sp|P18085|ARF4_HUMAN ADP-ribosylation factor 4 OS=Homo sapiens OX=9606 GN=ARF4 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.06 24.0 2 1 0 PRT sp|P55036|PSMD4_HUMAN 26S proteasome non-ATPase regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMD4 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.03 24.0 1 1 1 PRT sp|Q9NUL3-2|STAU2_HUMAN Isoform 2 of Double-stranded RNA-binding protein Staufen homolog 2 OS=Homo sapiens OX=9606 GN=STAU2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.02 24.0 1 1 1 PRT sp|Q9H3N1|TMX1_HUMAN Thioredoxin-related transmembrane protein 1 OS=Homo sapiens OX=9606 GN=TMX1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.13 24.0 7 3 0 PRT sp|Q15149|PLEC_HUMAN Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.01 24.0 5 5 5 PRT sp|Q14203-2|DCTN1_HUMAN Isoform p135 of Dynactin subunit 1 OS=Homo sapiens OX=9606 GN=DCTN1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.02 24.0 2 2 2 PRT sp|Q9NWH9|SLTM_HUMAN SAFB-like transcription modulator OS=Homo sapiens OX=9606 GN=SLTM PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.03 24.0 2 2 2 PRT sp|P07602-2|SAP_HUMAN Isoform Sap-mu-6 of Prosaposin OS=Homo sapiens OX=9606 GN=PSAP null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 411-UNIMOD:4,414-UNIMOD:4,63-UNIMOD:4,66-UNIMOD:4 0.04 24.0 3 3 3 PRT sp|Q9BZK7|TBL1R_HUMAN F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens OX=9606 GN=TBL1XR1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 0.03 24.0 1 1 1 PRT sp|Q02252-2|MMSA_HUMAN Isoform 2 of Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Homo sapiens OX=9606 GN=ALDH6A1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24.0 null 355-UNIMOD:4 0.02 24.0 2 2 2 PRT sp|Q12906|ILF3_HUMAN Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 24.0 null 0.01 24.0 1 1 0 PRT sp|P29401|TKT_HUMAN Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 24.0 null 1-UNIMOD:1 0.02 24.0 1 1 1 PRT sp|Q13885|TBB2A_HUMAN Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 24.0 null 354-UNIMOD:4 0.02 24.0 16 1 0 PRT sp|O43491-4|E41L2_HUMAN Isoform 4 of Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ],[MS, MS:1001207, Mascot, ] 24.0 null 2-UNIMOD:1 0.07 24.0 6 4 2 PRT sp|O94888|UBXN7_HUMAN UBX domain-containing protein 7 OS=Homo sapiens OX=9606 GN=UBXN7 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ],[MS, MS:1001207, Mascot, ] 24.0 null 2-UNIMOD:1 0.06 24.0 2 2 2 PRT sp|P30566|PUR8_HUMAN Adenylosuccinate lyase OS=Homo sapiens OX=9606 GN=ADSL PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ],[MS, MS:1001207, Mascot, ] 24.0 null 2-UNIMOD:1 0.08 24.0 5 3 1 PRT sp|P82979|SARNP_HUMAN SAP domain-containing ribonucleoprotein OS=Homo sapiens OX=9606 GN=SARNP PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ],[MS, MS:1001207, Mascot, ] 24.0 null 2-UNIMOD:1 0.10 24.0 3 2 1 PRT sp|P63218|GBG5_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5 OS=Homo sapiens OX=9606 GN=GNG5 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 24.0 null 2-UNIMOD:1 0.16 24.0 1 1 1 PRT sp|O75369|FLNB_HUMAN Filamin-B OS=Homo sapiens OX=9606 GN=FLNB PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 24.0 null 0.00 24.0 1 1 1 PRT sp|P61313|RL15_HUMAN 60S ribosomal protein L15 OS=Homo sapiens OX=9606 GN=RPL15 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1000663, ProteinPilot, ] 23.0 null 0.21 23.0 7 4 2 PRT sp|P34897-2|GLYM_HUMAN Isoform 2 of Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=SHMT2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 231-UNIMOD:4 0.08 23.0 4 4 4 PRT sp|Q9UBE0-2|SAE1_HUMAN Isoform 2 of SUMO-activating enzyme subunit 1 OS=Homo sapiens OX=9606 GN=SAE1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.05 23.0 1 1 1 PRT sp|Q9UKE5-2|TNIK_HUMAN Isoform 2 of TRAF2 and NCK-interacting protein kinase OS=Homo sapiens OX=9606 GN=TNIK null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.02 23.0 2 2 2 PRT sp|P60953|CDC42_HUMAN Cell division control protein 42 homolog OS=Homo sapiens OX=9606 GN=CDC42 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 157-UNIMOD:4,6-UNIMOD:4 0.18 23.0 3 3 3 PRT sp|Q9Y490|TLN1_HUMAN Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 1927-UNIMOD:4 0.03 23.0 5 5 5 PRT sp|Q92922|SMRC1_HUMAN SWI/SNF complex subunit SMARCC1 OS=Homo sapiens OX=9606 GN=SMARCC1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.01 23.0 1 1 1 PRT sp|Q16576-2|RBBP7_HUMAN Isoform 2 of Histone-binding protein RBBP7 OS=Homo sapiens OX=9606 GN=RBBP7 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 210-UNIMOD:4 0.04 23.0 2 1 0 PRT sp|Q9NR31-2|SAR1A_HUMAN Isoform 2 of GTP-binding protein SAR1a OS=Homo sapiens OX=9606 GN=SAR1A null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.08 23.0 1 1 1 PRT sp|Q14244-7|MAP7_HUMAN Isoform 7 of Ensconsin OS=Homo sapiens OX=9606 GN=MAP7 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.03 23.0 2 2 2 PRT sp|O00571-2|DDX3X_HUMAN Isoform 2 of ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 301-UNIMOD:4 0.07 23.0 4 4 4 PRT sp|Q00839|HNRPU_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 389-UNIMOD:4,391-UNIMOD:4,607-UNIMOD:4 0.06 23.0 12 5 0 PRT sp|Q9GZR7|DDX24_HUMAN ATP-dependent RNA helicase DDX24 OS=Homo sapiens OX=9606 GN=DDX24 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.03 23.0 2 2 2 PRT sp|P16989-2|YBOX3_HUMAN Isoform 2 of Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.05 23.0 2 1 0 PRT sp|P61254|RL26_HUMAN 60S ribosomal protein L26 OS=Homo sapiens OX=9606 GN=RPL26 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.31 23.0 8 5 4 PRT sp|P08758|ANXA5_HUMAN Annexin A5 OS=Homo sapiens OX=9606 GN=ANXA5 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.07 23.0 5 2 1 PRT sp|Q13283|G3BP1_HUMAN Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 73-UNIMOD:4 0.03 23.0 2 1 0 PRT sp|P84098|RL19_HUMAN 60S ribosomal protein L19 OS=Homo sapiens OX=9606 GN=RPL19 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 23.0 null 0.10 23.0 5 2 1 PRT sp|P62495-2|ERF1_HUMAN Isoform 2 of Eukaryotic peptide chain release factor subunit 1 OS=Homo sapiens OX=9606 GN=ETF1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 302-UNIMOD:4 0.03 23.0 1 1 1 PRT sp|Q9H4L7-2|SMRCD_HUMAN Isoform 2 of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens OX=9606 GN=SMARCAD1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.01 23.0 1 1 1 PRT sp|Q9UHD8|SEPT9_HUMAN Septin-9 OS=Homo sapiens OX=9606 GN=SEPT9 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 23.0 null 0.10 23.0 12 5 4 PRT sp|Q16891-2|MIC60_HUMAN Isoform 2 of MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.09 23.0 6 6 5 PRT sp|Q96QR8|PURB_HUMAN Transcriptional activator protein Pur-beta OS=Homo sapiens OX=9606 GN=PURB PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.04 23.0 1 1 1 PRT sp|Q12841|FSTL1_HUMAN Follistatin-related protein 1 OS=Homo sapiens OX=9606 GN=FSTL1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 98-UNIMOD:4 0.08 23.0 2 2 2 PRT sp|Q96IZ0|PAWR_HUMAN PRKC apoptosis WT1 regulator protein OS=Homo sapiens OX=9606 GN=PAWR PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.04 23.0 2 1 0 PRT sp|Q99729-2|ROAA_HUMAN Isoform 2 of Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens OX=9606 GN=HNRNPAB null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.04 23.0 2 1 0 PRT sp|P56192|SYMC_HUMAN Methionine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=MARS PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.04 23.0 3 3 3 PRT sp|P31948|STIP1_HUMAN Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 461-UNIMOD:4 0.08 23.0 6 4 3 PRT sp|O95777|LSM8_HUMAN U6 snRNA-associated Sm-like protein LSm8 OS=Homo sapiens OX=9606 GN=LSM8 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.11 23.0 1 1 1 PRT sp|Q14247|SRC8_HUMAN Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.02 23.0 2 1 0 PRT sp|Q01860|PO5F1_HUMAN POU domain, class 5, transcription factor 1 OS=Homo sapiens OX=9606 GN=POU5F1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 185-UNIMOD:4 0.09 23.0 4 3 2 PRT sp|O75347|TBCA_HUMAN Tubulin-specific chaperone A OS=Homo sapiens OX=9606 GN=TBCA PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.31 23.0 4 4 4 PRT sp|O60524-3|NEMF_HUMAN Isoform 3 of Nuclear export mediator factor NEMF OS=Homo sapiens OX=9606 GN=NEMF null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.01 23.0 1 1 1 PRT sp|Q9UIA9|XPO7_HUMAN Exportin-7 OS=Homo sapiens OX=9606 GN=XPO7 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.01 23.0 1 1 1 PRT sp|Q15417|CNN3_HUMAN Calponin-3 OS=Homo sapiens OX=9606 GN=CNN3 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 173-UNIMOD:4 0.12 23.0 4 3 2 PRT sp|P52907|CAZA1_HUMAN F-actin-capping protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=CAPZA1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.06 23.0 2 1 0 PRT sp|P22061-2|PIMT_HUMAN Isoform 2 of Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Homo sapiens OX=9606 GN=PCMT1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.11 23.0 2 2 1 PRT sp|P47897-2|SYQ_HUMAN Isoform 2 of Glutamine--tRNA ligase OS=Homo sapiens OX=9606 GN=QARS null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.04 23.0 3 3 3 PRT sp|P62995-3|TRA2B_HUMAN Isoform 3 of Transformer-2 protein homolog beta OS=Homo sapiens OX=9606 GN=TRA2B null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.18 23.0 5 4 3 PRT sp|P49773|HINT1_HUMAN Histidine triad nucleotide-binding protein 1 OS=Homo sapiens OX=9606 GN=HINT1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 84-UNIMOD:4 0.08 23.0 2 1 0 PRT sp|Q9BWF3|RBM4_HUMAN RNA-binding protein 4 OS=Homo sapiens OX=9606 GN=RBM4 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 89-UNIMOD:4 0.07 23.0 3 2 1 PRT sp|Q9BUJ2-2|HNRL1_HUMAN Isoform 2 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.04 23.0 3 3 3 PRT sp|P61011|SRP54_HUMAN Signal recognition particle 54 kDa protein OS=Homo sapiens OX=9606 GN=SRP54 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.03 23.0 3 1 0 PRT sp|Q9NQC3|RTN4_HUMAN Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.01 23.0 1 1 1 PRT sp|B5ME19|EIFCL_HUMAN Eukaryotic translation initiation factor 3 subunit C-like protein OS=Homo sapiens OX=9606 GN=EIF3CL PE=3 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.04 23.0 3 3 3 PRT sp|Q8WUB8-2|PHF10_HUMAN Isoform 2 of PHD finger protein 10 OS=Homo sapiens OX=9606 GN=PHF10 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.02 23.0 1 1 1 PRT sp|P09104-2|ENOG_HUMAN Isoform 2 of Gamma-enolase OS=Homo sapiens OX=9606 GN=ENO2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.06 23.0 2 2 2 PRT sp|Q14692|BMS1_HUMAN Ribosome biogenesis protein BMS1 homolog OS=Homo sapiens OX=9606 GN=BMS1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 556-UNIMOD:4 0.03 23.0 3 3 3 PRT sp|O43719|HTSF1_HUMAN HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.02 23.0 1 1 1 PRT sp|P46937-2|YAP1_HUMAN Isoform 2 of Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.06 23.0 2 2 2 PRT sp|Q99714-2|HCD2_HUMAN Isoform 2 of 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Homo sapiens OX=9606 GN=HSD17B10 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.12 23.0 3 2 1 PRT sp|Q4VC31|CCD58_HUMAN Coiled-coil domain-containing protein 58 OS=Homo sapiens OX=9606 GN=CCDC58 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 74-UNIMOD:4 0.08 23.0 1 1 1 PRT sp|P43246-2|MSH2_HUMAN Isoform 2 of DNA mismatch repair protein Msh2 OS=Homo sapiens OX=9606 GN=MSH2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 338-UNIMOD:4 0.03 23.0 3 2 1 PRT sp|O75330-3|HMMR_HUMAN Isoform 3 of Hyaluronan mediated motility receptor OS=Homo sapiens OX=9606 GN=HMMR null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.02 23.0 1 1 1 PRT sp|P09493-5|TPM1_HUMAN Isoform 5 of Tropomyosin alpha-1 chain OS=Homo sapiens OX=9606 GN=TPM1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.05 23.0 1 1 1 PRT sp|P62266|RS23_HUMAN 40S ribosomal protein S23 OS=Homo sapiens OX=9606 GN=RPS23 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.17 23.0 2 2 2 PRT sp|Q04637-9|IF4G1_HUMAN Isoform 9 of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.07 23.0 14 9 8 PRT sp|Q8TED0-3|UTP15_HUMAN Isoform 3 of U3 small nucleolar RNA-associated protein 15 homolog OS=Homo sapiens OX=9606 GN=UTP15 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.02 23.0 1 1 1 PRT sp|P11717|MPRI_HUMAN Cation-independent mannose-6-phosphate receptor OS=Homo sapiens OX=9606 GN=IGF2R PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 531-UNIMOD:4,538-UNIMOD:4,1217-UNIMOD:4,475-UNIMOD:4 0.02 23.0 4 4 4 PRT sp|P62241|RS8_HUMAN 40S ribosomal protein S8 OS=Homo sapiens OX=9606 GN=RPS8 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.05 23.0 2 1 0 PRT sp|Q9UPN3|MACF1_HUMAN Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.00 23.0 3 3 3 PRT sp|P17812|PYRG1_HUMAN CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.02 23.0 1 1 1 PRT sp|Q9HAU0-2|PKHA5_HUMAN Isoform 2 of Pleckstrin homology domain-containing family A member 5 OS=Homo sapiens OX=9606 GN=PLEKHA5 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.02 23.0 2 2 2 PRT sp|Q14204|DYHC1_HUMAN Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.02 23.0 8 7 6 PRT sp|A1X283|SPD2B_HUMAN SH3 and PX domain-containing protein 2B OS=Homo sapiens OX=9606 GN=SH3PXD2B PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.04 23.0 3 3 3 PRT sp|P62316|SMD2_HUMAN Small nuclear ribonucleoprotein Sm D2 OS=Homo sapiens OX=9606 GN=SNRPD2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 46-UNIMOD:4,63-UNIMOD:4 0.28 23.0 7 3 1 PRT sp|P10253|LYAG_HUMAN Lysosomal alpha-glucosidase OS=Homo sapiens OX=9606 GN=GAA PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.01 23.0 1 1 1 PRT sp|O60870-2|KIN17_HUMAN Isoform 2 of DNA/RNA-binding protein KIN17 OS=Homo sapiens OX=9606 GN=KIN null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.03 23.0 1 1 1 PRT sp|Q15654|TRIP6_HUMAN Thyroid receptor-interacting protein 6 OS=Homo sapiens OX=9606 GN=TRIP6 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 339-UNIMOD:4,342-UNIMOD:4 0.03 23.0 1 1 1 PRT sp|Q13895|BYST_HUMAN Bystin OS=Homo sapiens OX=9606 GN=BYSL PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.08 23.0 3 2 1 PRT sp|Q9Y3D6|FIS1_HUMAN Mitochondrial fission 1 protein OS=Homo sapiens OX=9606 GN=FIS1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.09 23.0 1 1 1 PRT sp|O15143|ARC1B_HUMAN Actin-related protein 2/3 complex subunit 1B OS=Homo sapiens OX=9606 GN=ARPC1B PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.05 23.0 1 1 1 PRT sp|P09382|LEG1_HUMAN Galectin-1 OS=Homo sapiens OX=9606 GN=LGALS1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 61-UNIMOD:4 0.19 23.0 2 2 2 PRT sp|P50991|TCPD_HUMAN T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 295-UNIMOD:4 0.04 23.0 4 2 0 PRT sp|Q9H201|EPN3_HUMAN Epsin-3 OS=Homo sapiens OX=9606 GN=EPN3 PE=2 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.02 23.0 1 1 1 PRT sp|P15559-2|NQO1_HUMAN Isoform 2 of NAD(P)H dehydrogenase [quinone] 1 OS=Homo sapiens OX=9606 GN=NQO1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.06 23.0 1 1 1 PRT sp|P32119|PRDX2_HUMAN Peroxiredoxin-2 OS=Homo sapiens OX=9606 GN=PRDX2 PE=1 SV=5 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.15 23.0 7 3 0 PRT sp|P61289-3|PSME3_HUMAN Isoform 3 of Proteasome activator complex subunit 3 OS=Homo sapiens OX=9606 GN=PSME3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 103-UNIMOD:4 0.05 23.0 1 1 1 PRT sp|O75530-2|EED_HUMAN Isoform 2 of Polycomb protein EED OS=Homo sapiens OX=9606 GN=EED null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 126-UNIMOD:4 0.03 23.0 1 1 1 PRT sp|P62979|RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens OX=9606 GN=RPS27A PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.06 23.0 2 1 0 PRT sp|P57088|TMM33_HUMAN Transmembrane protein 33 OS=Homo sapiens OX=9606 GN=TMEM33 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.04 23.0 3 1 0 PRT sp|P62899|RL31_HUMAN 60S ribosomal protein L31 OS=Homo sapiens OX=9606 GN=RPL31 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.30 23.0 6 4 3 PRT sp|Q07866-10|KLC1_HUMAN Isoform D of Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.04 23.0 2 2 2 PRT sp|Q9BT78|CSN4_HUMAN COP9 signalosome complex subunit 4 OS=Homo sapiens OX=9606 GN=COPS4 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.06 23.0 2 2 2 PRT sp|P49189|AL9A1_HUMAN 4-trimethylaminobutyraldehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH9A1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 45-UNIMOD:4 0.02 23.0 2 1 0 PRT sp|Q9Y450-4|HBS1L_HUMAN Isoform 3 of HBS1-like protein OS=Homo sapiens OX=9606 GN=HBS1L null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.02 23.0 1 1 1 PRT sp|P50454|SERPH_HUMAN Serpin H1 OS=Homo sapiens OX=9606 GN=SERPINH1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.03 23.0 4 1 0 PRT sp|O43837-2|IDH3B_HUMAN Isoform A of Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3B null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.04 23.0 1 1 1 PRT sp|Q99584|S10AD_HUMAN Protein S100-A13 OS=Homo sapiens OX=9606 GN=S100A13 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.12 23.0 1 1 1 PRT sp|Q8N163|CCAR2_HUMAN Cell cycle and apoptosis regulator protein 2 OS=Homo sapiens OX=9606 GN=CCAR2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 754-UNIMOD:4 0.02 23.0 3 2 1 PRT sp|Q96B26|EXOS8_HUMAN Exosome complex component RRP43 OS=Homo sapiens OX=9606 GN=EXOSC8 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.05 23.0 2 1 0 PRT sp|O94905|ERLN2_HUMAN Erlin-2 OS=Homo sapiens OX=9606 GN=ERLIN2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.04 23.0 2 1 0 PRT sp|Q16181-2|SEPT7_HUMAN Isoform 2 of Septin-7 OS=Homo sapiens OX=9606 GN=SEPT7 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 203-UNIMOD:4 0.07 23.0 2 2 1 PRT sp|P53041|PPP5_HUMAN Serine/threonine-protein phosphatase 5 OS=Homo sapiens OX=9606 GN=PPP5C PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 404-UNIMOD:4 0.03 23.0 2 1 0 PRT sp|O15145|ARPC3_HUMAN Actin-related protein 2/3 complex subunit 3 OS=Homo sapiens OX=9606 GN=ARPC3 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 23.0 null 0.15 23.0 2 2 2 PRT sp|P16615-4|AT2A2_HUMAN Isoform 4 of Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens OX=9606 GN=ATP2A2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 337-UNIMOD:4 0.03 23.0 2 2 2 PRT sp|P49642|PRI1_HUMAN DNA primase small subunit OS=Homo sapiens OX=9606 GN=PRIM1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.03 23.0 1 1 1 PRT sp|Q9UKV3|ACINU_HUMAN Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.02 23.0 3 3 3 PRT sp|Q92499-3|DDX1_HUMAN Isoform 3 of ATP-dependent RNA helicase DDX1 OS=Homo sapiens OX=9606 GN=DDX1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 414-UNIMOD:4,416-UNIMOD:4 0.06 23.0 3 3 3 PRT sp|Q15029-2|U5S1_HUMAN Isoform 2 of 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens OX=9606 GN=EFTUD2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.02 23.0 3 2 1 PRT sp|P35606|COPB2_HUMAN Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.03 23.0 3 2 1 PRT sp|Q9HB71|CYBP_HUMAN Calcyclin-binding protein OS=Homo sapiens OX=9606 GN=CACYBP PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.09 23.0 2 2 2 PRT sp|Q8IZ40|RCOR2_HUMAN REST corepressor 2 OS=Homo sapiens OX=9606 GN=RCOR2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.02 23.0 1 1 1 PRT sp|Q9BWH2|FUND2_HUMAN FUN14 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FUNDC2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23.0 null 0.07 23.0 1 1 1 PRT sp|Q9P0L0|VAPA_HUMAN Vesicle-associated membrane protein-associated protein A OS=Homo sapiens OX=9606 GN=VAPA PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ],[MS, MS:1001207, Mascot, ] 23.0 null 0.12 23.0 5 3 1 PRT sp|Q8IWC1|MA7D3_HUMAN MAP7 domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MAP7D3 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 23.0 null 3-UNIMOD:1 0.02 23.0 1 1 1 PRT sp|Q9P289|STK26_HUMAN Serine/threonine-protein kinase 26 OS=Homo sapiens OX=9606 GN=STK26 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ] 23.0 null 0.05 23.0 2 2 2 PRT sp|O00505|IMA4_HUMAN Importin subunit alpha-4 OS=Homo sapiens OX=9606 GN=KPNA3 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 23.0 null 2-UNIMOD:1 0.02 23.0 1 1 1 PRT sp|P35580|MYH10_HUMAN Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 23.0 null 164-UNIMOD:4,176-UNIMOD:4 0.02 23.0 3 3 2 PRT sp|P33316|DUT_HUMAN Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.04 22.0 1 1 1 PRT sp|Q9NRN7|ADPPT_HUMAN L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase OS=Homo sapiens OX=9606 GN=AASDHPPT PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.05 22.0 1 1 1 PRT sp|Q8IX01-3|SUGP2_HUMAN Isoform 3 of SURP and G-patch domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SUGP2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 656-UNIMOD:4 0.04 22.0 3 3 3 PRT sp|Q01105|SET_HUMAN Protein SET OS=Homo sapiens OX=9606 GN=SET PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.03 22.0 2 1 0 PRT sp|P62753|RS6_HUMAN 40S ribosomal protein S6 OS=Homo sapiens OX=9606 GN=RPS6 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 100-UNIMOD:4 0.11 22.0 2 2 2 PRT sp|P62826|RAN_HUMAN GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.05 22.0 3 1 0 PRT sp|Q01518-2|CAP1_HUMAN Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 415-UNIMOD:4,355-UNIMOD:4,374-UNIMOD:4 0.09 22.0 7 4 2 PRT sp|Q08257|QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens OX=9606 GN=CRYZ PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.09 22.0 2 2 2 PRT sp|P55265-4|DSRAD_HUMAN Isoform 4 of Double-stranded RNA-specific adenosine deaminase OS=Homo sapiens OX=9606 GN=ADAR null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.02 22.0 2 2 2 PRT sp|O00567|NOP56_HUMAN Nucleolar protein 56 OS=Homo sapiens OX=9606 GN=NOP56 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 142-UNIMOD:4 0.06 22.0 4 3 2 PRT sp|P08708|RS17_HUMAN 40S ribosomal protein S17 OS=Homo sapiens OX=9606 GN=RPS17 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.07 22.0 1 1 1 PRT sp|Q9BYC9|RM20_HUMAN 39S ribosomal protein L20, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL20 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.08 22.0 1 1 1 PRT sp|Q8TDN6|BRX1_HUMAN Ribosome biogenesis protein BRX1 homolog OS=Homo sapiens OX=9606 GN=BRIX1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.03 22.0 1 1 1 PRT sp|Q9NUQ6-3|SPS2L_HUMAN Isoform 3 of SPATS2-like protein OS=Homo sapiens OX=9606 GN=SPATS2L null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.02 22.0 1 1 1 PRT sp|Q14847-2|LASP1_HUMAN Isoform 2 of LIM and SH3 domain protein 1 OS=Homo sapiens OX=9606 GN=LASP1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 53-UNIMOD:4,29-UNIMOD:4,32-UNIMOD:4,35-UNIMOD:4 0.13 22.0 5 4 3 PRT sp|Q9NRX4-2|PHP14_HUMAN Isoform 2 of 14 kDa phosphohistidine phosphatase OS=Homo sapiens OX=9606 GN=PHPT1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 69-UNIMOD:4,71-UNIMOD:4,73-UNIMOD:4 0.10 22.0 1 1 1 PRT sp|P0DN76|U2AF5_HUMAN Splicing factor U2AF 35 kDa subunit-like protein OS=Homo sapiens OX=9606 GN=U2AF1L5 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.10 22.0 2 2 2 PRT sp|P35222|CTNB1_HUMAN Catenin beta-1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.03 22.0 2 2 2 PRT sp|Q9P2J5-2|SYLC_HUMAN Isoform 2 of Leucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=LARS null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 882-UNIMOD:4,1039-UNIMOD:4 0.04 22.0 4 4 3 PRT sp|O14974-2|MYPT1_HUMAN Isoform 2 of Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.03 22.0 2 2 2 PRT sp|P13797-2|PLST_HUMAN Isoform 2 of Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.03 22.0 2 2 2 PRT sp|P52732|KIF11_HUMAN Kinesin-like protein KIF11 OS=Homo sapiens OX=9606 GN=KIF11 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.01 22.0 1 1 1 PRT sp|Q9BZE4|NOG1_HUMAN Nucleolar GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=GTPBP4 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.02 22.0 1 1 1 PRT sp|Q15008-2|PSMD6_HUMAN Isoform 2 of 26S proteasome non-ATPase regulatory subunit 6 OS=Homo sapiens OX=9606 GN=PSMD6 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.04 22.0 1 1 1 PRT sp|Q9Y262|EIF3L_HUMAN Eukaryotic translation initiation factor 3 subunit L OS=Homo sapiens OX=9606 GN=EIF3L PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.04 22.0 2 2 2 PRT sp|P51659-2|DHB4_HUMAN Isoform 2 of Peroxisomal multifunctional enzyme type 2 OS=Homo sapiens OX=9606 GN=HSD17B4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 214-UNIMOD:4 0.06 22.0 4 3 2 PRT sp|P48643|TCPE_HUMAN T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.04 22.0 3 2 1 PRT sp|O14602|IF1AY_HUMAN Eukaryotic translation initiation factor 1A, Y-chromosomal OS=Homo sapiens OX=9606 GN=EIF1AY PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.08 22.0 1 1 1 PRT sp|O96019-2|ACL6A_HUMAN Isoform 2 of Actin-like protein 6A OS=Homo sapiens OX=9606 GN=ACTL6A null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.03 22.0 1 1 1 PRT sp|O60884|DNJA2_HUMAN DnaJ homolog subfamily A member 2 OS=Homo sapiens OX=9606 GN=DNAJA2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 143-UNIMOD:4,146-UNIMOD:4 0.06 22.0 3 2 1 PRT sp|P53985|MOT1_HUMAN Monocarboxylate transporter 1 OS=Homo sapiens OX=9606 GN=SLC16A1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.06 22.0 3 2 1 PRT sp|Q07954|LRP1_HUMAN Prolow-density lipoprotein receptor-related protein 1 OS=Homo sapiens OX=9606 GN=LRP1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 2952-UNIMOD:4,2956-UNIMOD:4 0.01 22.0 3 3 3 PRT sp|P08243-2|ASNS_HUMAN Isoform 2 of Asparagine synthetase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=ASNS null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.02 22.0 1 1 1 PRT sp|Q9NX63|MIC19_HUMAN MICOS complex subunit MIC19 OS=Homo sapiens OX=9606 GN=CHCHD3 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 183-UNIMOD:4 0.07 22.0 2 1 0 PRT sp|Q15046-2|SYK_HUMAN Isoform Mitochondrial of Lysine--tRNA ligase OS=Homo sapiens OX=9606 GN=KARS null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.02 22.0 2 2 2 PRT sp|P06576|ATPB_HUMAN ATP synthase subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1B PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.02 22.0 2 1 0 PRT sp|Q13263-2|TIF1B_HUMAN Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.01 22.0 1 1 1 PRT sp|Q9ULV4-2|COR1C_HUMAN Isoform 2 of Coronin-1C OS=Homo sapiens OX=9606 GN=CORO1C null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 196-UNIMOD:4,29-UNIMOD:4 0.04 22.0 3 2 1 PRT sp|Q9NRZ9-2|HELLS_HUMAN Isoform 2 of Lymphoid-specific helicase OS=Homo sapiens OX=9606 GN=HELLS null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.03 22.0 2 2 2 PRT sp|Q15631-2|TSN_HUMAN Isoform 2 of Translin OS=Homo sapiens OX=9606 GN=TSN null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.07 22.0 1 1 0 PRT sp|Q02790|FKBP4_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 396-UNIMOD:4 0.13 22.0 8 6 4 PRT sp|Q15366-2|PCBP2_HUMAN Isoform 2 of Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.06 22.0 6 2 1 PRT sp|O60664-3|PLIN3_HUMAN Isoform 3 of Perilipin-3 OS=Homo sapiens OX=9606 GN=PLIN3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.03 22.0 1 1 1 PRT sp|Q9BUA3|SPNDC_HUMAN Spindlin interactor and repressor of chromatin-binding protein OS=Homo sapiens OX=9606 GN=SPINDOC PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.03 22.0 1 1 1 PRT sp|P55196|AFAD_HUMAN Afadin OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.01 22.0 1 1 1 PRT sp|Q13347|EIF3I_HUMAN Eukaryotic translation initiation factor 3 subunit I OS=Homo sapiens OX=9606 GN=EIF3I PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 76-UNIMOD:4 0.11 22.0 3 3 3 PRT sp|P02533|K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.03 22.0 1 1 1 PRT sp|Q13243-3|SRSF5_HUMAN Isoform SRP40-4 of Serine/arginine-rich splicing factor 5 OS=Homo sapiens OX=9606 GN=SRSF5 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.06 22.0 2 1 0 PRT sp|P11940-2|PABP1_HUMAN Isoform 2 of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.08 22.0 5 4 3 PRT sp|Q01995|TAGL_HUMAN Transgelin OS=Homo sapiens OX=9606 GN=TAGLN PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 22.0 null 0.13 22.0 4 3 2 PRT sp|Q9H501|ESF1_HUMAN ESF1 homolog OS=Homo sapiens OX=9606 GN=ESF1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.03 22.0 2 2 2 PRT sp|Q99426|TBCB_HUMAN Tubulin-folding cofactor B OS=Homo sapiens OX=9606 GN=TBCB PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.04 22.0 2 1 0 PRT sp|P05165|PCCA_HUMAN Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Homo sapiens OX=9606 GN=PCCA PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.02 22.0 1 1 1 PRT sp|O43818|U3IP2_HUMAN U3 small nucleolar RNA-interacting protein 2 OS=Homo sapiens OX=9606 GN=RRP9 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.02 22.0 1 1 1 PRT sp|Q15833-2|STXB2_HUMAN Isoform 2 of Syntaxin-binding protein 2 OS=Homo sapiens OX=9606 GN=STXBP2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.02 22.0 1 1 1 PRT sp|Q14008-2|CKAP5_HUMAN Isoform 2 of Cytoskeleton-associated protein 5 OS=Homo sapiens OX=9606 GN=CKAP5 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.01 22.0 1 1 1 PRT sp|P52701-3|MSH6_HUMAN Isoform 3 of DNA mismatch repair protein Msh6 OS=Homo sapiens OX=9606 GN=MSH6 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 635-UNIMOD:4 0.02 22.0 3 3 3 PRT sp|Q7Z2Z2-2|EFL1_HUMAN Isoform 2 of Elongation factor-like GTPase 1 OS=Homo sapiens OX=9606 GN=EFL1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.01 22.0 1 1 1 PRT sp|P30626-2|SORCN_HUMAN Isoform 2 of Sorcin OS=Homo sapiens OX=9606 GN=SRI null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.13 22.0 4 2 0 PRT sp|Q6DKJ4-3|NXN_HUMAN Isoform 3 of Nucleoredoxin OS=Homo sapiens OX=9606 GN=NXN null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 194-UNIMOD:4 0.03 22.0 1 1 1 PRT sp|P06396-2|GELS_HUMAN Isoform 2 of Gelsolin OS=Homo sapiens OX=9606 GN=GSN null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.06 22.0 4 4 4 PRT sp|Q6UXK5|LRRN1_HUMAN Leucine-rich repeat neuronal protein 1 OS=Homo sapiens OX=9606 GN=LRRN1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 58-UNIMOD:4 0.02 22.0 1 1 1 PRT sp|P51148-2|RAB5C_HUMAN Isoform 2 of Ras-related protein Rab-5C OS=Homo sapiens OX=9606 GN=RAB5C null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.05 22.0 2 1 0 PRT sp|Q13642-4|FHL1_HUMAN Isoform 4 of Four and a half LIM domains protein 1 OS=Homo sapiens OX=9606 GN=FHL1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 65-UNIMOD:4,69-UNIMOD:4,72-UNIMOD:4 0.04 22.0 1 1 1 PRT sp|Q86YP4-2|P66A_HUMAN Isoform 2 of Transcriptional repressor p66-alpha OS=Homo sapiens OX=9606 GN=GATAD2A null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.04 22.0 3 2 1 PRT sp|P11586|C1TC_HUMAN C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ] 22.0 null 785-UNIMOD:385,785-UNIMOD:4 0.05 22.0 7 4 1 PRT sp|P49792|RBP2_HUMAN E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ] 22.0 null 2696-UNIMOD:385,2696-UNIMOD:4 0.03 22.0 5 5 5 PRT sp|P30038-2|AL4A1_HUMAN Isoform 2 of Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH4A1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.02 22.0 1 1 1 PRT sp|P52209-2|6PGD_HUMAN Isoform 2 of 6-phosphogluconate dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=PGD null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 389-UNIMOD:4 0.03 22.0 2 1 0 PRT sp|P04792|HSPB1_HUMAN Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.10 22.0 4 2 0 PRT sp|P53990-2|IST1_HUMAN Isoform 2 of IST1 homolog OS=Homo sapiens OX=9606 GN=IST1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.03 22.0 1 1 1 PRT sp|Q15031|SYLM_HUMAN Probable leucine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=LARS2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.01 22.0 1 1 1 PRT sp|P82970|HMGN5_HUMAN High mobility group nucleosome-binding domain-containing protein 5 OS=Homo sapiens OX=9606 GN=HMGN5 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.05 22.0 1 1 1 PRT sp|P30086|PEBP1_HUMAN Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 133-UNIMOD:4 0.15 22.0 4 3 2 PRT sp|Q14315-2|FLNC_HUMAN Isoform 2 of Filamin-C OS=Homo sapiens OX=9606 GN=FLNC null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 2646-UNIMOD:4 0.01 22.0 2 2 2 PRT sp|P06733|ENOA_HUMAN Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.07 22.0 7 3 2 PRT sp|Q06330-4|SUH_HUMAN Isoform 4 of Recombining binding protein suppressor of hairless OS=Homo sapiens OX=9606 GN=RBPJ null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 165-UNIMOD:4 0.02 22.0 1 1 1 PRT sp|Q9H2P0|ADNP_HUMAN Activity-dependent neuroprotector homeobox protein OS=Homo sapiens OX=9606 GN=ADNP PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.01 22.0 1 1 1 PRT sp|Q8N8S7|ENAH_HUMAN Protein enabled homolog OS=Homo sapiens OX=9606 GN=ENAH PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ] 22.0 null 2-UNIMOD:1,7-UNIMOD:4 0.05 22.0 3 3 3 PRT sp|Q9NQZ2|SAS10_HUMAN Something about silencing protein 10 OS=Homo sapiens OX=9606 GN=UTP3 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.04 22.0 1 1 1 PRT sp|P26038|MOES_HUMAN Moesin OS=Homo sapiens OX=9606 GN=MSN PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.09 22.0 7 6 5 PRT sp|P52948-2|NUP98_HUMAN Isoform 2 of Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 1644-UNIMOD:4 0.01 22.0 1 1 1 PRT sp|Q1ED39|KNOP1_HUMAN Lysine-rich nucleolar protein 1 OS=Homo sapiens OX=9606 GN=KNOP1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.05 22.0 3 2 1 PRT sp|O60341-2|KDM1A_HUMAN Isoform 2 of Lysine-specific histone demethylase 1A OS=Homo sapiens OX=9606 GN=KDM1A null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.01 22.0 1 1 1 PRT sp|O75368|SH3L1_HUMAN SH3 domain-binding glutamic acid-rich-like protein OS=Homo sapiens OX=9606 GN=SH3BGRL PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.12 22.0 1 1 1 PRT sp|Q96EK6|GNA1_HUMAN Glucosamine 6-phosphate N-acetyltransferase OS=Homo sapiens OX=9606 GN=GNPNAT1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 128-UNIMOD:4 0.07 22.0 1 1 1 PRT sp|Q5RKV6|EXOS6_HUMAN Exosome complex component MTR3 OS=Homo sapiens OX=9606 GN=EXOSC6 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.10 22.0 3 2 1 PRT sp|Q9UHB6-4|LIMA1_HUMAN Isoform 4 of LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.05 22.0 3 3 3 PRT sp|Q96A65|EXOC4_HUMAN Exocyst complex component 4 OS=Homo sapiens OX=9606 GN=EXOC4 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.02 22.0 1 1 1 PRT sp|Q9NS69|TOM22_HUMAN Mitochondrial import receptor subunit TOM22 homolog OS=Homo sapiens OX=9606 GN=TOMM22 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.09 22.0 2 1 0 PRT sp|Q08431-2|MFGM_HUMAN Isoform 2 of Lactadherin OS=Homo sapiens OX=9606 GN=MFGE8 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 100-UNIMOD:4,104-UNIMOD:4 0.05 22.0 2 1 0 PRT sp|Q9C0E2|XPO4_HUMAN Exportin-4 OS=Homo sapiens OX=9606 GN=XPO4 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.02 22.0 1 1 1 PRT sp|P22234-2|PUR6_HUMAN Isoform 2 of Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.02 22.0 1 1 1 PRT sp|P55884-2|EIF3B_HUMAN Isoform 2 of Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.02 22.0 2 2 2 PRT sp|Q9Y3Z3|SAMH1_HUMAN Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Homo sapiens OX=9606 GN=SAMHD1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.02 22.0 1 1 1 PRT sp|Q13442|HAP28_HUMAN 28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 22.0 null 0.12 22.0 2 2 2 PRT sp|Q9UNY4|TTF2_HUMAN Transcription termination factor 2 OS=Homo sapiens OX=9606 GN=TTF2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.01 22.0 1 1 1 PRT sp|P50990|TCPQ_HUMAN T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 22.0 null 0.10 22.0 8 5 2 PRT sp|P60228|EIF3E_HUMAN Eukaryotic translation initiation factor 3 subunit E OS=Homo sapiens OX=9606 GN=EIF3E PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.08 22.0 4 3 2 PRT sp|P63167|DYL1_HUMAN Dynein light chain 1, cytoplasmic OS=Homo sapiens OX=9606 GN=DYNLL1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.13 22.0 3 1 0 PRT sp|Q8IYB5-2|SMAP1_HUMAN Isoform 2 of Stromal membrane-associated protein 1 OS=Homo sapiens OX=9606 GN=SMAP1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.03 22.0 1 1 1 PRT sp|P30876|RPB2_HUMAN DNA-directed RNA polymerase II subunit RPB2 OS=Homo sapiens OX=9606 GN=POLR2B PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.01 22.0 1 1 1 PRT sp|O15372|EIF3H_HUMAN Eukaryotic translation initiation factor 3 subunit H OS=Homo sapiens OX=9606 GN=EIF3H PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.03 22.0 1 1 1 PRT sp|O94906|PRP6_HUMAN Pre-mRNA-processing factor 6 OS=Homo sapiens OX=9606 GN=PRPF6 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 522-UNIMOD:4 0.05 22.0 4 4 4 PRT sp|P54886-2|P5CS_HUMAN Isoform Short of Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens OX=9606 GN=ALDH18A1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 88-UNIMOD:4 0.01 22.0 1 1 1 PRT sp|P61158|ARP3_HUMAN Actin-related protein 3 OS=Homo sapiens OX=9606 GN=ACTR3 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.03 22.0 2 1 0 PRT sp|O60841|IF2P_HUMAN Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 22.0 null 0.03 22.0 4 3 2 PRT sp|Q14684-2|RRP1B_HUMAN Isoform 2 of Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.03 22.0 1 1 1 PRT sp|Q9NUU7|DD19A_HUMAN ATP-dependent RNA helicase DDX19A OS=Homo sapiens OX=9606 GN=DDX19A PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 392-UNIMOD:4 0.08 22.0 7 3 1 PRT sp|P42126-2|ECI1_HUMAN Isoform 2 of Enoyl-CoA delta isomerase 1, mitochondrial OS=Homo sapiens OX=9606 GN=ECI1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.04 22.0 1 1 1 PRT sp|Q9ULU4-13|PKCB1_HUMAN Isoform 13 of Protein kinase C-binding protein 1 OS=Homo sapiens OX=9606 GN=ZMYND8 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.02 22.0 2 2 2 PRT sp|P62136|PP1A_HUMAN Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Homo sapiens OX=9606 GN=PPP1CA PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.07 22.0 2 2 2 PRT sp|Q13310-2|PABP4_HUMAN Isoform 2 of Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.02 22.0 1 1 1 PRT sp|O75643|U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens OX=9606 GN=SNRNP200 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 428-UNIMOD:4 0.02 22.0 5 5 5 PRT sp|O60701|UGDH_HUMAN UDP-glucose 6-dehydrogenase OS=Homo sapiens OX=9606 GN=UGDH PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.07 22.0 5 3 2 PRT sp|O75223|GGCT_HUMAN Gamma-glutamylcyclotransferase OS=Homo sapiens OX=9606 GN=GGCT PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.13 22.0 3 2 1 PRT sp|Q13573|SNW1_HUMAN SNW domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SNW1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.05 22.0 2 2 2 PRT sp|O14994|SYN3_HUMAN Synapsin-3 OS=Homo sapiens OX=9606 GN=SYN3 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.03 22.0 1 1 1 PRT sp|O75487|GPC4_HUMAN Glypican-4 OS=Homo sapiens OX=9606 GN=GPC4 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.04 22.0 2 2 2 PRT sp|Q9BSJ8-2|ESYT1_HUMAN Isoform 2 of Extended synaptotagmin-1 OS=Homo sapiens OX=9606 GN=ESYT1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 370-UNIMOD:4 0.02 22.0 2 2 2 PRT sp|Q9H2U2-3|IPYR2_HUMAN Isoform 3 of Inorganic pyrophosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PPA2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.04 22.0 1 1 1 PRT sp|P50453|SPB9_HUMAN Serpin B9 OS=Homo sapiens OX=9606 GN=SERPINB9 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.03 22.0 2 1 0 PRT sp|Q13085-2|ACACA_HUMAN Isoform 2 of Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.01 22.0 1 1 1 PRT sp|P08579|RU2B_HUMAN U2 small nuclear ribonucleoprotein B'' OS=Homo sapiens OX=9606 GN=SNRPB2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.05 22.0 1 1 1 PRT sp|Q96BK5|PINX1_HUMAN PIN2/TERF1-interacting telomerase inhibitor 1 OS=Homo sapiens OX=9606 GN=PINX1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.05 22.0 1 1 1 PRT sp|O00746|NDKM_HUMAN Nucleoside diphosphate kinase, mitochondrial OS=Homo sapiens OX=9606 GN=NME4 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.08 22.0 1 1 1 PRT sp|P14550|AK1A1_HUMAN Alcohol dehydrogenase [NADP(+)] OS=Homo sapiens OX=9606 GN=AKR1A1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 134-UNIMOD:4 0.05 22.0 2 1 0 PRT sp|Q9UBU9|NXF1_HUMAN Nuclear RNA export factor 1 OS=Homo sapiens OX=9606 GN=NXF1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.02 22.0 1 1 1 PRT sp|Q7L9L4-2|MOB1B_HUMAN Isoform 2 of MOB kinase activator 1B OS=Homo sapiens OX=9606 GN=MOB1B null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22.0 null 0.06 22.0 1 1 1 PRT sp|P38159|RBMX_HUMAN RNA-binding motif protein, X chromosome OS=Homo sapiens OX=9606 GN=RBMX PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 22.0 null 2-UNIMOD:1 0.02 22.0 1 1 1 PRT sp|P22626|ROA2_HUMAN Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 22.0 null 191-UNIMOD:28 0.07 22.0 3 2 0 PRT sp|Q14008|CKAP5_HUMAN Cytoskeleton-associated protein 5 OS=Homo sapiens OX=9606 GN=CKAP5 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22.0 null 0.01 22.0 1 1 1 PRT sp|Q15046|SYK_HUMAN Lysine--tRNA ligase OS=Homo sapiens OX=9606 GN=KARS PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 22.0 null 2-UNIMOD:1 0.02 22.0 2 1 0 PRT sp|Q13247|SRSF6_HUMAN Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ],[MS, MS:1001207, Mascot, ] 22.0 null 132-UNIMOD:28 0.09 22.0 5 3 2 PRT sp|P62328|TYB4_HUMAN Thymosin beta-4 OS=Homo sapiens OX=9606 GN=TMSB4X PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 22.0 null 2-UNIMOD:1,7-UNIMOD:35 0.27 22.0 3 1 0 PRT sp|Q86U86|PB1_HUMAN Protein polybromo-1 OS=Homo sapiens OX=9606 GN=PBRM1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22.0 null 0.01 22.0 1 1 1 PRT sp|O00148|DX39A_HUMAN ATP-dependent RNA helicase DDX39A OS=Homo sapiens OX=9606 GN=DDX39A PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ] 22.0 null 197-UNIMOD:4,164-UNIMOD:4 0.05 22.0 2 2 2 PRT sp|Q9UBE0|SAE1_HUMAN SUMO-activating enzyme subunit 1 OS=Homo sapiens OX=9606 GN=SAE1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22.0 null 0.03 22.0 1 1 1 PRT sp|P52209|6PGD_HUMAN 6-phosphogluconate dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=PGD PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22.0 null 402-UNIMOD:4 0.02 22.0 1 1 0 PRT sp|Q9BQ61|TRIR_HUMAN Telomerase RNA component interacting RNase OS=Homo sapiens OX=9606 GN=TRIR PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ],[MS, MS:1001207, Mascot, ] 22.0 null 136-UNIMOD:28 0.07 22.0 3 2 1 PRT sp|Q9Y4E8|UBP15_HUMAN Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens OX=9606 GN=USP15 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 22.0 null 2-UNIMOD:1 0.01 22.0 1 1 1 PRT sp|Q8TDB8|GTR14_HUMAN Solute carrier family 2, facilitated glucose transporter member 14 OS=Homo sapiens OX=9606 GN=SLC2A14 PE=2 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22.0 null 0.02 22.0 1 1 1 PRT sp|Q9UNF1|MAGD2_HUMAN Melanoma-associated antigen D2 OS=Homo sapiens OX=9606 GN=MAGED2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 22.0 null 2-UNIMOD:1 0.02 22.0 1 1 1 PRT sp|P30040|ERP29_HUMAN Endoplasmic reticulum resident protein 29 OS=Homo sapiens OX=9606 GN=ERP29 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 22.0 null 183-UNIMOD:28 0.04 22.0 1 1 1 PRT sp|P62273|RS29_HUMAN 40S ribosomal protein S29 OS=Homo sapiens OX=9606 GN=RPS29 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 22.0 null 0.21 22.0 2 1 0 PRT sp|P35659|DEK_HUMAN Protein DEK OS=Homo sapiens OX=9606 GN=DEK PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 22.0 null 2-UNIMOD:1 0.06 22.0 1 1 1 PRT sp|P14635|CCNB1_HUMAN G2/mitotic-specific cyclin-B1 OS=Homo sapiens OX=9606 GN=CCNB1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22.0 null 0.03 22.0 1 1 1 PRT sp|Q7KZ85|SPT6H_HUMAN Transcription elongation factor SPT6 OS=Homo sapiens OX=9606 GN=SUPT6H PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ] 22.0 null 0.01 22.0 2 2 2 PRT sp|Q16658|FSCN1_HUMAN Fascin OS=Homo sapiens OX=9606 GN=FSCN1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22.0 null 0.02 22.0 1 1 1 PRT sp|Q92797|SYMPK_HUMAN Symplekin OS=Homo sapiens OX=9606 GN=SYMPK PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22.0 null 0.01 22.0 1 1 1 PRT sp|P50993|AT1A2_HUMAN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Homo sapiens OX=9606 GN=ATP1A2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22.0 null 0.01 22.0 1 1 1 PRT sp|Q6PJT7|ZC3HE_HUMAN Zinc finger CCCH domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZC3H14 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22.0 null 0.02 22.0 1 1 1 PRT sp|P49419-2|AL7A1_HUMAN Isoform 2 of Alpha-aminoadipic semialdehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH7A1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 494-UNIMOD:4 0.05 21.0 3 2 1 PRT sp|Q8ND56-3|LS14A_HUMAN Isoform 3 of Protein LSM14 homolog A OS=Homo sapiens OX=9606 GN=LSM14A null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.03 21.0 1 1 1 PRT sp|Q8N5M9|JAGN1_HUMAN Protein jagunal homolog 1 OS=Homo sapiens OX=9606 GN=JAGN1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.07 21.0 1 1 1 PRT sp|Q9P0J7|KCMF1_HUMAN E3 ubiquitin-protein ligase KCMF1 OS=Homo sapiens OX=9606 GN=KCMF1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 9-UNIMOD:4,12-UNIMOD:4 0.03 21.0 1 1 1 PRT sp|P63010-2|AP2B1_HUMAN Isoform 2 of AP-2 complex subunit beta OS=Homo sapiens OX=9606 GN=AP2B1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 871-UNIMOD:4,241-UNIMOD:4 0.03 21.0 2 2 2 PRT sp|P10599-2|THIO_HUMAN Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.12 21.0 2 1 0 PRT sp|P24539|AT5F1_HUMAN ATP synthase F(0) complex subunit B1, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PB PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.09 21.0 6 2 0 PRT sp|Q8WU90|ZC3HF_HUMAN Zinc finger CCCH domain-containing protein 15 OS=Homo sapiens OX=9606 GN=ZC3H15 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.03 21.0 1 1 1 PRT sp|O14964-2|HGS_HUMAN Isoform 2 of Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 75-UNIMOD:4 0.02 21.0 1 1 1 PRT sp|Q08J23-2|NSUN2_HUMAN Isoform 2 of tRNA (cytosine(34)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NSUN2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.04 21.0 3 2 1 PRT sp|O43852-2|CALU_HUMAN Isoform 2 of Calumenin OS=Homo sapiens OX=9606 GN=CALU null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.10 21.0 5 3 1 PRT sp|P17980|PRS6A_HUMAN 26S proteasome regulatory subunit 6A OS=Homo sapiens OX=9606 GN=PSMC3 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 387-UNIMOD:4,396-UNIMOD:4 0.03 21.0 1 1 1 PRT sp|O75083|WDR1_HUMAN WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=WDR1 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.03 21.0 3 3 3 PRT sp|O95487-2|SC24B_HUMAN Isoform 2 of Protein transport protein Sec24B OS=Homo sapiens OX=9606 GN=SEC24B null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.01 21.0 1 1 1 PRT sp|Q16630-2|CPSF6_HUMAN Isoform 2 of Cleavage and polyadenylation specificity factor subunit 6 OS=Homo sapiens OX=9606 GN=CPSF6 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 159-UNIMOD:4 0.04 21.0 2 2 2 PRT sp|P62829|RL23_HUMAN 60S ribosomal protein L23 OS=Homo sapiens OX=9606 GN=RPL23 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.08 21.0 1 1 1 PRT sp|P49454|CENPF_HUMAN Centromere protein F OS=Homo sapiens OX=9606 GN=CENPF PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1000663, ProteinPilot, ] 21.0 null 0.00 21.0 1 1 1 PRT sp|Q96T76-8|MMS19_HUMAN Isoform 5 of MMS19 nucleotide excision repair protein homolog OS=Homo sapiens OX=9606 GN=MMS19 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.01 21.0 1 1 1 PRT sp|Q6UXN9|WDR82_HUMAN WD repeat-containing protein 82 OS=Homo sapiens OX=9606 GN=WDR82 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.05 21.0 1 1 1 PRT sp|P09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A OS=Homo sapiens OX=9606 GN=SNRPA PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.04 21.0 1 1 1 PRT sp|O60313-10|OPA1_HUMAN Isoform 4 of Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens OX=9606 GN=OPA1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.03 21.0 3 3 3 PRT sp|P11021|BIP_HUMAN Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 21.0 null 0.10 21.0 10 8 5 PRT sp|Q13619-2|CUL4A_HUMAN Isoform 2 of Cullin-4A OS=Homo sapiens OX=9606 GN=CUL4A null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 383-UNIMOD:4 0.05 21.0 3 3 3 PRT sp|P20073-2|ANXA7_HUMAN Isoform 2 of Annexin A7 OS=Homo sapiens OX=9606 GN=ANXA7 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.03 21.0 1 1 1 PRT sp|Q9Y5J1|UTP18_HUMAN U3 small nucleolar RNA-associated protein 18 homolog OS=Homo sapiens OX=9606 GN=UTP18 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.02 21.0 1 1 1 PRT sp|P50579-2|MAP2_HUMAN Isoform 2 of Methionine aminopeptidase 2 OS=Homo sapiens OX=9606 GN=METAP2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.03 21.0 1 1 1 PRT sp|Q13263|TIF1B_HUMAN Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1000663, ProteinPilot, ] 21.0 null 0.02 21.0 1 1 1 PRT sp|P28070|PSB4_HUMAN Proteasome subunit beta type-4 OS=Homo sapiens OX=9606 GN=PSMB4 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.04 21.0 1 1 1 PRT sp|Q9H444|CHM4B_HUMAN Charged multivesicular body protein 4b OS=Homo sapiens OX=9606 GN=CHMP4B PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.15 21.0 6 3 2 PRT sp|Q92905|CSN5_HUMAN COP9 signalosome complex subunit 5 OS=Homo sapiens OX=9606 GN=COPS5 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.03 21.0 1 1 1 PRT sp|P83881|RL36A_HUMAN 60S ribosomal protein L36a OS=Homo sapiens OX=9606 GN=RPL36A PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 72-UNIMOD:4,77-UNIMOD:4 0.09 21.0 2 1 0 PRT sp|P23193-2|TCEA1_HUMAN Isoform 2 of Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 250-UNIMOD:4 0.04 21.0 1 1 1 PRT sp|Q56VL3|OCAD2_HUMAN OCIA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=OCIAD2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 130-UNIMOD:4,134-UNIMOD:4,137-UNIMOD:4 0.07 21.0 2 1 0 PRT sp|Q8N1F7|NUP93_HUMAN Nuclear pore complex protein Nup93 OS=Homo sapiens OX=9606 GN=NUP93 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.03 21.0 2 2 2 PRT sp|Q08AM6|VAC14_HUMAN Protein VAC14 homolog OS=Homo sapiens OX=9606 GN=VAC14 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.01 21.0 1 1 1 PRT sp|Q07955|SRSF1_HUMAN Serine/arginine-rich splicing factor 1 OS=Homo sapiens OX=9606 GN=SRSF1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.08 21.0 2 2 2 PRT sp|Q14126|DSG2_HUMAN Desmoglein-2 OS=Homo sapiens OX=9606 GN=DSG2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.01 21.0 1 1 1 PRT sp|Q9BV38|WDR18_HUMAN WD repeat-containing protein 18 OS=Homo sapiens OX=9606 GN=WDR18 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.05 21.0 2 2 2 PRT sp|P02545-2|LMNA_HUMAN Isoform C of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.10 21.0 5 5 5 PRT sp|Q96HA1|P121A_HUMAN Nuclear envelope pore membrane protein POM 121 OS=Homo sapiens OX=9606 GN=POM121 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.01 21.0 1 1 1 PRT sp|P62750|RL23A_HUMAN 60S ribosomal protein L23a OS=Homo sapiens OX=9606 GN=RPL23A PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.15 21.0 4 3 2 PRT sp|Q13685|AAMP_HUMAN Angio-associated migratory cell protein OS=Homo sapiens OX=9606 GN=AAMP PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.03 21.0 1 1 1 PRT sp|O60488-2|ACSL4_HUMAN Isoform Short of Long-chain-fatty-acid--CoA ligase 4 OS=Homo sapiens OX=9606 GN=ACSL4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.02 21.0 1 1 1 PRT sp|Q02543|RL18A_HUMAN 60S ribosomal protein L18a OS=Homo sapiens OX=9606 GN=RPL18A PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.11 21.0 2 2 2 PRT sp|P35249-2|RFC4_HUMAN Isoform 2 of Replication factor C subunit 4 OS=Homo sapiens OX=9606 GN=RFC4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.08 21.0 2 2 2 PRT sp|P54577|SYYC_HUMAN Tyrosine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=YARS PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.10 21.0 6 5 4 PRT sp|P09936|UCHL1_HUMAN Ubiquitin carboxyl-terminal hydrolase isozyme L1 OS=Homo sapiens OX=9606 GN=UCHL1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.04 21.0 2 1 0 PRT sp|P25789-2|PSA4_HUMAN Isoform 2 of Proteasome subunit alpha type-4 OS=Homo sapiens OX=9606 GN=PSMA4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.05 21.0 1 1 1 PRT sp|Q9Y4E8-2|UBP15_HUMAN Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens OX=9606 GN=USP15 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.01 21.0 1 1 1 PRT sp|P36542-2|ATPG_HUMAN Isoform Heart of ATP synthase subunit gamma, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1C null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 103-UNIMOD:4 0.08 21.0 3 2 1 PRT sp|Q9HC35-2|EMAL4_HUMAN Isoform 2 of Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.04 21.0 4 3 2 PRT sp|Q9Y2Z0-2|SGT1_HUMAN Isoform 2 of Protein SGT1 homolog OS=Homo sapiens OX=9606 GN=SUGT1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.10 21.0 3 3 3 PRT sp|Q99816-2|TS101_HUMAN Isoform 2 of Tumor susceptibility gene 101 protein OS=Homo sapiens OX=9606 GN=TSG101 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.08 21.0 2 2 2 PRT sp|P26639-2|SYTC_HUMAN Isoform 2 of Threonine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.10 21.0 9 7 6 PRT sp|Q9C0C9|UBE2O_HUMAN (E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.02 21.0 1 1 1 PRT sp|P11279|LAMP1_HUMAN Lysosome-associated membrane glycoprotein 1 OS=Homo sapiens OX=9606 GN=LAMP1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21.0 null 0.03 21.0 1 1 0 PRT sp|Q13435|SF3B2_HUMAN Splicing factor 3B subunit 2 OS=Homo sapiens OX=9606 GN=SF3B2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.02 21.0 5 3 1 PRT sp|Q9P2X0-2|DPM3_HUMAN Isoform 2 of Dolichol-phosphate mannosyltransferase subunit 3 OS=Homo sapiens OX=9606 GN=DPM3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.09 21.0 1 1 1 PRT sp|O15511-2|ARPC5_HUMAN Isoform 2 of Actin-related protein 2/3 complex subunit 5 OS=Homo sapiens OX=9606 GN=ARPC5 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.08 21.0 2 2 2 PRT sp|Q8IWZ8|SUGP1_HUMAN SURP and G-patch domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SUGP1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.02 21.0 1 1 1 PRT sp|Q9Y2A7-2|NCKP1_HUMAN Isoform 2 of Nck-associated protein 1 OS=Homo sapiens OX=9606 GN=NCKAP1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.01 21.0 1 1 1 PRT sp|O95299|NDUAA_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFA10 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.04 21.0 1 1 1 PRT sp|O60716-3|CTND1_HUMAN Isoform 1AC of Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.03 21.0 2 2 2 PRT sp|O14757|CHK1_HUMAN Serine/threonine-protein kinase Chk1 OS=Homo sapiens OX=9606 GN=CHEK1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.03 21.0 1 1 1 PRT sp|P25705-3|ATPA_HUMAN Isoform 3 of ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.02 21.0 3 1 0 PRT sp|O94973-2|AP2A2_HUMAN Isoform 2 of AP-2 complex subunit alpha-2 OS=Homo sapiens OX=9606 GN=AP2A2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.01 21.0 1 1 1 PRT sp|Q13509|TBB3_HUMAN Tubulin beta-3 chain OS=Homo sapiens OX=9606 GN=TUBB3 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.03 21.0 2 1 0 PRT sp|Q9UNF0|PACN2_HUMAN Protein kinase C and casein kinase substrate in neurons protein 2 OS=Homo sapiens OX=9606 GN=PACSIN2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.02 21.0 1 1 1 PRT sp|O00754|MA2B1_HUMAN Lysosomal alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN2B1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.01 21.0 1 1 1 PRT sp|P61619|S61A1_HUMAN Protein transport protein Sec61 subunit alpha isoform 1 OS=Homo sapiens OX=9606 GN=SEC61A1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.04 21.0 2 2 2 PRT sp|Q96JM3|CHAP1_HUMAN Chromosome alignment-maintaining phosphoprotein 1 OS=Homo sapiens OX=9606 GN=CHAMP1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.01 21.0 1 1 1 PRT sp|P06730-3|IF4E_HUMAN Isoform 3 of Eukaryotic translation initiation factor 4E OS=Homo sapiens OX=9606 GN=EIF4E null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.06 21.0 1 1 1 PRT sp|P78310|CXAR_HUMAN Coxsackievirus and adenovirus receptor OS=Homo sapiens OX=9606 GN=CXADR PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 223-UNIMOD:4 0.03 21.0 2 1 0 PRT sp|Q13206|DDX10_HUMAN Probable ATP-dependent RNA helicase DDX10 OS=Homo sapiens OX=9606 GN=DDX10 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.02 21.0 1 1 1 PRT sp|Q9C0C2|TB182_HUMAN 182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 21.0 null 1373-UNIMOD:4 0.03 21.0 4 4 4 PRT sp|O14776-2|TCRG1_HUMAN Isoform 2 of Transcription elongation regulator 1 OS=Homo sapiens OX=9606 GN=TCERG1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.01 21.0 1 1 1 PRT sp|P19387|RPB3_HUMAN DNA-directed RNA polymerase II subunit RPB3 OS=Homo sapiens OX=9606 GN=POLR2C PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.04 21.0 1 1 1 PRT sp|O14929|HAT1_HUMAN Histone acetyltransferase type B catalytic subunit OS=Homo sapiens OX=9606 GN=HAT1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 27-UNIMOD:4 0.03 21.0 1 1 1 PRT sp|P55809|SCOT1_HUMAN Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=OXCT1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 504-UNIMOD:4 0.05 21.0 2 2 2 PRT sp|P54920|SNAA_HUMAN Alpha-soluble NSF attachment protein OS=Homo sapiens OX=9606 GN=NAPA PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.04 21.0 2 1 0 PRT sp|P36871|PGM1_HUMAN Phosphoglucomutase-1 OS=Homo sapiens OX=9606 GN=PGM1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.02 21.0 1 1 1 PRT sp|P43686|PRS6B_HUMAN 26S proteasome regulatory subunit 6B OS=Homo sapiens OX=9606 GN=PSMC4 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.05 21.0 2 2 2 PRT sp|O15400-2|STX7_HUMAN Isoform 2 of Syntaxin-7 OS=Homo sapiens OX=9606 GN=STX7 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 28-UNIMOD:4 0.05 21.0 1 1 1 PRT sp|Q9UH65|SWP70_HUMAN Switch-associated protein 70 OS=Homo sapiens OX=9606 GN=SWAP70 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.04 21.0 2 2 2 PRT sp|Q9H9B4|SFXN1_HUMAN Sideroflexin-1 OS=Homo sapiens OX=9606 GN=SFXN1 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.04 21.0 1 1 1 PRT sp|Q9BZJ0-3|CRNL1_HUMAN Isoform 3 of Crooked neck-like protein 1 OS=Homo sapiens OX=9606 GN=CRNKL1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.02 21.0 1 1 1 PRT sp|Q9BY77-2|PDIP3_HUMAN Isoform 2 of Polymerase delta-interacting protein 3 OS=Homo sapiens OX=9606 GN=POLDIP3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.04 21.0 1 1 1 PRT sp|O43390-2|HNRPR_HUMAN Isoform 2 of Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens OX=9606 GN=HNRNPR null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 226-UNIMOD:4 0.02 21.0 2 1 0 PRT sp|P25786-2|PSA1_HUMAN Isoform Long of Proteasome subunit alpha type-1 OS=Homo sapiens OX=9606 GN=PSMA1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.09 21.0 2 2 2 PRT sp|P12830-2|CADH1_HUMAN Isoform 2 of Cadherin-1 OS=Homo sapiens OX=9606 GN=CDH1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.01 21.0 1 1 1 PRT sp|P11234-2|RALB_HUMAN Isoform 2 of Ras-related protein Ral-B OS=Homo sapiens OX=9606 GN=RALB null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.05 21.0 1 1 1 PRT sp|P37198|NUP62_HUMAN Nuclear pore glycoprotein p62 OS=Homo sapiens OX=9606 GN=NUP62 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.03 21.0 2 1 0 PRT sp|Q9NW13|RBM28_HUMAN RNA-binding protein 28 OS=Homo sapiens OX=9606 GN=RBM28 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.01 21.0 1 1 1 PRT sp|P15880|RS2_HUMAN 40S ribosomal protein S2 OS=Homo sapiens OX=9606 GN=RPS2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 182-UNIMOD:4 0.14 21.0 8 4 2 PRT sp|P51572-2|BAP31_HUMAN Isoform 2 of B-cell receptor-associated protein 31 OS=Homo sapiens OX=9606 GN=BCAP31 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.03 21.0 1 1 1 PRT sp|Q9BXJ9|NAA15_HUMAN N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA15 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.01 21.0 1 1 1 PRT sp|P26640|SYVC_HUMAN Valine--tRNA ligase OS=Homo sapiens OX=9606 GN=VARS PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.03 21.0 2 2 2 PRT sp|P29692-2|EF1D_HUMAN Isoform 2 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.02 21.0 1 1 1 PRT sp|P27824-2|CALX_HUMAN Isoform 2 of Calnexin OS=Homo sapiens OX=9606 GN=CANX null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.02 21.0 2 1 0 PRT sp|Q6P1M3-2|L2GL2_HUMAN Isoform A of Lethal(2) giant larvae protein homolog 2 OS=Homo sapiens OX=9606 GN=LLGL2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.01 21.0 1 1 1 PRT sp|Q96KP4|CNDP2_HUMAN Cytosolic non-specific dipeptidase OS=Homo sapiens OX=9606 GN=CNDP2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.02 21.0 1 1 1 PRT sp|P39019|RS19_HUMAN 40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.14 21.0 2 2 2 PRT sp|Q14254|FLOT2_HUMAN Flotillin-2 OS=Homo sapiens OX=9606 GN=FLOT2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.03 21.0 1 1 1 PRT sp|P40925-3|MDHC_HUMAN Isoform 3 of Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.06 21.0 5 2 1 PRT sp|P60900|PSA6_HUMAN Proteasome subunit alpha type-6 OS=Homo sapiens OX=9606 GN=PSMA6 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 21.0 null 47-UNIMOD:4 0.09 21.0 3 2 1 PRT sp|Q8IYD1|ERF3B_HUMAN Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Homo sapiens OX=9606 GN=GSPT2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 582-UNIMOD:4 0.03 21.0 5 2 1 PRT sp|O95347-2|SMC2_HUMAN Isoform 2 of Structural maintenance of chromosomes protein 2 OS=Homo sapiens OX=9606 GN=SMC2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.01 21.0 1 1 1 PRT sp|Q9BQG0-2|MBB1A_HUMAN Isoform 2 of Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.02 21.0 2 2 2 PRT sp|Q9UEY8-2|ADDG_HUMAN Isoform 1 of Gamma-adducin OS=Homo sapiens OX=9606 GN=ADD3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.02 21.0 1 1 1 PRT sp|P40763-2|STAT3_HUMAN Isoform Del-701 of Signal transducer and activator of transcription 3 OS=Homo sapiens OX=9606 GN=STAT3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.02 21.0 1 1 1 PRT sp|Q9BZF1-2|OSBL8_HUMAN Isoform 2 of Oxysterol-binding protein-related protein 8 OS=Homo sapiens OX=9606 GN=OSBPL8 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.01 21.0 1 1 1 PRT sp|Q9UJU6-2|DBNL_HUMAN Isoform 2 of Drebrin-like protein OS=Homo sapiens OX=9606 GN=DBNL null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.03 21.0 1 1 1 PRT sp|P46940|IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 1534-UNIMOD:4 0.02 21.0 3 3 3 PRT sp|Q92621|NU205_HUMAN Nuclear pore complex protein Nup205 OS=Homo sapiens OX=9606 GN=NUP205 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.01 21.0 1 1 1 PRT sp|Q12830-2|BPTF_HUMAN Isoform 2 of Nucleosome-remodeling factor subunit BPTF OS=Homo sapiens OX=9606 GN=BPTF null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.00 21.0 2 1 0 PRT sp|Q15047-3|SETB1_HUMAN Isoform 3 of Histone-lysine N-methyltransferase SETDB1 OS=Homo sapiens OX=9606 GN=SETDB1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.01 21.0 1 1 1 PRT sp|P05556|ITB1_HUMAN Integrin beta-1 OS=Homo sapiens OX=9606 GN=ITGB1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.03 21.0 2 2 2 PRT sp|Q86U86-8|PB1_HUMAN Isoform 8 of Protein polybromo-1 OS=Homo sapiens OX=9606 GN=PBRM1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.01 21.0 1 1 1 PRT sp|Q9HDC9-2|APMAP_HUMAN Isoform 2 of Adipocyte plasma membrane-associated protein OS=Homo sapiens OX=9606 GN=APMAP null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 149-UNIMOD:4 0.09 21.0 2 2 2 PRT sp|Q9H0D6-2|XRN2_HUMAN Isoform 2 of 5'-3' exoribonuclease 2 OS=Homo sapiens OX=9606 GN=XRN2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.03 21.0 2 2 2 PRT sp|Q16531|DDB1_HUMAN DNA damage-binding protein 1 OS=Homo sapiens OX=9606 GN=DDB1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.01 21.0 2 2 2 PRT sp|Q13111|CAF1A_HUMAN Chromatin assembly factor 1 subunit A OS=Homo sapiens OX=9606 GN=CHAF1A PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.01 21.0 1 1 1 PRT sp|Q9Y4W2-2|LAS1L_HUMAN Isoform 2 of Ribosomal biogenesis protein LAS1L OS=Homo sapiens OX=9606 GN=LAS1L null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.02 21.0 1 1 1 PRT sp|Q9NRW1-2|RAB6B_HUMAN Isoform 2 of Ras-related protein Rab-6B OS=Homo sapiens OX=9606 GN=RAB6B null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.06 21.0 1 1 1 PRT sp|Q13427|PPIG_HUMAN Peptidyl-prolyl cis-trans isomerase G OS=Homo sapiens OX=9606 GN=PPIG PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.02 21.0 1 1 1 PRT sp|Q99614|TTC1_HUMAN Tetratricopeptide repeat protein 1 OS=Homo sapiens OX=9606 GN=TTC1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21.0 null 0.05 21.0 1 1 1 PRT sp|Q14847|LASP1_HUMAN LIM and SH3 domain protein 1 OS=Homo sapiens OX=9606 GN=LASP1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 21.0 null 76-UNIMOD:28 0.08 21.0 2 2 1 PRT sp|Q15366|PCBP2_HUMAN Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21.0 null 0.03 21.0 1 1 0 PRT sp|Q96QV6|H2A1A_HUMAN Histone H2A type 1-A OS=Homo sapiens OX=9606 GN=HIST1H2AA PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21.0 null 0.11 21.0 1 1 0 PRT sp|O94826|TOM70_HUMAN Mitochondrial import receptor subunit TOM70 OS=Homo sapiens OX=9606 GN=TOMM70 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ],[MS, MS:1001207, Mascot, ] 21.0 null 0.04 21.0 2 2 2 PRT sp|O43242|PSMD3_HUMAN 26S proteasome non-ATPase regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PSMD3 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ] 21.0 null 0.06 21.0 3 3 3 PRT sp|Q16695|H31T_HUMAN Histone H3.1t OS=Homo sapiens OX=9606 GN=HIST3H3 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21.0 null 0.07 21.0 2 1 0 PRT sp|Q9HCS7|SYF1_HUMAN Pre-mRNA-splicing factor SYF1 OS=Homo sapiens OX=9606 GN=XAB2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21.0 null 0.01 21.0 1 1 1 PRT sp|Q9UIF9|BAZ2A_HUMAN Bromodomain adjacent to zinc finger domain protein 2A OS=Homo sapiens OX=9606 GN=BAZ2A PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21.0 null 0.01 21.0 1 1 1 PRT sp|P54578|UBP14_HUMAN Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo sapiens OX=9606 GN=USP14 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 21.0 null 257-UNIMOD:385,257-UNIMOD:4 0.02 21.0 1 1 0 PRT sp|Q5TBB1|RNH2B_HUMAN Ribonuclease H2 subunit B OS=Homo sapiens OX=9606 GN=RNASEH2B PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 21.0 null 2-UNIMOD:1,7-UNIMOD:4 0.04 21.0 1 1 1 PRT sp|P09960|LKHA4_HUMAN Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 GN=LTA4H PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21.0 null 0.02 21.0 1 1 1 PRT sp|Q15631|TSN_HUMAN Translin OS=Homo sapiens OX=9606 GN=TSN PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21.0 null 0.05 21.0 1 1 0 PRT sp|P62913|RL11_HUMAN 60S ribosomal protein L11 OS=Homo sapiens OX=9606 GN=RPL11 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21.0 null 0.06 21.0 1 1 1 PRT sp|P83731|RL24_HUMAN 60S ribosomal protein L24 OS=Homo sapiens OX=9606 GN=RPL24 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21.0 null 36-UNIMOD:4 0.06 21.0 1 1 1 PRT sp|P35658|NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21.0 null 0.00 21.0 1 1 1 PRT sp|P14618|KPYM_HUMAN Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21.0 null 0.02 21.0 1 1 1 PRT sp|Q2VIR3|IF2GL_HUMAN Eukaryotic translation initiation factor 2 subunit 3B OS=Homo sapiens OX=9606 GN=EIF2S3B PE=2 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21.0 null 0.03 21.0 1 1 1 PRT sp|O95782|AP2A1_HUMAN AP-2 complex subunit alpha-1 OS=Homo sapiens OX=9606 GN=AP2A1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21.0 null 225-UNIMOD:4 0.01 21.0 1 1 0 PRT sp|Q15293|RCN1_HUMAN Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21.0 null 0.04 21.0 2 1 0 PRT sp|P61586|RHOA_HUMAN Transforming protein RhoA OS=Homo sapiens OX=9606 GN=RHOA PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21.0 null 16-UNIMOD:4 0.06 21.0 1 1 1 PRT sp|Q15424-3|SAFB1_HUMAN Isoform 3 of Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.01 20.0 1 1 1 PRT sp|B2RPK0|HGB1A_HUMAN Putative high mobility group protein B1-like 1 OS=Homo sapiens OX=9606 GN=HMGB1P1 PE=5 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.04 20.0 1 1 1 PRT sp|P62913-2|RL11_HUMAN Isoform 2 of 60S ribosomal protein L11 OS=Homo sapiens OX=9606 GN=RPL11 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 71-UNIMOD:4 0.23 20.0 4 3 2 PRT sp|Q3MHD2-2|LSM12_HUMAN Isoform 2 of Protein LSM12 homolog OS=Homo sapiens OX=9606 GN=LSM12 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.05 20.0 1 1 1 PRT sp|P25685|DNJB1_HUMAN DnaJ homolog subfamily B member 1 OS=Homo sapiens OX=9606 GN=DNAJB1 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.04 20.0 1 1 1 PRT sp|Q9NWB6|ARGL1_HUMAN Arginine and glutamate-rich protein 1 OS=Homo sapiens OX=9606 GN=ARGLU1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.03 20.0 4 1 0 PRT sp|P00491|PNPH_HUMAN Purine nucleoside phosphorylase OS=Homo sapiens OX=9606 GN=PNP PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.04 20.0 1 1 1 PRT sp|P78417|GSTO1_HUMAN Glutathione S-transferase omega-1 OS=Homo sapiens OX=9606 GN=GSTO1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 192-UNIMOD:4 0.05 20.0 1 1 1 PRT sp|Q09028-2|RBBP4_HUMAN Isoform 2 of Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 166-UNIMOD:4 0.04 20.0 1 1 1 PRT sp|P00558-2|PGK1_HUMAN Isoform 2 of Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 71-UNIMOD:4,22-UNIMOD:4 0.07 20.0 3 3 3 PRT sp|Q01469|FABP5_HUMAN Fatty acid-binding protein 5 OS=Homo sapiens OX=9606 GN=FABP5 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.07 20.0 1 1 1 PRT sp|O75821|EIF3G_HUMAN Eukaryotic translation initiation factor 3 subunit G OS=Homo sapiens OX=9606 GN=EIF3G PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 139-UNIMOD:4 0.08 20.0 2 2 2 PRT sp|Q16186|ADRM1_HUMAN Proteasomal ubiquitin receptor ADRM1 OS=Homo sapiens OX=9606 GN=ADRM1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.04 20.0 1 1 1 PRT sp|Q13485|SMAD4_HUMAN Mothers against decapentaplegic homolog 4 OS=Homo sapiens OX=9606 GN=SMAD4 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|Q9Y5B6-2|PAXB1_HUMAN Isoform 2 of PAX3- and PAX7-binding protein 1 OS=Homo sapiens OX=9606 GN=PAXBP1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.01 20.0 1 1 1 PRT sp|P48444|COPD_HUMAN Coatomer subunit delta OS=Homo sapiens OX=9606 GN=ARCN1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.05 20.0 2 2 2 PRT sp|P55072|TERA_HUMAN Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1000663, ProteinPilot, ] 20.0 null 0.05 20.0 5 5 5 PRT sp|P80303-2|NUCB2_HUMAN Isoform 2 of Nucleobindin-2 OS=Homo sapiens OX=9606 GN=NUCB2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.03 20.0 1 1 1 PRT sp|P53007|TXTP_HUMAN Tricarboxylate transport protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.04 20.0 1 1 1 PRT sp|P54578-2|UBP14_HUMAN Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo sapiens OX=9606 GN=USP14 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 222-UNIMOD:4 0.03 20.0 1 1 0 PRT sp|P00492|HPRT_HUMAN Hypoxanthine-guanine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=HPRT1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 106-UNIMOD:4 0.06 20.0 1 1 1 PRT sp|P39687|AN32A_HUMAN Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Homo sapiens OX=9606 GN=ANP32A PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.07 20.0 2 2 2 PRT sp|O75400-3|PR40A_HUMAN Isoform 3 of Pre-mRNA-processing factor 40 homolog A OS=Homo sapiens OX=9606 GN=PRPF40A null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.03 20.0 2 2 2 PRT sp|P21741|MK_HUMAN Midkine OS=Homo sapiens OX=9606 GN=MDK PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 116-UNIMOD:4 0.08 20.0 1 1 1 PRT sp|P31689-2|DNJA1_HUMAN Isoform 2 of DnaJ homolog subfamily A member 1 OS=Homo sapiens OX=9606 GN=DNAJA1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.03 20.0 1 1 1 PRT sp|P62333|PRS10_HUMAN 26S proteasome regulatory subunit 10B OS=Homo sapiens OX=9606 GN=PSMC6 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.06 20.0 2 2 2 PRT sp|A6PVS8|LRIQ3_HUMAN Leucine-rich repeat and IQ domain-containing protein 3 OS=Homo sapiens OX=9606 GN=LRRIQ3 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 445-UNIMOD:35 0.02 20.0 1 1 1 PRT sp|Q96EY7|PTCD3_HUMAN Pentatricopeptide repeat domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD3 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.01 20.0 1 1 1 PRT sp|P46087-4|NOP2_HUMAN Isoform 4 of Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NOP2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|P17844-2|DDX5_HUMAN Isoform 2 of Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens OX=9606 GN=DDX5 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.02 20.0 2 2 2 PRT sp|Q9H2G2-2|SLK_HUMAN Isoform 2 of STE20-like serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SLK null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.01 20.0 1 1 1 PRT sp|Q16881-2|TRXR1_HUMAN Isoform 2 of Thioredoxin reductase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TXNRD1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|Q13617-2|CUL2_HUMAN Isoform 2 of Cullin-2 OS=Homo sapiens OX=9606 GN=CUL2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.01 20.0 1 1 1 PRT sp|Q96RS6-2|NUDC1_HUMAN Isoform 2 of NudC domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NUDCD1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 347-UNIMOD:4 0.02 20.0 1 1 0 PRT sp|Q13630|FCL_HUMAN GDP-L-fucose synthase OS=Homo sapiens OX=9606 GN=TSTA3 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.04 20.0 1 1 1 PRT sp|Q96ME7-3|ZN512_HUMAN Isoform 3 of Zinc finger protein 512 OS=Homo sapiens OX=9606 GN=ZNF512 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|P50851-2|LRBA_HUMAN Isoform 2 of Lipopolysaccharide-responsive and beige-like anchor protein OS=Homo sapiens OX=9606 GN=LRBA null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 1228-UNIMOD:4 0.01 20.0 1 1 1 PRT sp|P37268|FDFT_HUMAN Squalene synthase OS=Homo sapiens OX=9606 GN=FDFT1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.05 20.0 3 2 1 PRT sp|O00515|LAD1_HUMAN Ladinin-1 OS=Homo sapiens OX=9606 GN=LAD1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.03 20.0 1 1 1 PRT sp|Q12797-10|ASPH_HUMAN Isoform 10 of Aspartyl/asparaginyl beta-hydroxylase OS=Homo sapiens OX=9606 GN=ASPH null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|Q99567|NUP88_HUMAN Nuclear pore complex protein Nup88 OS=Homo sapiens OX=9606 GN=NUP88 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 155-UNIMOD:4 0.02 20.0 1 1 1 PRT sp|Q9NP97|DLRB1_HUMAN Dynein light chain roadblock-type 1 OS=Homo sapiens OX=9606 GN=DYNLRB1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.11 20.0 1 1 1 PRT sp|P41250|GARS_HUMAN Glycine--tRNA ligase OS=Homo sapiens OX=9606 GN=GARS PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 466-UNIMOD:4,471-UNIMOD:4 0.01 20.0 1 1 1 PRT sp|P48047|ATPO_HUMAN ATP synthase subunit O, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PO PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.04 20.0 1 1 1 PRT sp|P47755-2|CAZA2_HUMAN Isoform 2 of F-actin-capping protein subunit alpha-2 OS=Homo sapiens OX=9606 GN=CAPZA2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.05 20.0 2 1 0 PRT sp|Q04837|SSBP_HUMAN Single-stranded DNA-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=SSBP1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.06 20.0 1 1 1 PRT sp|P46778|RL21_HUMAN 60S ribosomal protein L21 OS=Homo sapiens OX=9606 GN=RPL21 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.06 20.0 1 1 1 PRT sp|P05186|PPBT_HUMAN Alkaline phosphatase, tissue-nonspecific isozyme OS=Homo sapiens OX=9606 GN=ALPL PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|Q9UBT2|SAE2_HUMAN SUMO-activating enzyme subunit 2 OS=Homo sapiens OX=9606 GN=UBA2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.02 20.0 2 1 0 PRT sp|P09496-2|CLCA_HUMAN Isoform Non-brain of Clathrin light chain A OS=Homo sapiens OX=9606 GN=CLTA null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.10 20.0 2 2 2 PRT sp|Q9H814|PHAX_HUMAN Phosphorylated adapter RNA export protein OS=Homo sapiens OX=9606 GN=PHAX PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.04 20.0 1 1 1 PRT sp|O75312|ZPR1_HUMAN Zinc finger protein ZPR1 OS=Homo sapiens OX=9606 GN=ZPR1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.03 20.0 1 1 1 PRT sp|Q9NQW7-3|XPP1_HUMAN Isoform 3 of Xaa-Pro aminopeptidase 1 OS=Homo sapiens OX=9606 GN=XPNPEP1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|P25787|PSA2_HUMAN Proteasome subunit alpha type-2 OS=Homo sapiens OX=9606 GN=PSMA2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 20.0 null 0.05 20.0 3 1 0 PRT sp|Q14978-2|NOLC1_HUMAN Isoform Beta of Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.04 20.0 3 3 3 PRT sp|P20042|IF2B_HUMAN Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.09 20.0 3 3 3 PRT sp|Q15006|EMC2_HUMAN ER membrane protein complex subunit 2 OS=Homo sapiens OX=9606 GN=EMC2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.04 20.0 1 1 1 PRT sp|Q9H2J4|PDCL3_HUMAN Phosducin-like protein 3 OS=Homo sapiens OX=9606 GN=PDCL3 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.05 20.0 1 1 1 PRT sp|O94776|MTA2_HUMAN Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 209-UNIMOD:4 0.03 20.0 2 2 2 PRT sp|P15927-3|RFA2_HUMAN Isoform 3 of Replication protein A 32 kDa subunit OS=Homo sapiens OX=9606 GN=RPA2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.03 20.0 1 1 1 PRT sp|Q9H3U1-2|UN45A_HUMAN Isoform 2 of Protein unc-45 homolog A OS=Homo sapiens OX=9606 GN=UNC45A null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 208-UNIMOD:4 0.01 20.0 1 1 1 PRT sp|P62191|PRS4_HUMAN 26S proteasome regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMC1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 20.0 null 58-UNIMOD:4 0.07 20.0 4 3 2 PRT sp|Q92769|HDAC2_HUMAN Histone deacetylase 2 OS=Homo sapiens OX=9606 GN=HDAC2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.03 20.0 1 1 1 PRT sp|Q7KZF4|SND1_HUMAN Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SND1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.01 20.0 1 1 1 PRT sp|P53634|CATC_HUMAN Dipeptidyl peptidase 1 OS=Homo sapiens OX=9606 GN=CTSC PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.02 20.0 2 1 0 PRT sp|Q13423|NNTM_HUMAN NAD(P) transhydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=NNT PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.01 20.0 1 1 1 PRT sp|P60983|GMFB_HUMAN Glia maturation factor beta OS=Homo sapiens OX=9606 GN=GMFB PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.07 20.0 1 1 1 PRT sp|P27144|KAD4_HUMAN Adenylate kinase 4, mitochondrial OS=Homo sapiens OX=9606 GN=AK4 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.05 20.0 1 1 1 PRT sp|Q96G03|PGM2_HUMAN Phosphoglucomutase-2 OS=Homo sapiens OX=9606 GN=PGM2 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|Q8IZQ5|SELH_HUMAN Selenoprotein H OS=Homo sapiens OX=9606 GN=SELENOH PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.10 20.0 2 1 0 PRT sp|Q14166|TTL12_HUMAN Tubulin--tyrosine ligase-like protein 12 OS=Homo sapiens OX=9606 GN=TTLL12 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.04 20.0 2 2 2 PRT sp|Q9UNZ2-4|NSF1C_HUMAN Isoform 2 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.03 20.0 1 1 1 PRT sp|O00232|PSD12_HUMAN 26S proteasome non-ATPase regulatory subunit 12 OS=Homo sapiens OX=9606 GN=PSMD12 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|Q9NWY4|HPF1_HUMAN Histone PARylation factor 1 OS=Homo sapiens OX=9606 GN=HPF1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.03 20.0 1 1 1 PRT sp|P26440|IVD_HUMAN Isovaleryl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=IVD PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.04 20.0 2 2 2 PRT sp|Q13330|MTA1_HUMAN Metastasis-associated protein MTA1 OS=Homo sapiens OX=9606 GN=MTA1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|O60925|PFD1_HUMAN Prefoldin subunit 1 OS=Homo sapiens OX=9606 GN=PFDN1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.16 20.0 2 2 2 PRT sp|Q86X55-1|CARM1_HUMAN Isoform 1 of Histone-arginine methyltransferase CARM1 OS=Homo sapiens OX=9606 GN=CARM1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|Q96A72|MGN2_HUMAN Protein mago nashi homolog 2 OS=Homo sapiens OX=9606 GN=MAGOHB PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1000663, ProteinPilot, ] 20.0 null 0.07 20.0 1 1 1 PRT sp|Q99497|PARK7_HUMAN Protein/nucleic acid deglycase DJ-1 OS=Homo sapiens OX=9606 GN=PARK7 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.05 20.0 2 1 0 PRT sp|Q9BYN8|RT26_HUMAN 28S ribosomal protein S26, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS26 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.06 20.0 1 1 1 PRT sp|Q9UMS4|PRP19_HUMAN Pre-mRNA-processing factor 19 OS=Homo sapiens OX=9606 GN=PRPF19 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 114-UNIMOD:4 0.05 20.0 4 2 1 PRT sp|Q01813-2|PFKAP_HUMAN Isoform 2 of ATP-dependent 6-phosphofructokinase, platelet type OS=Homo sapiens OX=9606 GN=PFKP null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 104-UNIMOD:4 0.01 20.0 1 1 1 PRT sp|Q9UDY2-7|ZO2_HUMAN Isoform 7 of Tight junction protein ZO-2 OS=Homo sapiens OX=9606 GN=TJP2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.03 20.0 3 3 3 PRT sp|Q99661|KIF2C_HUMAN Kinesin-like protein KIF2C OS=Homo sapiens OX=9606 GN=KIF2C PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.01 20.0 1 1 1 PRT sp|P68036|UB2L3_HUMAN Ubiquitin-conjugating enzyme E2 L3 OS=Homo sapiens OX=9606 GN=UBE2L3 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.06 20.0 1 1 1 PRT sp|P33992|MCM5_HUMAN DNA replication licensing factor MCM5 OS=Homo sapiens OX=9606 GN=MCM5 PE=1 SV=5 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.01 20.0 1 1 1 PRT sp|P28066|PSA5_HUMAN Proteasome subunit alpha type-5 OS=Homo sapiens OX=9606 GN=PSMA5 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.05 20.0 1 1 1 PRT sp|Q9Y230-2|RUVB2_HUMAN Isoform 2 of RuvB-like 2 OS=Homo sapiens OX=9606 GN=RUVBL2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.03 20.0 2 1 0 PRT sp|P54136|SYRC_HUMAN Arginine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=RARS PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|O95400|CD2B2_HUMAN CD2 antigen cytoplasmic tail-binding protein 2 OS=Homo sapiens OX=9606 GN=CD2BP2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.03 20.0 1 1 1 PRT sp|P45974-2|UBP5_HUMAN Isoform Short of Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens OX=9606 GN=USP5 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.01 20.0 1 1 1 PRT sp|Q14690|RRP5_HUMAN Protein RRP5 homolog OS=Homo sapiens OX=9606 GN=PDCD11 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.02 20.0 3 3 3 PRT sp|Q86UP2|KTN1_HUMAN Kinectin OS=Homo sapiens OX=9606 GN=KTN1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 20.0 null 0.02 20.0 2 2 2 PRT sp|Q9P0K7-3|RAI14_HUMAN Isoform 3 of Ankycorbin OS=Homo sapiens OX=9606 GN=RAI14 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.01 20.0 1 1 1 PRT sp|Q15075|EEA1_HUMAN Early endosome antigen 1 OS=Homo sapiens OX=9606 GN=EEA1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.01 20.0 1 1 1 PRT sp|O15305|PMM2_HUMAN Phosphomannomutase 2 OS=Homo sapiens OX=9606 GN=PMM2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.05 20.0 1 1 1 PRT sp|Q9NSE4|SYIM_HUMAN Isoleucine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=IARS2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 1002-UNIMOD:4 0.01 20.0 1 1 1 PRT sp|Q04726-4|TLE3_HUMAN Isoform 4 of Transducin-like enhancer protein 3 OS=Homo sapiens OX=9606 GN=TLE3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|P62273-2|RS29_HUMAN Isoform 2 of 40S ribosomal protein S29 OS=Homo sapiens OX=9606 GN=RPS29 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.18 20.0 3 1 0 PRT sp|P00387-2|NB5R3_HUMAN Isoform 2 of NADH-cytochrome b5 reductase 3 OS=Homo sapiens OX=9606 GN=CYB5R3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.05 20.0 1 1 1 PRT sp|P36873-2|PP1G_HUMAN Isoform 2 of Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Homo sapiens OX=9606 GN=PPP1CC null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.03 20.0 2 1 0 PRT sp|Q4V328-4|GRAP1_HUMAN Isoform 4 of GRIP1-associated protein 1 OS=Homo sapiens OX=9606 GN=GRIPAP1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.04 20.0 3 3 3 PRT sp|P53621-2|COPA_HUMAN Isoform 2 of Coatomer subunit alpha OS=Homo sapiens OX=9606 GN=COPA null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 589-UNIMOD:4 0.02 20.0 3 3 3 PRT sp|Q02750-2|MP2K1_HUMAN Isoform 2 of Dual specificity mitogen-activated protein kinase kinase 1 OS=Homo sapiens OX=9606 GN=MAP2K1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.03 20.0 1 1 1 PRT sp|Q96RP9-2|EFGM_HUMAN Isoform 2 of Elongation factor G, mitochondrial OS=Homo sapiens OX=9606 GN=GFM1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.01 20.0 1 1 1 PRT sp|Q92520|FAM3C_HUMAN Protein FAM3C OS=Homo sapiens OX=9606 GN=FAM3C PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.05 20.0 1 1 1 PRT sp|P10644|KAP0_HUMAN cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR1A PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1000663, ProteinPilot, ] 20.0 null 0.03 20.0 1 1 1 PRT sp|Q9NXE4-2|NSMA3_HUMAN Isoform 2 of Sphingomyelin phosphodiesterase 4 OS=Homo sapiens OX=9606 GN=SMPD4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.01 20.0 1 1 1 PRT sp|O75396|SC22B_HUMAN Vesicle-trafficking protein SEC22b OS=Homo sapiens OX=9606 GN=SEC22B PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.05 20.0 1 1 1 PRT sp|P62760|VISL1_HUMAN Visinin-like protein 1 OS=Homo sapiens OX=9606 GN=VSNL1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.05 20.0 1 1 1 PRT sp|Q9UJY5-6|GGA1_HUMAN Isoform 6 of ADP-ribosylation factor-binding protein GGA1 OS=Homo sapiens OX=9606 GN=GGA1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|P05091-2|ALDH2_HUMAN Isoform 2 of Aldehyde dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 339-UNIMOD:4 0.03 20.0 1 1 1 PRT sp|Q10472|GALT1_HUMAN Polypeptide N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=GALNT1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 523-UNIMOD:4 0.04 20.0 2 2 2 PRT sp|Q9UNX4|WDR3_HUMAN WD repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=WDR3 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.01 20.0 1 1 1 PRT sp|P13645|K1C10_HUMAN Keratin, type I cytoskeletal 10 OS=Homo sapiens OX=9606 GN=KRT10 PE=1 SV=6 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.07 20.0 4 4 4 PRT sp|P05026-2|AT1B1_HUMAN Isoform 2 of Sodium/potassium-transporting ATPase subunit beta-1 OS=Homo sapiens OX=9606 GN=ATP1B1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.04 20.0 1 1 1 PRT sp|O75534-2|CSDE1_HUMAN Isoform 2 of Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 475-UNIMOD:4 0.07 20.0 4 4 4 PRT sp|O43395|PRPF3_HUMAN U4/U6 small nuclear ribonucleoprotein Prp3 OS=Homo sapiens OX=9606 GN=PRPF3 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|P18858-2|DNLI1_HUMAN Isoform 2 of DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|Q9Y2Q5-2|LTOR2_HUMAN Isoform 2 of Ragulator complex protein LAMTOR2 OS=Homo sapiens OX=9606 GN=LAMTOR2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.09 20.0 1 1 1 PRT sp|Q7Z417|NUFP2_HUMAN Nuclear fragile X mental retardation-interacting protein 2 OS=Homo sapiens OX=9606 GN=NUFIP2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|Q8ND24|RN214_HUMAN RING finger protein 214 OS=Homo sapiens OX=9606 GN=RNF214 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|O43143|DHX15_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Homo sapiens OX=9606 GN=DHX15 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.03 20.0 5 3 2 PRT sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.00 20.0 1 1 1 PRT sp|P55795|HNRH2_HUMAN Heterogeneous nuclear ribonucleoprotein H2 OS=Homo sapiens OX=9606 GN=HNRNPH2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 290-UNIMOD:4 0.04 20.0 1 1 1 PRT sp|Q9NUQ3-2|TXLNG_HUMAN Isoform 2 of Gamma-taxilin OS=Homo sapiens OX=9606 GN=TXLNG null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.08 20.0 3 3 3 PRT sp|Q5JRX3-2|PREP_HUMAN Isoform 2 of Presequence protease, mitochondrial OS=Homo sapiens OX=9606 GN=PITRM1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.02 20.0 2 2 2 PRT sp|P06744-2|G6PI_HUMAN Isoform 2 of Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.04 20.0 2 2 2 PRT sp|Q15370-2|ELOB_HUMAN Isoform 2 of Elongin-B OS=Homo sapiens OX=9606 GN=ELOB null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.17 20.0 4 3 2 PRT sp|Q9BTE3-2|MCMBP_HUMAN Isoform 2 of Mini-chromosome maintenance complex-binding protein OS=Homo sapiens OX=9606 GN=MCMBP null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|Q13451|FKBP5_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Homo sapiens OX=9606 GN=FKBP5 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|Q7LBR1|CHM1B_HUMAN Charged multivesicular body protein 1b OS=Homo sapiens OX=9606 GN=CHMP1B PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.05 20.0 1 1 1 PRT sp|Q6I9Y2|THOC7_HUMAN THO complex subunit 7 homolog OS=Homo sapiens OX=9606 GN=THOC7 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ] 20.0 null 2-UNIMOD:1 0.11 20.0 2 2 2 PRT sp|Q5ZPR3-3|CD276_HUMAN Isoform 3 of CD276 antigen OS=Homo sapiens OX=9606 GN=CD276 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.06 20.0 2 2 2 PRT sp|Q8N3U4-2|STAG2_HUMAN Isoform 2 of Cohesin subunit SA-2 OS=Homo sapiens OX=9606 GN=STAG2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 632-UNIMOD:4 0.02 20.0 2 2 2 PRT sp|Q8WWQ0|PHIP_HUMAN PH-interacting protein OS=Homo sapiens OX=9606 GN=PHIP PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.01 20.0 1 1 1 PRT sp|O95983-2|MBD3_HUMAN Isoform 2 of Methyl-CpG-binding domain protein 3 OS=Homo sapiens OX=9606 GN=MBD3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.04 20.0 1 1 1 PRT sp|Q13724|MOGS_HUMAN Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.01 20.0 1 1 1 PRT sp|Q9UKA9-2|PTBP2_HUMAN Isoform 2 of Polypyrimidine tract-binding protein 2 OS=Homo sapiens OX=9606 GN=PTBP2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|P63151-2|2ABA_HUMAN Isoform 2 of Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R2A null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.03 20.0 2 1 0 PRT sp|Q66PJ3-2|AR6P4_HUMAN Isoform 2 of ADP-ribosylation factor-like protein 6-interacting protein 4 OS=Homo sapiens OX=9606 GN=ARL6IP4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.04 20.0 1 1 1 PRT sp|P78406|RAE1L_HUMAN mRNA export factor OS=Homo sapiens OX=9606 GN=RAE1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.03 20.0 1 1 1 PRT sp|Q9HCE1|MOV10_HUMAN Putative helicase MOV-10 OS=Homo sapiens OX=9606 GN=MOV10 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.01 20.0 1 1 1 PRT sp|P23378|GCSP_HUMAN Glycine dehydrogenase (decarboxylating), mitochondrial OS=Homo sapiens OX=9606 GN=GLDC PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 225-UNIMOD:4 0.02 20.0 2 2 2 PRT sp|P78316|NOP14_HUMAN Nucleolar protein 14 OS=Homo sapiens OX=9606 GN=NOP14 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|Q07960|RHG01_HUMAN Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=ARHGAP1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.03 20.0 1 1 1 PRT sp|P54709|AT1B3_HUMAN Sodium/potassium-transporting ATPase subunit beta-3 OS=Homo sapiens OX=9606 GN=ATP1B3 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.03 20.0 1 1 1 PRT sp|O43660-2|PLRG1_HUMAN Isoform 2 of Pleiotropic regulator 1 OS=Homo sapiens OX=9606 GN=PLRG1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.04 20.0 1 1 1 PRT sp|Q5JPE7-2|NOMO2_HUMAN Isoform 2 of Nodal modulator 2 OS=Homo sapiens OX=9606 GN=NOMO2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.01 20.0 1 1 1 PRT sp|O75663-2|TIPRL_HUMAN Isoform 2 of TIP41-like protein OS=Homo sapiens OX=9606 GN=TIPRL null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 87-UNIMOD:4 0.07 20.0 1 1 1 PRT sp|Q14BN4-8|SLMAP_HUMAN Isoform 8 of Sarcolemmal membrane-associated protein OS=Homo sapiens OX=9606 GN=SLMAP null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.05 20.0 1 1 1 PRT sp|Q9BYV9|BACH2_HUMAN Transcription regulator protein BACH2 OS=Homo sapiens OX=9606 GN=BACH2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 340-UNIMOD:4 0.01 20.0 1 1 1 PRT sp|Q86U38|NOP9_HUMAN Nucleolar protein 9 OS=Homo sapiens OX=9606 GN=NOP9 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|Q9Y6C9|MTCH2_HUMAN Mitochondrial carrier homolog 2 OS=Homo sapiens OX=9606 GN=MTCH2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20.0 null 0.07 20.0 1 1 1 PRT sp|Q13428|TCOF_HUMAN Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20.0 null 0.01 20.0 1 1 1 PRT sp|Q16643|DREB_HUMAN Drebrin OS=Homo sapiens OX=9606 GN=DBN1 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 20.0 null 239-UNIMOD:28,96-UNIMOD:385,96-UNIMOD:4,98-UNIMOD:4 0.03 20.0 2 2 1 PRT sp|P54886|P5CS_HUMAN Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens OX=9606 GN=ALDH18A1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 20.0 null 139-UNIMOD:28 0.02 20.0 1 1 1 PRT sp|Q9UHB9|SRP68_HUMAN Signal recognition particle subunit SRP68 OS=Homo sapiens OX=9606 GN=SRP68 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20.0 null 0.04 20.0 2 2 2 PRT sp|P52789|HXK2_HUMAN Hexokinase-2 OS=Homo sapiens OX=9606 GN=HK2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20.0 null 0.01 20.0 2 1 0 PRT sp|Q16555|DPYL2_HUMAN Dihydropyrimidinase-related protein 2 OS=Homo sapiens OX=9606 GN=DPYSL2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 20.0 null 0.02 20.0 2 1 0 PRT sp|P46977|STT3A_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Homo sapiens OX=9606 GN=STT3A PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20.0 null 0.01 20.0 1 1 1 PRT sp|Q92979|NEP1_HUMAN Ribosomal RNA small subunit methyltransferase NEP1 OS=Homo sapiens OX=9606 GN=EMG1 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 20.0 null 2-UNIMOD:1 0.05 20.0 1 1 1 PRT sp|P0CG39|POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens OX=9606 GN=POTEJ PE=3 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20.0 null 880-UNIMOD:4 0.02 20.0 2 1 0 PRT sp|Q96A08|H2B1A_HUMAN Histone H2B type 1-A OS=Homo sapiens OX=9606 GN=HIST1H2BA PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20.0 null 0.09 20.0 1 1 0 PRT sp|Q8N357|S35F6_HUMAN Solute carrier family 35 member F6 OS=Homo sapiens OX=9606 GN=SLC35F6 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20.0 null 0.04 20.0 1 1 1 PRT sp|P24752|THIL_HUMAN Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20.0 null 196-UNIMOD:4 0.03 20.0 1 1 1 PRT sp|Q14978|NOLC1_HUMAN Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|O15294|OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20.0 null 0.01 20.0 1 1 1 PRT sp|P35613|BASI_HUMAN Basigin OS=Homo sapiens OX=9606 GN=BSG PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20.0 null 0.03 20.0 2 1 0 PRT sp|P60866|RS20_HUMAN 40S ribosomal protein S20 OS=Homo sapiens OX=9606 GN=RPS20 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20.0 null 0.10 20.0 1 1 0 PRT sp|P37840|SYUA_HUMAN Alpha-synuclein OS=Homo sapiens OX=9606 GN=SNCA PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20.0 null 0.07 20.0 1 1 1 PRT sp|Q02539|H11_HUMAN Histone H1.1 OS=Homo sapiens OX=9606 GN=HIST1H1A PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20.0 null 0.06 20.0 2 1 0 PRT sp|Q9NRZ9|HELLS_HUMAN Lymphoid-specific helicase OS=Homo sapiens OX=9606 GN=HELLS PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20.0 null 0.01 20.0 1 1 1 PRT sp|P68366-2|TBA4A_HUMAN Isoform 2 of Tubulin alpha-4A chain OS=Homo sapiens OX=9606 GN=TUBA4A null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.06 19.0 3 3 3 PRT sp|O60264|SMCA5_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens OX=9606 GN=SMARCA5 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 259-UNIMOD:4 0.03 19.0 3 3 3 PRT sp|O75152|ZC11A_HUMAN Zinc finger CCCH domain-containing protein 11A OS=Homo sapiens OX=9606 GN=ZC3H11A PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.03 19.0 1 1 1 PRT sp|P42285|MTREX_HUMAN Exosome RNA helicase MTR4 OS=Homo sapiens OX=9606 GN=MTREX PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|P11388|TOP2A_HUMAN DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1000663, ProteinPilot, ] 19.0 null 0.01 19.0 1 1 0 PRT sp|O43252|PAPS1_HUMAN Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1 OS=Homo sapiens OX=9606 GN=PAPSS1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.02 19.0 1 1 1 PRT sp|P51610-2|HCFC1_HUMAN Isoform 2 of Host cell factor 1 OS=Homo sapiens OX=9606 GN=HCFC1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.01 19.0 3 2 1 PRT sp|Q9NVU7-2|SDA1_HUMAN Isoform 2 of Protein SDA1 homolog OS=Homo sapiens OX=9606 GN=SDAD1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.02 19.0 1 1 1 PRT sp|Q15274|NADC_HUMAN Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Homo sapiens OX=9606 GN=QPRT PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.09 19.0 2 2 2 PRT sp|Q9UI26-2|IPO11_HUMAN Isoform 2 of Importin-11 OS=Homo sapiens OX=9606 GN=IPO11 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|Q9Y4W6|AFG32_HUMAN AFG3-like protein 2 OS=Homo sapiens OX=9606 GN=AFG3L2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.02 19.0 1 1 1 PRT sp|Q13907|IDI1_HUMAN Isopentenyl-diphosphate Delta-isomerase 1 OS=Homo sapiens OX=9606 GN=IDI1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 39-UNIMOD:4 0.10 19.0 2 2 2 PRT sp|P23396-2|RS3_HUMAN Isoform 2 of 40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.10 19.0 3 3 3 PRT sp|P46782|RS5_HUMAN 40S ribosomal protein S5 OS=Homo sapiens OX=9606 GN=RPS5 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 66-UNIMOD:4 0.15 19.0 4 3 2 PRT sp|P49207|RL34_HUMAN 60S ribosomal protein L34 OS=Homo sapiens OX=9606 GN=RPL34 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 83-UNIMOD:4 0.09 19.0 1 1 1 PRT sp|O95104-2|SFR15_HUMAN Isoform 2 of Splicing factor, arginine/serine-rich 15 OS=Homo sapiens OX=9606 GN=SCAF4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|Q9UNH7|SNX6_HUMAN Sorting nexin-6 OS=Homo sapiens OX=9606 GN=SNX6 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.05 19.0 2 2 2 PRT sp|Q9NUD5|ZCHC3_HUMAN Zinc finger CCHC domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ZCCHC3 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.03 19.0 1 1 1 PRT sp|Q99829|CPNE1_HUMAN Copine-1 OS=Homo sapiens OX=9606 GN=CPNE1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 53-UNIMOD:4 0.02 19.0 1 1 1 PRT sp|P26358|DNMT1_HUMAN DNA (cytosine-5)-methyltransferase 1 OS=Homo sapiens OX=9606 GN=DNMT1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 62-UNIMOD:4 0.02 19.0 3 3 3 PRT sp|Q6PD62|CTR9_HUMAN RNA polymerase-associated protein CTR9 homolog OS=Homo sapiens OX=9606 GN=CTR9 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 363-UNIMOD:4 0.01 19.0 1 1 1 PRT sp|Q5TDH0-3|DDI2_HUMAN Isoform 3 of Protein DDI1 homolog 2 OS=Homo sapiens OX=9606 GN=DDI2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.02 19.0 1 1 1 PRT sp|O75822-2|EIF3J_HUMAN Isoform 2 of Eukaryotic translation initiation factor 3 subunit J OS=Homo sapiens OX=9606 GN=EIF3J null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.05 19.0 1 1 1 PRT sp|Q9BQE5|APOL2_HUMAN Apolipoprotein L2 OS=Homo sapiens OX=9606 GN=APOL2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.04 19.0 1 1 1 PRT sp|Q15003-2|CND2_HUMAN Isoform 2 of Condensin complex subunit 2 OS=Homo sapiens OX=9606 GN=NCAPH null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 173-UNIMOD:4 0.02 19.0 1 1 1 PRT sp|Q8IUD2|RB6I2_HUMAN ELKS/Rab6-interacting/CAST family member 1 OS=Homo sapiens OX=9606 GN=ERC1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|Q8N490-2|PNKD_HUMAN Isoform 2 of Probable hydrolase PNKD OS=Homo sapiens OX=9606 GN=PNKD null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.08 19.0 1 1 1 PRT sp|Q15007|FL2D_HUMAN Pre-mRNA-splicing regulator WTAP OS=Homo sapiens OX=9606 GN=WTAP PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.04 19.0 1 1 1 PRT sp|Q92925-2|SMRD2_HUMAN Isoform 2 of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2 OS=Homo sapiens OX=9606 GN=SMARCD2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.02 19.0 1 1 1 PRT sp|Q15185-3|TEBP_HUMAN Isoform 3 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.08 19.0 1 1 1 PRT sp|P05387|RLA2_HUMAN 60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.08 19.0 2 1 0 PRT sp|P51784|UBP11_HUMAN Ubiquitin carboxyl-terminal hydrolase 11 OS=Homo sapiens OX=9606 GN=USP11 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|P51532-2|SMCA4_HUMAN Isoform 2 of Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 1205-UNIMOD:4 0.02 19.0 3 3 3 PRT sp|Q9UI09-2|NDUAC_HUMAN Isoform 2 of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 OS=Homo sapiens OX=9606 GN=NDUFA12 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.16 19.0 1 1 1 PRT sp|P20645|MPRD_HUMAN Cation-dependent mannose-6-phosphate receptor OS=Homo sapiens OX=9606 GN=M6PR PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 32-UNIMOD:4 0.03 19.0 1 1 1 PRT sp|P50395|GDIB_HUMAN Rab GDP dissociation inhibitor beta OS=Homo sapiens OX=9606 GN=GDI2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.09 19.0 4 4 4 PRT sp|P60842-2|IF4A1_HUMAN Isoform 2 of Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.03 19.0 1 1 1 PRT sp|Q9NPD3|EXOS4_HUMAN Exosome complex component RRP41 OS=Homo sapiens OX=9606 GN=EXOSC4 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.04 19.0 1 1 1 PRT sp|Q13610|PWP1_HUMAN Periodic tryptophan protein 1 homolog OS=Homo sapiens OX=9606 GN=PWP1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 400-UNIMOD:4 0.02 19.0 1 1 1 PRT sp|P43487-2|RANG_HUMAN Isoform 2 of Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.05 19.0 1 1 1 PRT sp|P40926-2|MDHM_HUMAN Isoform 2 of Malate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=MDH2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.04 19.0 1 1 1 PRT sp|P55854-2|SUMO3_HUMAN Isoform 2 of Small ubiquitin-related modifier 3 OS=Homo sapiens OX=9606 GN=SUMO3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.07 19.0 1 1 1 PRT sp|Q10589-2|BST2_HUMAN Isoform 2 of Bone marrow stromal antigen 2 OS=Homo sapiens OX=9606 GN=BST2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.12 19.0 2 2 2 PRT sp|P63208|SKP1_HUMAN S-phase kinase-associated protein 1 OS=Homo sapiens OX=9606 GN=SKP1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 160-UNIMOD:4 0.06 19.0 1 1 1 PRT sp|Q16850-2|CP51A_HUMAN Isoform 2 of Lanosterol 14-alpha demethylase OS=Homo sapiens OX=9606 GN=CYP51A1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.03 19.0 1 1 1 PRT sp|Q96GQ7|DDX27_HUMAN Probable ATP-dependent RNA helicase DDX27 OS=Homo sapiens OX=9606 GN=DDX27 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 259-UNIMOD:4,261-UNIMOD:4 0.03 19.0 2 2 2 PRT sp|Q9HAV0|GBB4_HUMAN Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens OX=9606 GN=GNB4 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 204-UNIMOD:4 0.04 19.0 1 1 1 PRT sp|P35611-2|ADDA_HUMAN Isoform 2 of Alpha-adducin OS=Homo sapiens OX=9606 GN=ADD1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.03 19.0 1 1 1 PRT sp|Q1KMD3|HNRL2_HUMAN Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens OX=9606 GN=HNRNPUL2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.02 19.0 1 1 1 PRT sp|Q15942|ZYX_HUMAN Zyxin OS=Homo sapiens OX=9606 GN=ZYX PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.03 19.0 1 1 1 PRT sp|P46781|RS9_HUMAN 40S ribosomal protein S9 OS=Homo sapiens OX=9606 GN=RPS9 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.09 19.0 3 2 1 PRT sp|P07339|CATD_HUMAN Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.02 19.0 3 1 0 PRT sp|Q14739|LBR_HUMAN Lamin-B receptor OS=Homo sapiens OX=9606 GN=LBR PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.03 19.0 2 2 2 PRT sp|Q9UKM9-2|RALY_HUMAN Isoform 1 of RNA-binding protein Raly OS=Homo sapiens OX=9606 GN=RALY null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.03 19.0 1 1 1 PRT sp|Q9H0U4|RAB1B_HUMAN Ras-related protein Rab-1B OS=Homo sapiens OX=9606 GN=RAB1B PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.08 19.0 1 1 1 PRT sp|Q99832-3|TCPH_HUMAN Isoform 3 of T-complex protein 1 subunit eta OS=Homo sapiens OX=9606 GN=CCT7 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 114-UNIMOD:4 0.06 19.0 3 3 3 PRT sp|P40939|ECHA_HUMAN Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|P51114|FXR1_HUMAN Fragile X mental retardation syndrome-related protein 1 OS=Homo sapiens OX=9606 GN=FXR1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.03 19.0 3 3 3 PRT sp|P26599-2|PTBP1_HUMAN Isoform 2 of Polypyrimidine tract-binding protein 1 OS=Homo sapiens OX=9606 GN=PTBP1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.02 19.0 2 1 0 PRT sp|P14209-3|CD99_HUMAN Isoform 3 of CD99 antigen OS=Homo sapiens OX=9606 GN=CD99 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.09 19.0 1 1 1 PRT sp|O14777|NDC80_HUMAN Kinetochore protein NDC80 homolog OS=Homo sapiens OX=9606 GN=NDC80 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.02 19.0 1 1 1 PRT sp|Q8IY37|DHX37_HUMAN Probable ATP-dependent RNA helicase DHX37 OS=Homo sapiens OX=9606 GN=DHX37 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|Q8NFU3-2|TSTD1_HUMAN Isoform 2 of Thiosulfate:glutathione sulfurtransferase OS=Homo sapiens OX=9606 GN=TSTD1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.15 19.0 1 1 1 PRT sp|Q92600-2|CNOT9_HUMAN Isoform 2 of CCR4-NOT transcription complex subunit 9 OS=Homo sapiens OX=9606 GN=CNOT9 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.04 19.0 1 1 1 PRT sp|Q10567-2|AP1B1_HUMAN Isoform B of AP-1 complex subunit beta-1 OS=Homo sapiens OX=9606 GN=AP1B1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 859-UNIMOD:4 0.01 19.0 1 1 1 PRT sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens OX=9606 GN=EHMT1 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|P46776|RL27A_HUMAN 60S ribosomal protein L27a OS=Homo sapiens OX=9606 GN=RPL27A PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.06 19.0 2 1 0 PRT sp|Q9UBQ0-2|VPS29_HUMAN Isoform 2 of Vacuolar protein sorting-associated protein 29 OS=Homo sapiens OX=9606 GN=VPS29 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.05 19.0 1 1 1 PRT sp|P62280|RS11_HUMAN 40S ribosomal protein S11 OS=Homo sapiens OX=9606 GN=RPS11 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 19.0 null 0.17 19.0 4 3 2 PRT sp|P13073|COX41_HUMAN Cytochrome c oxidase subunit 4 isoform 1, mitochondrial OS=Homo sapiens OX=9606 GN=COX4I1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.07 19.0 3 1 0 PRT sp|Q99961-3|SH3G1_HUMAN Isoform 3 of Endophilin-A2 OS=Homo sapiens OX=9606 GN=SH3GL1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.06 19.0 2 2 2 PRT sp|P62081|RS7_HUMAN 40S ribosomal protein S7 OS=Homo sapiens OX=9606 GN=RPS7 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.05 19.0 2 1 0 PRT sp|Q14019|COTL1_HUMAN Coactosin-like protein OS=Homo sapiens OX=9606 GN=COTL1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.06 19.0 1 1 1 PRT sp|P55145|MANF_HUMAN Mesencephalic astrocyte-derived neurotrophic factor OS=Homo sapiens OX=9606 GN=MANF PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 117-UNIMOD:4 0.05 19.0 1 1 1 PRT sp|Q9HAV7|GRPE1_HUMAN GrpE protein homolog 1, mitochondrial OS=Homo sapiens OX=9606 GN=GRPEL1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.05 19.0 1 1 1 PRT sp|O15160-2|RPAC1_HUMAN Isoform 2 of DNA-directed RNA polymerases I and III subunit RPAC1 OS=Homo sapiens OX=9606 GN=POLR1C null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.04 19.0 1 1 1 PRT sp|P48681|NEST_HUMAN Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 157-UNIMOD:4 0.04 19.0 6 6 6 PRT sp|P21291|CSRP1_HUMAN Cysteine and glycine-rich protein 1 OS=Homo sapiens OX=9606 GN=CSRP1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.06 19.0 1 1 1 PRT sp|P61081|UBC12_HUMAN NEDD8-conjugating enzyme Ubc12 OS=Homo sapiens OX=9606 GN=UBE2M PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.05 19.0 1 1 1 PRT sp|Q13576|IQGA2_HUMAN Ras GTPase-activating-like protein IQGAP2 OS=Homo sapiens OX=9606 GN=IQGAP2 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|Q69YN2|C19L1_HUMAN CWF19-like protein 1 OS=Homo sapiens OX=9606 GN=CWF19L1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 11-UNIMOD:4 0.02 19.0 1 1 1 PRT sp|Q8WVB6-2|CTF18_HUMAN Isoform 2 of Chromosome transmission fidelity protein 18 homolog OS=Homo sapiens OX=9606 GN=CHTF18 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|Q9UJX2-3|CDC23_HUMAN Isoform 3 of Cell division cycle protein 23 homolog OS=Homo sapiens OX=9606 GN=CDC23 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.02 19.0 1 1 1 PRT sp|Q96AC1-2|FERM2_HUMAN Isoform 2 of Fermitin family homolog 2 OS=Homo sapiens OX=9606 GN=FERMT2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.02 19.0 1 1 1 PRT sp|P08621|RU17_HUMAN U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens OX=9606 GN=SNRNP70 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.08 19.0 3 3 3 PRT sp|O75190-3|DNJB6_HUMAN Isoform C of DnaJ homolog subfamily B member 6 OS=Homo sapiens OX=9606 GN=DNAJB6 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.03 19.0 1 1 1 PRT sp|Q9H6Z4-2|RANB3_HUMAN Isoform 2 of Ran-binding protein 3 OS=Homo sapiens OX=9606 GN=RANBP3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.02 19.0 1 1 1 PRT sp|Q9Y3T9|NOC2L_HUMAN Nucleolar complex protein 2 homolog OS=Homo sapiens OX=9606 GN=NOC2L PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 585-UNIMOD:4 0.02 19.0 1 1 1 PRT sp|Q9NY26-2|S39A1_HUMAN Isoform 2 of Zinc transporter ZIP1 OS=Homo sapiens OX=9606 GN=SLC39A1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.06 19.0 1 1 1 PRT sp|Q9NZ09-2|UBAP1_HUMAN Isoform 2 of Ubiquitin-associated protein 1 OS=Homo sapiens OX=9606 GN=UBAP1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 81-UNIMOD:4 0.03 19.0 1 1 1 PRT sp|O14497|ARI1A_HUMAN AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.02 19.0 4 3 2 PRT sp|P12814-2|ACTN1_HUMAN Isoform 2 of Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.01 19.0 2 1 0 PRT sp|P10515|ODP2_HUMAN Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Homo sapiens OX=9606 GN=DLAT PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 488-UNIMOD:4 0.03 19.0 2 2 2 PRT sp|Q5TGZ0-2|MIC10_HUMAN Isoform 2 of MICOS complex subunit MIC10 OS=Homo sapiens OX=9606 GN=MINOS1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 13-UNIMOD:4 0.38 19.0 1 1 1 PRT sp|Q92820|GGH_HUMAN Gamma-glutamyl hydrolase OS=Homo sapiens OX=9606 GN=GGH PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.04 19.0 1 1 1 PRT sp|Q5JTH9-2|RRP12_HUMAN Isoform 2 of RRP12-like protein OS=Homo sapiens OX=9606 GN=RRP12 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|P12955-2|PEPD_HUMAN Isoform 2 of Xaa-Pro dipeptidase OS=Homo sapiens OX=9606 GN=PEPD null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.02 19.0 1 1 1 PRT sp|Q9UJV9|DDX41_HUMAN Probable ATP-dependent RNA helicase DDX41 OS=Homo sapiens OX=9606 GN=DDX41 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.02 19.0 1 1 1 PRT sp|P12004|PCNA_HUMAN Proliferating cell nuclear antigen OS=Homo sapiens OX=9606 GN=PCNA PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.07 19.0 3 2 1 PRT sp|Q8NFC6|BD1L1_HUMAN Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens OX=9606 GN=BOD1L1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.01 19.0 2 2 2 PRT sp|Q08945|SSRP1_HUMAN FACT complex subunit SSRP1 OS=Homo sapiens OX=9606 GN=SSRP1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 207-UNIMOD:4 0.01 19.0 1 1 1 PRT sp|Q9P013|CWC15_HUMAN Spliceosome-associated protein CWC15 homolog OS=Homo sapiens OX=9606 GN=CWC15 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.11 19.0 3 3 3 PRT sp|Q9H0A0|NAT10_HUMAN RNA cytidine acetyltransferase OS=Homo sapiens OX=9606 GN=NAT10 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|Q9UQ88-2|CD11A_HUMAN Isoform SV1 of Cyclin-dependent kinase 11A OS=Homo sapiens OX=9606 GN=CDK11A null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|P38117|ETFB_HUMAN Electron transfer flavoprotein subunit beta OS=Homo sapiens OX=9606 GN=ETFB PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.04 19.0 1 1 1 PRT sp|Q9UNN5-2|FAF1_HUMAN Isoform Short of FAS-associated factor 1 OS=Homo sapiens OX=9606 GN=FAF1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.02 19.0 1 1 1 PRT sp|Q9NTJ5-2|SAC1_HUMAN Isoform 2 of Phosphatidylinositide phosphatase SAC1 OS=Homo sapiens OX=9606 GN=SACM1L null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.02 19.0 1 1 1 PRT sp|Q7KZI7-11|MARK2_HUMAN Isoform 11 of Serine/threonine-protein kinase MARK2 OS=Homo sapiens OX=9606 GN=MARK2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.02 19.0 1 1 1 PRT sp|Q9Y388|RBMX2_HUMAN RNA-binding motif protein, X-linked 2 OS=Homo sapiens OX=9606 GN=RBMX2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.11 19.0 3 3 3 PRT sp|Q9Y3A5|SBDS_HUMAN Ribosome maturation protein SBDS OS=Homo sapiens OX=9606 GN=SBDS PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.04 19.0 1 1 1 PRT sp|Q15437|SC23B_HUMAN Protein transport protein Sec23B OS=Homo sapiens OX=9606 GN=SEC23B PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.02 19.0 1 1 1 PRT sp|Q9BR76|COR1B_HUMAN Coronin-1B OS=Homo sapiens OX=9606 GN=CORO1B PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 25-UNIMOD:4 0.02 19.0 1 1 1 PRT sp|Q9GZU8|PIP30_HUMAN PSME3-interacting protein OS=Homo sapiens OX=9606 GN=FAM192A PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.04 19.0 1 1 1 PRT sp|Q14318-2|FKBP8_HUMAN Isoform 2 of Peptidyl-prolyl cis-trans isomerase FKBP8 OS=Homo sapiens OX=9606 GN=FKBP8 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.06 19.0 3 2 1 PRT sp|P55786-2|PSA_HUMAN Isoform 2 of Puromycin-sensitive aminopeptidase OS=Homo sapiens OX=9606 GN=NPEPPS null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|Q8TEQ6|GEMI5_HUMAN Gem-associated protein 5 OS=Homo sapiens OX=9606 GN=GEMIN5 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|Q13561-2|DCTN2_HUMAN Isoform 2 of Dynactin subunit 2 OS=Homo sapiens OX=9606 GN=DCTN2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.03 19.0 1 1 1 PRT sp|P07311|ACYP1_HUMAN Acylphosphatase-1 OS=Homo sapiens OX=9606 GN=ACYP1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.14 19.0 1 1 1 PRT sp|Q92542-2|NICA_HUMAN Isoform 2 of Nicastrin OS=Homo sapiens OX=9606 GN=NCSTN null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|P38606|VATA_HUMAN V-type proton ATPase catalytic subunit A OS=Homo sapiens OX=9606 GN=ATP6V1A PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|Q15393|SF3B3_HUMAN Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.01 19.0 3 1 0 PRT sp|O75390|CISY_HUMAN Citrate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=CS PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.03 19.0 1 1 1 PRT sp|O43815-2|STRN_HUMAN Isoform 2 of Striatin OS=Homo sapiens OX=9606 GN=STRN null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 538-UNIMOD:4 0.02 19.0 1 1 1 PRT sp|Q9BZL1|UBL5_HUMAN Ubiquitin-like protein 5 OS=Homo sapiens OX=9606 GN=UBL5 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 18-UNIMOD:4 0.18 19.0 3 2 1 PRT sp|Q86W42-2|THOC6_HUMAN Isoform 2 of THO complex subunit 6 homolog OS=Homo sapiens OX=9606 GN=THOC6 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.05 19.0 1 1 1 PRT sp|Q14839-2|CHD4_HUMAN Isoform 2 of Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens OX=9606 GN=CHD4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.01 19.0 2 2 2 PRT sp|A5YKK6-2|CNOT1_HUMAN Isoform 2 of CCR4-NOT transcription complex subunit 1 OS=Homo sapiens OX=9606 GN=CNOT1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.01 19.0 2 2 2 PRT sp|Q99459|CDC5L_HUMAN Cell division cycle 5-like protein OS=Homo sapiens OX=9606 GN=CDC5L PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.02 19.0 2 2 2 PRT sp|P08559-2|ODPA_HUMAN Isoform 2 of Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.07 19.0 3 3 3 PRT sp|P58107|EPIPL_HUMAN Epiplakin OS=Homo sapiens OX=9606 GN=EPPK1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|Q13363-2|CTBP1_HUMAN Isoform 2 of C-terminal-binding protein 1 OS=Homo sapiens OX=9606 GN=CTBP1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.02 19.0 1 1 1 PRT sp|Q14562|DHX8_HUMAN ATP-dependent RNA helicase DHX8 OS=Homo sapiens OX=9606 GN=DHX8 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|P54819-2|KAD2_HUMAN Isoform 2 of Adenylate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AK2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 92-UNIMOD:4 0.04 19.0 1 1 1 PRT sp|Q9UPT8|ZC3H4_HUMAN Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZC3H4 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.03 19.0 2 2 2 PRT sp|Q9UNS2-2|CSN3_HUMAN Isoform 2 of COP9 signalosome complex subunit 3 OS=Homo sapiens OX=9606 GN=COPS3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.02 19.0 1 1 1 PRT sp|O60566-3|BUB1B_HUMAN Isoform 3 of Mitotic checkpoint serine/threonine-protein kinase BUB1 beta OS=Homo sapiens OX=9606 GN=BUB1B null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|Q12769|NU160_HUMAN Nuclear pore complex protein Nup160 OS=Homo sapiens OX=9606 GN=NUP160 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|P09001|RM03_HUMAN 39S ribosomal protein L3, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL3 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.04 19.0 1 1 1 PRT sp|Q15651-2|HMGN3_HUMAN Isoform 2 of High mobility group nucleosome-binding domain-containing protein 3 OS=Homo sapiens OX=9606 GN=HMGN3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.13 19.0 1 1 1 PRT sp|Q99442|SEC62_HUMAN Translocation protein SEC62 OS=Homo sapiens OX=9606 GN=SEC62 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 82-UNIMOD:4 0.03 19.0 1 1 1 PRT sp|Q15005|SPCS2_HUMAN Signal peptidase complex subunit 2 OS=Homo sapiens OX=9606 GN=SPCS2 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.04 19.0 1 1 1 PRT sp|O00566|MPP10_HUMAN U3 small nucleolar ribonucleoprotein protein MPP10 OS=Homo sapiens OX=9606 GN=MPHOSPH10 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.02 19.0 1 1 1 PRT sp|Q9Y3A3-3|PHOCN_HUMAN Isoform 3 of MOB-like protein phocein OS=Homo sapiens OX=9606 GN=MOB4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 98-UNIMOD:4 0.05 19.0 1 1 1 PRT sp|Q96EY4|TMA16_HUMAN Translation machinery-associated protein 16 OS=Homo sapiens OX=9606 GN=TMA16 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 75-UNIMOD:4 0.05 19.0 1 1 1 PRT sp|Q8NFH4|NUP37_HUMAN Nucleoporin Nup37 OS=Homo sapiens OX=9606 GN=NUP37 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 149-UNIMOD:4 0.05 19.0 1 1 1 PRT sp|Q9UG63-2|ABCF2_HUMAN Isoform 2 of ATP-binding cassette sub-family F member 2 OS=Homo sapiens OX=9606 GN=ABCF2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.02 19.0 1 1 1 PRT sp|Q9NX40|OCAD1_HUMAN OCIA domain-containing protein 1 OS=Homo sapiens OX=9606 GN=OCIAD1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.05 19.0 1 1 1 PRT sp|Q9UKR5|ERG28_HUMAN Probable ergosterol biosynthetic protein 28 OS=Homo sapiens OX=9606 GN=ERG28 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 65-UNIMOD:4,67-UNIMOD:4 0.08 19.0 1 1 1 PRT sp|O15266-2|SHOX_HUMAN Isoform SHOXB of Short stature homeobox protein OS=Homo sapiens OX=9606 GN=SHOX null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19.0 null 0.07 19.0 1 1 1 PRT sp|O43684|BUB3_HUMAN Mitotic checkpoint protein BUB3 OS=Homo sapiens OX=9606 GN=BUB3 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 19.0 null 315-UNIMOD:28 0.03 19.0 1 1 1 PRT sp|P06748|NPM_HUMAN Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19.0 null 0.08 19.0 2 2 0 PRT sp|Q9BQ04|RBM4B_HUMAN RNA-binding protein 4B OS=Homo sapiens OX=9606 GN=RBM4B PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19.0 null 0.03 19.0 1 1 1 PRT sp|O43852|CALU_HUMAN Calumenin OS=Homo sapiens OX=9606 GN=CALU PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19.0 null 0.03 19.0 1 1 0 PRT sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|Q32P28|P3H1_HUMAN Prolyl 3-hydroxylase 1 OS=Homo sapiens OX=9606 GN=P3H1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|P35250|RFC2_HUMAN Replication factor C subunit 2 OS=Homo sapiens OX=9606 GN=RFC2 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19.0 null 171-UNIMOD:4 0.03 19.0 1 1 1 PRT sp|P36543|VATE1_HUMAN V-type proton ATPase subunit E 1 OS=Homo sapiens OX=9606 GN=ATP6V1E1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 19.0 null 2-UNIMOD:1 0.04 19.0 1 1 1 PRT sp|O14908|GIPC1_HUMAN PDZ domain-containing protein GIPC1 OS=Homo sapiens OX=9606 GN=GIPC1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 19.0 null 0.05 19.0 1 1 1 PRT sp|Q7Z4H3|HDDC2_HUMAN HD domain-containing protein 2 OS=Homo sapiens OX=9606 GN=HDDC2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19.0 null 0.07 19.0 1 1 1 PRT sp|Q9BV86|NTM1A_HUMAN N-terminal Xaa-Pro-Lys N-methyltransferase 1 OS=Homo sapiens OX=9606 GN=NTMT1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 19.0 null 2-UNIMOD:1 0.04 19.0 1 1 1 PRT sp|P0DKV0|S31C1_HUMAN Putative spermatogenesis-associated protein 31C1 OS=Homo sapiens OX=9606 GN=SPATA31C1 PE=5 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|P22459|KCNA4_HUMAN Potassium voltage-gated channel subfamily A member 4 OS=Homo sapiens OX=9606 GN=KCNA4 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19.0 null 0.02 19.0 1 1 1 PRT sp|Q92974|ARHG2_HUMAN Rho guanine nucleotide exchange factor 2 OS=Homo sapiens OX=9606 GN=ARHGEF2 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|Q8TBZ3|WDR20_HUMAN WD repeat-containing protein 20 OS=Homo sapiens OX=9606 GN=WDR20 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 19.0 null 514-UNIMOD:4 0.02 19.0 1 1 1 PRT sp|Q8WUD1|RAB2B_HUMAN Ras-related protein Rab-2B OS=Homo sapiens OX=9606 GN=RAB2B PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 19.0 null 0.05 19.0 1 1 1 PRT sp|Q8IVN3|MSTN1_HUMAN Musculoskeletal embryonic nuclear protein 1 OS=Homo sapiens OX=9606 GN=MUSTN1 PE=3 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 19.0 null 2-UNIMOD:1 0.15 19.0 1 1 1 PRT sp|O00479|HMGN4_HUMAN High mobility group nucleosome-binding domain-containing protein 4 OS=Homo sapiens OX=9606 GN=HMGN4 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19.0 null 0.11 19.0 1 1 1 PRT sp|Q16891|MIC60_HUMAN MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19.0 null 0.01 19.0 1 1 0 PRT sp|Q7Z4W1|DCXR_HUMAN L-xylulose reductase OS=Homo sapiens OX=9606 GN=DCXR PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19.0 null 0.05 19.0 1 1 1 PRT sp|Q9UK59|DBR1_HUMAN Lariat debranching enzyme OS=Homo sapiens OX=9606 GN=DBR1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19.0 null 8-UNIMOD:4,9-UNIMOD:4 0.03 19.0 1 1 1 PRT sp|P78371|TCPB_HUMAN T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19.0 null 0.02 19.0 1 1 0 PRT sp|P28340|DPOD1_HUMAN DNA polymerase delta catalytic subunit OS=Homo sapiens OX=9606 GN=POLD1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|O00159|MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens OX=9606 GN=MYO1C PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|P40938|RFC3_HUMAN Replication factor C subunit 3 OS=Homo sapiens OX=9606 GN=RFC3 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19.0 null 0.04 19.0 1 1 0 PRT sp|P68402|PA1B2_HUMAN Platelet-activating factor acetylhydrolase IB subunit beta OS=Homo sapiens OX=9606 GN=PAFAH1B2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19.0 null 0.05 19.0 1 1 1 PRT sp|O43181|NDUS4_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS4 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19.0 null 0.06 19.0 1 1 1 PRT sp|P18754|RCC1_HUMAN Regulator of chromosome condensation OS=Homo sapiens OX=9606 GN=RCC1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19.0 null 0.03 19.0 1 1 1 PRT sp|P06899|H2B1J_HUMAN Histone H2B type 1-J OS=Homo sapiens OX=9606 GN=HIST1H2BJ PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.08 18.0 1 1 1 PRT sp|O00233-2|PSMD9_HUMAN Isoform p27-S of 26S proteasome non-ATPase regulatory subunit 9 OS=Homo sapiens OX=9606 GN=PSMD9 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.06 18.0 1 1 1 PRT sp|Q15125|EBP_HUMAN 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase OS=Homo sapiens OX=9606 GN=EBP PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.06 18.0 1 1 1 PRT sp|P41091|IF2G_HUMAN Eukaryotic translation initiation factor 2 subunit 3 OS=Homo sapiens OX=9606 GN=EIF2S3 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|P51665|PSMD7_HUMAN 26S proteasome non-ATPase regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMD7 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|P62820|RAB1A_HUMAN Ras-related protein Rab-1A OS=Homo sapiens OX=9606 GN=RAB1A PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.05 18.0 1 1 1 PRT sp|P23284|PPIB_HUMAN Peptidyl-prolyl cis-trans isomerase B OS=Homo sapiens OX=9606 GN=PPIB PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.08 18.0 2 2 2 PRT sp|Q03701|CEBPZ_HUMAN CCAAT/enhancer-binding protein zeta OS=Homo sapiens OX=9606 GN=CEBPZ PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.03 18.0 2 2 2 PRT sp|Q99747|SNAG_HUMAN Gamma-soluble NSF attachment protein OS=Homo sapiens OX=9606 GN=NAPG PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|Q86V81|THOC4_HUMAN THO complex subunit 4 OS=Homo sapiens OX=9606 GN=ALYREF PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ] 18.0 null 0.05 18.0 2 1 0 PRT sp|Q9H8V3-4|ECT2_HUMAN Isoform 4 of Protein ECT2 OS=Homo sapiens OX=9606 GN=ECT2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1000663, ProteinPilot, ] 18.0 null 190-UNIMOD:4 0.02 18.0 1 1 1 PRT sp|P49257|LMAN1_HUMAN Protein ERGIC-53 OS=Homo sapiens OX=9606 GN=LMAN1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|Q7Z6K5-2|ARPIN_HUMAN Isoform C15orf38-AP3S2 of Arpin OS=Homo sapiens OX=9606 GN=ARPIN null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|Q8IXB1-2|DJC10_HUMAN Isoform 2 of DnaJ homolog subfamily C member 10 OS=Homo sapiens OX=9606 GN=DNAJC10 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 186-UNIMOD:4 0.01 18.0 1 1 1 PRT sp|P51571|SSRD_HUMAN Translocon-associated protein subunit delta OS=Homo sapiens OX=9606 GN=SSR4 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.06 18.0 1 1 1 PRT sp|O14976|GAK_HUMAN Cyclin-G-associated kinase OS=Homo sapiens OX=9606 GN=GAK PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|O75947|ATP5H_HUMAN ATP synthase subunit d, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PD PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.07 18.0 1 1 1 PRT sp|P49736|MCM2_HUMAN DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|P42166|LAP2A_HUMAN Lamina-associated polypeptide 2, isoform alpha OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|Q96SU4-2|OSBL9_HUMAN Isoform 2 of Oxysterol-binding protein-related protein 9 OS=Homo sapiens OX=9606 GN=OSBPL9 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|Q13098-5|CSN1_HUMAN Isoform 4 of COP9 signalosome complex subunit 1 OS=Homo sapiens OX=9606 GN=GPS1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|Q58F21-5|BRDT_HUMAN Isoform 5 of Bromodomain testis-specific protein OS=Homo sapiens OX=9606 GN=BRDT null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|P26368-2|U2AF2_HUMAN Isoform 2 of Splicing factor U2AF 65 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|O60313|OPA1_HUMAN Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens OX=9606 GN=OPA1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1000663, ProteinPilot, ] 18.0 null 853-UNIMOD:4,856-UNIMOD:4 0.01 18.0 1 1 1 PRT sp|P08240-2|SRPRA_HUMAN Isoform 2 of Signal recognition particle receptor subunit alpha OS=Homo sapiens OX=9606 GN=SRPRA null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|O60869-3|EDF1_HUMAN Isoform 3 of Endothelial differentiation-related factor 1 OS=Homo sapiens OX=9606 GN=EDF1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.06 18.0 1 1 1 PRT sp|Q9NRV9|HEBP1_HUMAN Heme-binding protein 1 OS=Homo sapiens OX=9606 GN=HEBP1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.06 18.0 1 1 1 PRT sp|P47756-2|CAPZB_HUMAN Isoform 2 of F-actin-capping protein subunit beta OS=Homo sapiens OX=9606 GN=CAPZB null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.07 18.0 2 2 2 PRT sp|P55010|IF5_HUMAN Eukaryotic translation initiation factor 5 OS=Homo sapiens OX=9606 GN=EIF5 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|P62312|LSM6_HUMAN U6 snRNA-associated Sm-like protein LSm6 OS=Homo sapiens OX=9606 GN=LSM6 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.11 18.0 1 1 1 PRT sp|Q16543|CDC37_HUMAN Hsp90 co-chaperone Cdc37 OS=Homo sapiens OX=9606 GN=CDC37 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|Q96I25|SPF45_HUMAN Splicing factor 45 OS=Homo sapiens OX=9606 GN=RBM17 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|P35251-2|RFC1_HUMAN Isoform 2 of Replication factor C subunit 1 OS=Homo sapiens OX=9606 GN=RFC1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 607-UNIMOD:4 0.01 18.0 1 1 1 PRT sp|Q02040|AK17A_HUMAN A-kinase anchor protein 17A OS=Homo sapiens OX=9606 GN=AKAP17A PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|P98179|RBM3_HUMAN RNA-binding protein 3 OS=Homo sapiens OX=9606 GN=RBM3 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.07 18.0 1 1 1 PRT sp|Q9H299|SH3L3_HUMAN SH3 domain-binding glutamic acid-rich-like protein 3 OS=Homo sapiens OX=9606 GN=SH3BGRL3 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.12 18.0 1 1 1 PRT sp|P82675|RT05_HUMAN 28S ribosomal protein S5, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS5 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|O75691|UTP20_HUMAN Small subunit processome component 20 homolog OS=Homo sapiens OX=9606 GN=UTP20 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.00 18.0 1 1 1 PRT sp|Q12931|TRAP1_HUMAN Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens OX=9606 GN=TRAP1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 573-UNIMOD:4 0.03 18.0 2 2 2 PRT sp|O60502-2|OGA_HUMAN Isoform 2 of Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 543-UNIMOD:4 0.01 18.0 1 1 1 PRT sp|Q9UBC2-2|EP15R_HUMAN Isoform 2 of Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|P33240-2|CSTF2_HUMAN Isoform 2 of Cleavage stimulation factor subunit 2 OS=Homo sapiens OX=9606 GN=CSTF2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 150-UNIMOD:4 0.02 18.0 1 1 1 PRT sp|P36639-3|8ODP_HUMAN Isoform p21 of 7,8-dihydro-8-oxoguanine triphosphatase OS=Homo sapiens OX=9606 GN=NUDT1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.08 18.0 1 1 1 PRT sp|P84157-2|MXRA7_HUMAN Isoform 2 of Matrix-remodeling-associated protein 7 OS=Homo sapiens OX=9606 GN=MXRA7 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.07 18.0 1 1 1 PRT sp|P31153|METK2_HUMAN S-adenosylmethionine synthase isoform type-2 OS=Homo sapiens OX=9606 GN=MAT2A PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|P61160-2|ARP2_HUMAN Isoform 2 of Actin-related protein 2 OS=Homo sapiens OX=9606 GN=ACTR2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|P30043|BLVRB_HUMAN Flavin reductase (NADPH) OS=Homo sapiens OX=9606 GN=BLVRB PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.05 18.0 1 1 1 PRT sp|Q15363|TMED2_HUMAN Transmembrane emp24 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=TMED2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.05 18.0 1 1 1 PRT sp|Q13257|MD2L1_HUMAN Mitotic spindle assembly checkpoint protein MAD2A OS=Homo sapiens OX=9606 GN=MAD2L1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.04 18.0 1 1 1 PRT sp|P13798|ACPH_HUMAN Acylamino-acid-releasing enzyme OS=Homo sapiens OX=9606 GN=APEH PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|Q9P035|HACD3_HUMAN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 OS=Homo sapiens OX=9606 GN=HACD3 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|P40429|RL13A_HUMAN 60S ribosomal protein L13a OS=Homo sapiens OX=9606 GN=RPL13A PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.04 18.0 1 1 1 PRT sp|P09661|RU2A_HUMAN U2 small nuclear ribonucleoprotein A' OS=Homo sapiens OX=9606 GN=SNRPA1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.04 18.0 1 1 1 PRT sp|Q71UM5|RS27L_HUMAN 40S ribosomal protein S27-like OS=Homo sapiens OX=9606 GN=RPS27L PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 77-UNIMOD:4 0.11 18.0 1 1 1 PRT sp|Q9NX14-2|NDUBB_HUMAN Isoform 2 of NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFB11 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.07 18.0 1 1 1 PRT sp|Q8NHH9-3|ATLA2_HUMAN Isoform 3 of Atlastin-2 OS=Homo sapiens OX=9606 GN=ATL2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|Q13112|CAF1B_HUMAN Chromatin assembly factor 1 subunit B OS=Homo sapiens OX=9606 GN=CHAF1B PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|Q9NTJ3|SMC4_HUMAN Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|Q8WYA6-2|CTBL1_HUMAN Isoform 2 of Beta-catenin-like protein 1 OS=Homo sapiens OX=9606 GN=CTNNBL1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|P42696|RBM34_HUMAN RNA-binding protein 34 OS=Homo sapiens OX=9606 GN=RBM34 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|Q96RE7|NACC1_HUMAN Nucleus accumbens-associated protein 1 OS=Homo sapiens OX=9606 GN=NACC1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 416-UNIMOD:4 0.02 18.0 1 1 1 PRT sp|Q9UPN9-2|TRI33_HUMAN Isoform Beta of E3 ubiquitin-protein ligase TRIM33 OS=Homo sapiens OX=9606 GN=TRIM33 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 2 2 2 PRT sp|P35221|CTNA1_HUMAN Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1000663, ProteinPilot, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|P0C7P4|UCRIL_HUMAN Putative cytochrome b-c1 complex subunit Rieske-like protein 1 OS=Homo sapiens OX=9606 GN=UQCRFS1P1 PE=5 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.04 18.0 3 2 1 PRT sp|P31323|KAP3_HUMAN cAMP-dependent protein kinase type II-beta regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2B PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|O95372|LYPA2_HUMAN Acyl-protein thioesterase 2 OS=Homo sapiens OX=9606 GN=LYPLA2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.04 18.0 1 1 1 PRT sp|Q8IUE6|H2A2B_HUMAN Histone H2A type 2-B OS=Homo sapiens OX=9606 GN=HIST2H2AB PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18.0 null 0.06 18.0 1 1 1 PRT sp|Q12888-2|TP53B_HUMAN Isoform 2 of TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|P00505|AATM_HUMAN Aspartate aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=GOT2 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|Q53GQ0|DHB12_HUMAN Very-long-chain 3-oxoacyl-CoA reductase OS=Homo sapiens OX=9606 GN=HSD17B12 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.03 18.0 2 1 0 PRT sp|Q6PKG0|LARP1_HUMAN La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|P09497-2|CLCB_HUMAN Isoform Non-brain of Clathrin light chain B OS=Homo sapiens OX=9606 GN=CLTB null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.07 18.0 1 1 1 PRT sp|Q12798|CETN1_HUMAN Centrin-1 OS=Homo sapiens OX=9606 GN=CETN1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.06 18.0 1 1 1 PRT sp|Q9NSI2-2|F207A_HUMAN Isoform B of Protein FAM207A OS=Homo sapiens OX=9606 GN=FAM207A null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.04 18.0 1 1 1 PRT sp|P56747|CLD6_HUMAN Claudin-6 OS=Homo sapiens OX=9606 GN=CLDN6 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.05 18.0 1 1 1 PRT sp|Q9NVH1-2|DJC11_HUMAN Isoform 2 of DnaJ homolog subfamily C member 11 OS=Homo sapiens OX=9606 GN=DNAJC11 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|Q86V48-2|LUZP1_HUMAN Isoform 2 of Leucine zipper protein 1 OS=Homo sapiens OX=9606 GN=LUZP1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|Q9H3K2|GHITM_HUMAN Growth hormone-inducible transmembrane protein OS=Homo sapiens OX=9606 GN=GHITM PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|Q9NRL3-3|STRN4_HUMAN Isoform 3 of Striatin-4 OS=Homo sapiens OX=9606 GN=STRN4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|Q05655-2|KPCD_HUMAN Isoform 2 of Protein kinase C delta type OS=Homo sapiens OX=9606 GN=PRKCD null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 280-UNIMOD:4 0.02 18.0 1 1 1 PRT sp|P46459|NSF_HUMAN Vesicle-fusing ATPase OS=Homo sapiens OX=9606 GN=NSF PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|Q15084-2|PDIA6_HUMAN Isoform 2 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|Q99733-2|NP1L4_HUMAN Isoform 2 of Nucleosome assembly protein 1-like 4 OS=Homo sapiens OX=9606 GN=NAP1L4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens OX=9606 GN=KRT2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|Q2TAY7|SMU1_HUMAN WD40 repeat-containing protein SMU1 OS=Homo sapiens OX=9606 GN=SMU1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.03 18.0 2 1 0 PRT sp|Q9NYH9|UTP6_HUMAN U3 small nucleolar RNA-associated protein 6 homolog OS=Homo sapiens OX=9606 GN=UTP6 PE=2 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 524-UNIMOD:4 0.02 18.0 1 1 1 PRT sp|P62906|RL10A_HUMAN 60S ribosomal protein L10a OS=Homo sapiens OX=9606 GN=RPL10A PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.04 18.0 2 1 0 PRT sp|P28347-2|TEAD1_HUMAN Isoform 2 of Transcriptional enhancer factor TEF-1 OS=Homo sapiens OX=9606 GN=TEAD1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|Q2TAL8|QRIC1_HUMAN Glutamine-rich protein 1 OS=Homo sapiens OX=9606 GN=QRICH1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|P13693-2|TCTP_HUMAN Isoform 2 of Translationally-controlled tumor protein OS=Homo sapiens OX=9606 GN=TPT1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.06 18.0 1 1 1 PRT sp|P78344|IF4G2_HUMAN Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|Q9UBW8|CSN7A_HUMAN COP9 signalosome complex subunit 7a OS=Homo sapiens OX=9606 GN=COPS7A PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|P15104|GLNA_HUMAN Glutamine synthetase OS=Homo sapiens OX=9606 GN=GLUL PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 183-UNIMOD:4 0.02 18.0 1 1 1 PRT sp|Q9BWD1-2|THIC_HUMAN Isoform 2 of Acetyl-CoA acetyltransferase, cytosolic OS=Homo sapiens OX=9606 GN=ACAT2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.04 18.0 2 2 2 PRT sp|P11766|ADHX_HUMAN Alcohol dehydrogenase class-3 OS=Homo sapiens OX=9606 GN=ADH5 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|O95433|AHSA1_HUMAN Activator of 90 kDa heat shock protein ATPase homolog 1 OS=Homo sapiens OX=9606 GN=AHSA1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|Q969U7-2|PSMG2_HUMAN Isoform 2 of Proteasome assembly chaperone 2 OS=Homo sapiens OX=9606 GN=PSMG2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.06 18.0 1 1 1 PRT sp|P22392-2|NDKB_HUMAN Isoform 3 of Nucleoside diphosphate kinase B OS=Homo sapiens OX=9606 GN=NME2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|Q9UHY1|NRBP_HUMAN Nuclear receptor-binding protein OS=Homo sapiens OX=9606 GN=NRBP1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|O00429-2|DNM1L_HUMAN Isoform 4 of Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|Q9Y2W2|WBP11_HUMAN WW domain-binding protein 11 OS=Homo sapiens OX=9606 GN=WBP11 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|Q16656-4|NRF1_HUMAN Isoform 4 of Nuclear respiratory factor 1 OS=Homo sapiens OX=9606 GN=NRF1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|P14678-3|RSMB_HUMAN Isoform SM-B1 of Small nuclear ribonucleoprotein-associated proteins B and B' OS=Homo sapiens OX=9606 GN=SNRPB null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|O95163|ELP1_HUMAN Elongator complex protein 1 OS=Homo sapiens OX=9606 GN=ELP1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|Q02818|NUCB1_HUMAN Nucleobindin-1 OS=Homo sapiens OX=9606 GN=NUCB1 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|Q9Y276|BCS1_HUMAN Mitochondrial chaperone BCS1 OS=Homo sapiens OX=9606 GN=BCS1L PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|Q8IXT5|RB12B_HUMAN RNA-binding protein 12B OS=Homo sapiens OX=9606 GN=RBM12B PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|Q15021|CND1_HUMAN Condensin complex subunit 1 OS=Homo sapiens OX=9606 GN=NCAPD2 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 3 3 3 PRT sp|Q8WVY7|UBCP1_HUMAN Ubiquitin-like domain-containing CTD phosphatase 1 OS=Homo sapiens OX=9606 GN=UBLCP1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.04 18.0 1 1 1 PRT sp|O14980|XPO1_HUMAN Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|P12931-2|SRC_HUMAN Isoform 2 of Proto-oncogene tyrosine-protein kinase Src OS=Homo sapiens OX=9606 GN=SRC null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|P11171-2|41_HUMAN Isoform 2 of Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|Q9BRX2|PELO_HUMAN Protein pelota homolog OS=Homo sapiens OX=9606 GN=PELO PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|Q9BSC4-2|NOL10_HUMAN Isoform 2 of Nucleolar protein 10 OS=Homo sapiens OX=9606 GN=NOL10 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|Q9NS86|LANC2_HUMAN LanC-like protein 2 OS=Homo sapiens OX=9606 GN=LANCL2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|O75179-7|ANR17_HUMAN Isoform 7 of Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.01 18.0 2 2 2 PRT sp|P41134-2|ID1_HUMAN Isoform ID-B of DNA-binding protein inhibitor ID-1 OS=Homo sapiens OX=9606 GN=ID1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 34-UNIMOD:4 0.08 18.0 1 1 1 PRT sp|P09211|GSTP1_HUMAN Glutathione S-transferase P OS=Homo sapiens OX=9606 GN=GSTP1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.04 18.0 1 1 1 PRT sp|Q15181|IPYR_HUMAN Inorganic pyrophosphatase OS=Homo sapiens OX=9606 GN=PPA1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|O75955|FLOT1_HUMAN Flotillin-1 OS=Homo sapiens OX=9606 GN=FLOT1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|Q7L014|DDX46_HUMAN Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens OX=9606 GN=DDX46 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 501-UNIMOD:4 0.01 18.0 2 1 0 PRT sp|Q12904-2|AIMP1_HUMAN Isoform 2 of Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Homo sapiens OX=9606 GN=AIMP1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 185-UNIMOD:4 0.03 18.0 1 1 0 PRT sp|Q9BY44-3|EIF2A_HUMAN Isoform 3 of Eukaryotic translation initiation factor 2A OS=Homo sapiens OX=9606 GN=EIF2A null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|Q9NPH2|INO1_HUMAN Inositol-3-phosphate synthase 1 OS=Homo sapiens OX=9606 GN=ISYNA1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|O75688-2|PPM1B_HUMAN Isoform Beta-2 of Protein phosphatase 1B OS=Homo sapiens OX=9606 GN=PPM1B null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|Q15811-8|ITSN1_HUMAN Isoform 8 of Intersectin-1 OS=Homo sapiens OX=9606 GN=ITSN1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|O75937|DNJC8_HUMAN DnaJ homolog subfamily C member 8 OS=Homo sapiens OX=9606 GN=DNAJC8 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.04 18.0 1 1 1 PRT sp|Q5T8P6-2|RBM26_HUMAN Isoform 2 of RNA-binding protein 26 OS=Homo sapiens OX=9606 GN=RBM26 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|O15371-2|EIF3D_HUMAN Isoform 2 of Eukaryotic translation initiation factor 3 subunit D OS=Homo sapiens OX=9606 GN=EIF3D null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|Q6UB35|C1TM_HUMAN Monofunctional C1-tetrahydrofolate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD1L PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|Q96D46|NMD3_HUMAN 60S ribosomal export protein NMD3 OS=Homo sapiens OX=9606 GN=NMD3 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 256-UNIMOD:4 0.02 18.0 1 1 1 PRT sp|Q9UIF9-2|BAZ2A_HUMAN Isoform 1 of Bromodomain adjacent to zinc finger domain protein 2A OS=Homo sapiens OX=9606 GN=BAZ2A null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|O95071-2|UBR5_HUMAN Isoform 2 of E3 ubiquitin-protein ligase UBR5 OS=Homo sapiens OX=9606 GN=UBR5 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|Q13308-6|PTK7_HUMAN Isoform 6 of Inactive tyrosine-protein kinase 7 OS=Homo sapiens OX=9606 GN=PTK7 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|Q969Z0|FAKD4_HUMAN FAST kinase domain-containing protein 4 OS=Homo sapiens OX=9606 GN=TBRG4 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|Q09666|AHNK_HUMAN Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|O95782-2|AP2A1_HUMAN Isoform B of AP-2 complex subunit alpha-1 OS=Homo sapiens OX=9606 GN=AP2A1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 225-UNIMOD:4 0.01 18.0 1 1 0 PRT sp|P16435|NCPR_HUMAN NADPH--cytochrome P450 reductase OS=Homo sapiens OX=9606 GN=POR PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|Q32P28-3|P3H1_HUMAN Isoform 3 of Prolyl 3-hydroxylase 1 OS=Homo sapiens OX=9606 GN=P3H1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|Q93009-3|UBP7_HUMAN Isoform 3 of Ubiquitin carboxyl-terminal hydrolase 7 OS=Homo sapiens OX=9606 GN=USP7 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|Q9Y399|RT02_HUMAN 28S ribosomal protein S2, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|Q96L73-2|NSD1_HUMAN Isoform 2 of Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific OS=Homo sapiens OX=9606 GN=NSD1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.00 18.0 1 1 1 PRT sp|P11279-2|LAMP1_HUMAN Isoform 2 of Lysosome-associated membrane glycoprotein 1 OS=Homo sapiens OX=9606 GN=LAMP1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.03 18.0 1 1 0 PRT sp|Q2NL82|TSR1_HUMAN Pre-rRNA-processing protein TSR1 homolog OS=Homo sapiens OX=9606 GN=TSR1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|P46939-2|UTRO_HUMAN Isoform 2 of Utrophin OS=Homo sapiens OX=9606 GN=UTRN null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.00 18.0 1 1 1 PRT sp|Q9BVP2-2|GNL3_HUMAN Isoform 2 of Guanine nucleotide-binding protein-like 3 OS=Homo sapiens OX=9606 GN=GNL3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|Q93034|CUL5_HUMAN Cullin-5 OS=Homo sapiens OX=9606 GN=CUL5 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|P61758|PFD3_HUMAN Prefoldin subunit 3 OS=Homo sapiens OX=9606 GN=VBP1 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.07 18.0 1 1 1 PRT sp|Q99700-2|ATX2_HUMAN Isoform 2 of Ataxin-2 OS=Homo sapiens OX=9606 GN=ATXN2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|Q9Y2Z4|SYYM_HUMAN Tyrosine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=YARS2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|Q8WY07|CTR3_HUMAN Cationic amino acid transporter 3 OS=Homo sapiens OX=9606 GN=SLC7A3 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|Q9UHJ6|SHPK_HUMAN Sedoheptulokinase OS=Homo sapiens OX=9606 GN=SHPK PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|Q5BJD5-2|TM41B_HUMAN Isoform 2 of Transmembrane protein 41B OS=Homo sapiens OX=9606 GN=TMEM41B null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.10 18.0 1 1 1 PRT sp|Q9ULF5|S39AA_HUMAN Zinc transporter ZIP10 OS=Homo sapiens OX=9606 GN=SLC39A10 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|Q9NRR5|UBQL4_HUMAN Ubiquilin-4 OS=Homo sapiens OX=9606 GN=UBQLN4 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 29-UNIMOD:4 0.02 18.0 1 1 1 PRT sp|Q9ULR0-1|ISY1_HUMAN Isoform 2 of Pre-mRNA-splicing factor ISY1 homolog OS=Homo sapiens OX=9606 GN=ISY1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.05 18.0 1 1 1 PRT sp|Q15649|ZNHI3_HUMAN Zinc finger HIT domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ZNHIT3 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.06 18.0 1 1 1 PRT sp|Q9Y232-4|CDYL_HUMAN Isoform 4 of Chromodomain Y-like protein OS=Homo sapiens OX=9606 GN=CDYL null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.04 18.0 1 1 1 PRT sp|Q8N7H5-2|PAF1_HUMAN Isoform 2 of RNA polymerase II-associated factor 1 homolog OS=Homo sapiens OX=9606 GN=PAF1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|O14763-2|TR10B_HUMAN Isoform Short of Tumor necrosis factor receptor superfamily member 10B OS=Homo sapiens OX=9606 GN=TNFRSF10B null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 335-UNIMOD:35 0.03 18.0 1 1 1 PRT sp|Q9H0U3|MAGT1_HUMAN Magnesium transporter protein 1 OS=Homo sapiens OX=9606 GN=MAGT1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|P13489|RINI_HUMAN Ribonuclease inhibitor OS=Homo sapiens OX=9606 GN=RNH1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 38-UNIMOD:4 0.02 18.0 1 1 1 PRT sp|Q9BU76-4|MMTA2_HUMAN Isoform 4 of Multiple myeloma tumor-associated protein 2 OS=Homo sapiens OX=9606 GN=MMTAG2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.08 18.0 1 1 1 PRT sp|Q5VU43-13|MYOME_HUMAN Isoform 13 of Myomegalin OS=Homo sapiens OX=9606 GN=PDE4DIP null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|P49903-2|SPS1_HUMAN Isoform 2 of Selenide, water dikinase 1 OS=Homo sapiens OX=9606 GN=SEPHS1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|L0R6Q1|S35U4_HUMAN SLC35A4 upstream open reading frame protein OS=Homo sapiens OX=9606 GN=SLC35A4 PE=3 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.09 18.0 1 1 1 PRT sp|P82673|RT35_HUMAN 28S ribosomal protein S35, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS35 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.04 18.0 1 1 1 PRT sp|Q92845-2|KIFA3_HUMAN Isoform 2 of Kinesin-associated protein 3 OS=Homo sapiens OX=9606 GN=KIFAP3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|P78347|GTF2I_HUMAN General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18.0 null 0.03 18.0 2 2 2 PRT sp|Q9H4B7|TBB1_HUMAN Tubulin beta-1 chain OS=Homo sapiens OX=9606 GN=TUBB1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18.0 null 354-UNIMOD:4 0.02 18.0 3 1 0 PRT sp|P23526|SAHH_HUMAN Adenosylhomocysteinase OS=Homo sapiens OX=9606 GN=AHCY PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 18.0 null 2-UNIMOD:1 0.02 18.0 2 1 0 PRT sp|Q16181|SEPT7_HUMAN Septin-7 OS=Homo sapiens OX=9606 GN=SEPT7 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18.0 null 0.03 18.0 1 1 0 PRT sp|O60524|NEMF_HUMAN Nuclear export mediator factor NEMF OS=Homo sapiens OX=9606 GN=NEMF PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|Q9NQ39|RS10L_HUMAN Putative 40S ribosomal protein S10-like OS=Homo sapiens OX=9606 GN=RPS10P5 PE=5 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 18.0 null 0.06 18.0 1 1 1 PRT sp|P0CZ25|D10OS_HUMAN Uncharacterized protein DNAH10OS OS=Homo sapiens OX=9606 GN=DNAH10OS PE=2 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 18.0 null 0.07 18.0 1 1 1 PRT sp|P61086|UBE2K_HUMAN Ubiquitin-conjugating enzyme E2 K OS=Homo sapiens OX=9606 GN=UBE2K PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 18.0 null 2-UNIMOD:1 0.04 18.0 1 1 1 PRT sp|Q9P243|ZFAT_HUMAN Zinc finger protein ZFAT OS=Homo sapiens OX=9606 GN=ZFAT PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|Q86US8|EST1A_HUMAN Telomerase-binding protein EST1A OS=Homo sapiens OX=9606 GN=SMG6 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|Q8WX93|PALLD_HUMAN Palladin OS=Homo sapiens OX=9606 GN=PALLD PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|P16989|YBOX3_HUMAN Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3 PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|O00483|NDUA4_HUMAN Cytochrome c oxidase subunit NDUFA4 OS=Homo sapiens OX=9606 GN=NDUFA4 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18.0 null 0.11 18.0 1 1 1 PRT sp|Q96RS6|NUDC1_HUMAN NudC domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NUDCD1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18.0 null 376-UNIMOD:4 0.02 18.0 1 1 0 PRT sp|P0DPD8|EFCE2_HUMAN EEF1AKMT4-ECE2 readthrough transcript protein OS=Homo sapiens OX=9606 GN=EEF1AKMT4-ECE2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|P55265|DSRAD_HUMAN Double-stranded RNA-specific adenosine deaminase OS=Homo sapiens OX=9606 GN=ADAR PE=1 SV=4 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18.0 null 630-UNIMOD:4 0.01 18.0 1 1 1 PRT sp|Q86WB0|NIPA_HUMAN Nuclear-interacting partner of ALK OS=Homo sapiens OX=9606 GN=ZC3HC1 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|Q8IZ83|A16A1_HUMAN Aldehyde dehydrogenase family 16 member A1 OS=Homo sapiens OX=9606 GN=ALDH16A1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18.0 null 350-UNIMOD:4 0.01 18.0 1 1 1 PRT sp|Q6IA86|ELP2_HUMAN Elongator complex protein 2 OS=Homo sapiens OX=9606 GN=ELP2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18.0 null 0.02 18.0 1 1 0 PRT sp|P27816|MAP4_HUMAN Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4 PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens OX=9606 GN=KLC2 PE=1 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18.0 null 474-UNIMOD:4 0.02 18.0 1 1 1 PRT sp|Q96D98|EID2B_HUMAN EP300-interacting inhibitor of differentiation 2B OS=Homo sapiens OX=9606 GN=EID2B PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18.0 null 0.09 18.0 1 1 1 PRT sp|P15924|DESP_HUMAN Desmoplakin OS=Homo sapiens OX=9606 GN=DSP PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18.0 null 0.00 18.0 1 1 1 PRT sp|O43172|PRP4_HUMAN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens OX=9606 GN=PRPF4 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|Q58FF7|H90B3_HUMAN Putative heat shock protein HSP 90-beta-3 OS=Homo sapiens OX=9606 GN=HSP90AB3P PE=5 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18.0 null 0.02 18.0 2 1 0 PRT sp|Q9P2J5|SYLC_HUMAN Leucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=LARS PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18.0 null 0.01 18.0 1 1 0 PRT sp|Q06481|APLP2_HUMAN Amyloid-like protein 2 OS=Homo sapiens OX=9606 GN=APLP2 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|Q58FG0|HS905_HUMAN Putative heat shock protein HSP 90-alpha A5 OS=Homo sapiens OX=9606 GN=HSP90AA5P PE=2 SV=1 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18.0 null 0.03 18.0 1 1 0 PRT sp|O60566|BUB1B_HUMAN Mitotic checkpoint serine/threonine-protein kinase BUB1 beta OS=Homo sapiens OX=9606 GN=BUB1B PE=1 SV=3 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|Q12904|AIMP1_HUMAN Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Homo sapiens OX=9606 GN=AIMP1 PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18.0 null 161-UNIMOD:4 0.03 18.0 1 1 0 PRT sp|P20674|COX5A_HUMAN Cytochrome c oxidase subunit 5A, mitochondrial OS=Homo sapiens OX=9606 GN=COX5A PE=1 SV=2 null null userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18.0 null 0.07 18.0 1 1 1 PSH sequence PSM_ID accession unique database database_version search_engine search_engine_score[1] modifications spectra_ref retention_time charge exp_mass_to_charge calc_mass_to_charge pre post start end PSM SSGSPYGGGYGSGGGSGGYGSR 1 sp|P51991|ROA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 53 ms_run[1]:scan=1.1.8127.11 109.543 2 1909.7854 1909.7827 R R 355 377 PSM SSGSPYGGGYGSGGGSGGYGSR 2 sp|P51991|ROA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 50 ms_run[1]:scan=1.1.8146.11 110.0609 2 1909.7854 1909.7827 R R 355 377 PSM GGGGPGGGGPGGGSAGGPSQPPGGGGPGIR 3 sp|Q92945|FUBP2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 44 ms_run[1]:scan=1.1.7882.11 102.9287 3 2269.0564 2269.0585 R K 41 71 PSM TDNAGDQHGGGGGGGGGAGAAGGGGGGENYDDPHK 4 sp|P14866|HNRPL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 43 ms_run[1]:scan=1.1.6197.11 57.33215 4 2980.2001 2980.1953 K T 63 98 PSM LCYVALDFEQEMATAASSSSLEK 5 sp|P60709|ACTB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 41 2-UNIMOD:4 ms_run[1]:scan=1.1.1640.8 11.06165 3 2549.1598 2549.1665 K S 216 239 PSM KQPPVSPGTALVGSQK 6 sp|P17096|HMGA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 41 ms_run[1]:scan=1.1.8041.9 107.2728 3 1592.8888 1592.8886 R E 31 47 PSM PAASITSKPATLTTTSATSK 7 sp|O43670-2|ZN207_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 41 ms_run[1]:scan=1.1.8004.11 106.2662 3 1933.0360 1933.0368 K L 328 348 PSM KQPPVSPGTALVGSQK 8 sp|P17096|HMGA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 41 ms_run[1]:scan=1.1.8022.8 106.7545 3 1592.8888 1592.8886 R E 31 47 PSM NQGGYGGSSSSSSYGSGR 9 sp|P09651-2|ROA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 41 ms_run[1]:scan=1.1.6383.11 62.43097 2 1693.6952 1693.6928 R R 301 319 PSM APKPDGPGGGPGGSHMGGNYGDDR 10 sp|P35637|FUS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 41 ms_run[1]:scan=1.1.7152.11 83.25488 4 2252.968094 2251.966492 K R 449 473 PSM ATCAPQHGAPGPGPADASK 11 sp|P21333-2|FLNA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 40 3-UNIMOD:4 ms_run[1]:scan=1.1.6155.11 56.17013 3 1788.8242 1788.8213 K V 2533 2552 PSM GEAAAERPGEAAVASSPSK 12 sp|P29966|MARCS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 40 ms_run[1]:scan=1.1.6542.9 66.72005 3 1783.8709 1783.8700 K A 12 31 PSM SSGSPYGGGYGSGGGSGGYGSR 13 sp|P51991|ROA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 40 ms_run[1]:scan=1.1.8108.11 109.0261 2 1909.7854 1909.7827 R R 355 377 PSM EELQANGSAPAADKEEPAAAGSGAASPSAAEK 14 sp|P29966|MARCS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 40 ms_run[1]:scan=1.1.8236.11 112.5089 4 2981.3513 2981.3849 K G 56 88 PSM IATGHGQQGVTQVVLK 15 sp|P51610|HCFC1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 40 ms_run[1]:scan=1.1.8476.8 119.0163 3 1635.908771 1634.910404 K G 821 837 PSM PVSSAASVYAGAGGSGSR 16 sp|P05783|K1C18_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 40 ms_run[1]:scan=1.1.8129.11 109.5976 2 1579.759047 1579.759048 R I 28 46 PSM GILVASDSGAVELWELDENETLIVSK 17 sp|Q9BQA1|MEP50_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 39 ms_run[1]:scan=1.1.1645.2 11.17812 3 2786.4166 2786.4225 R F 93 119 PSM TDNAGDQHGGGGGGGGGAGAAGGGGGGENYDDPHK 18 sp|P14866|HNRPL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 39 ms_run[1]:scan=1.1.6178.9 56.80242 5 2980.1981 2980.1953 K T 63 98 PSM GAEAANVTGPGGVPVQGSK 19 sp|P67809|YBOX1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 39 ms_run[1]:scan=1.1.8105.6 108.9368 3 1694.8564 1694.8588 K Y 119 138 PSM GAEAANVTGPGGVPVQGSK 20 sp|P67809|YBOX1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 39 ms_run[1]:scan=1.1.8085.11 108.423 2 1694.8592 1694.8588 K Y 119 138 PSM TSPADHGGSVGSESGGSAVDSVAGEHSVSGR 21 sp|Q5T4S7-2|UBR4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 39 ms_run[1]:scan=1.1.8480.9 119.1272 4 2839.2621 2839.2605 R S 2884 2915 PSM KQPPVSPGTALVGSQK 22 sp|P17096|HMGA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 39 ms_run[1]:scan=1.1.8139.10 109.8686 3 1592.8858 1592.8886 R E 31 47 PSM KPLTSSSAAPQRPISTQR 23 sp|Q15691|MARE1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 38 ms_run[1]:scan=1.1.6623.7 68.93192 4 1924.0493 1924.0490 K T 151 169 PSM PAEKPAETPVATSPTATDSTSGDSSR 24 sp|P54727|RD23B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 38 ms_run[1]:scan=1.1.7123.11 82.46862 3 2559.1984 2559.1936 K S 148 174 PSM PAETPVATSPTATDSTSGDSSR 25 sp|P54727|RD23B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 38 ms_run[1]:scan=1.1.7233.11 85.41808 3 2133.9670 2133.9662 K S 152 174 PSM TTHFVEGGDAGNREDQINR 26 sp|P18124|RL7_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 38 ms_run[1]:scan=1.1.7515.8 92.95665 4 2114.9673 2114.9730 K L 224 243 PSM AAEAAAAPAESAAPAAGEEPSKEEGEPK 27 sp|P80723|BASP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 38 ms_run[1]:scan=1.1.7699.11 97.9684 3 2635.2283 2635.2248 K K 122 150 PSM KQPPVSPGTALVGSQK 28 sp|P17096|HMGA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 38 ms_run[1]:scan=1.1.8120.5 109.3422 3 1592.8858 1592.8886 R E 31 47 PSM CTGGEVGATSALAPK 29 sp|P30050-2|RL12_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 38 1-UNIMOD:4 ms_run[1]:scan=1.1.8168.11 110.6596 2 1417.6852 1417.6871 R I 17 32 PSM GAEAANVTGPGGVPVQGSK 30 sp|P67809|YBOX1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 38 ms_run[1]:scan=1.1.8124.9 109.4579 2 1694.8592 1694.8588 K Y 119 138 PSM PASQIGCSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTK 31 sp|Q9BQA1|MEP50_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 37 7-UNIMOD:4 ms_run[1]:scan=1.1.1668.3 11.7206 4 4489.1349 4489.1537 K S 202 244 PSM NQGGYGGSSSSSSYGSGR 32 sp|P09651-2|ROA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 37 ms_run[1]:scan=1.1.6403.11 62.95537 2 1693.6952 1693.6928 R R 301 319 PSM DAQDVQASQAEADQQQTR 33 sp|Q9P2E9|RRBP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 37 ms_run[1]:scan=1.1.6852.11 75.18598 3 1987.8808 1987.8831 R L 971 989 PSM GDVTAEEAAGASPAK 34 sp|P49006|MRP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 37 ms_run[1]:scan=1.1.6917.11 76.92587 2 1372.6476 1372.6470 R A 11 26 PSM GEPAAAAAPEAGASPVEK 35 sp|P29966|MARCS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 37 ms_run[1]:scan=1.1.7562.11 94.24348 2 1621.7928 1621.7947 K E 88 106 PSM KQPPVSPGTALVGSQK 36 sp|P17096|HMGA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 37 ms_run[1]:scan=1.1.7996.8 106.0434 3 1592.8888 1592.8886 R E 31 47 PSM KQPPVSPGTALVGSQK 37 sp|P17096|HMGA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 37 ms_run[1]:scan=1.1.7965.11 105.2041 2 1592.8888 1592.8886 R E 31 47 PSM EGEEPTVYSDEEEPKDESAR 38 sp|O00264-2|PGRC1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 37 ms_run[1]:scan=1.1.8137.10 109.814 3 2294.9647 2294.9662 K K 121 141 PSM TTHFVEGGDAGNREDQINR 39 sp|P18124|RL7_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 37 ms_run[1]:scan=1.1.7535.7 93.49872 4 2114.9673 2114.9730 K L 224 243 PSM HILLAVANDEELNQLLK 40 sp|O75367-3|H2AY_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 36 ms_run[1]:scan=1.1.1721.3 12.5101 3 1932.0634 1932.0680 R G 80 97 PSM KGDVEGSQSQDEGEGSGESER 41 sp|Q9UQE7|SMC3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 36 ms_run[1]:scan=1.1.5895.10 49.07818 3 2165.8978 2165.8945 K G 1059 1080 PSM HSGPNSADSANDGFVR 42 sp|P52597|HNRPF_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 36 ms_run[1]:scan=1.1.7026.11 79.85247 3 1629.7120 1629.7132 K L 99 115 PSM NIIHGSDSVESAEK 43 sp|P15531-2|NDKA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 36 ms_run[1]:scan=1.1.7181.8 84.0059 3 1484.7103 1484.7107 R E 140 154 PSM GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR 44 sp|P04264|K2C1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 36 ms_run[1]:scan=1.1.7422.11 90.47865 3 2382.9505 2382.9447 R G 519 550 PSM AASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAGPGAATK 45 sp|Q9UKY7|CDV3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 36 ms_run[1]:scan=1.1.7511.11 92.85268 4 3668.7093 3668.7123 R A 28 77 PSM KQPPVSPGTALVGSQK 46 sp|P17096|HMGA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 36 ms_run[1]:scan=1.1.7977.9 105.5284 3 1593.886871 1592.888606 R E 31 47 PSM KQPPVSPGTALVGSQK 47 sp|P17096|HMGA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 36 ms_run[1]:scan=1.1.8060.8 107.7755 3 1593.887771 1592.888606 R E 31 47 PSM YVELFLNSTAGASGGAYEHR 48 sp|P31943|HNRH1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 35 ms_run[1]:scan=1.1.1653.8 11.36448 3 2141.0164 2141.0178 R Y 356 376 PSM LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK 49 sp|P06748-2|NPM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 35 ms_run[1]:scan=1.1.1628.3 10.73497 3 3722.1862 3722.1951 K A 158 190 PSM TDNAGDQHGGGGGGGGGAGAAGGGGGGENYDDPHK 50 sp|P14866|HNRPL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 35 ms_run[1]:scan=1.1.6215.10 57.83082 4 2980.2001 2980.1953 K T 63 98 PSM EKEDDEEEEDEDASGGDQDQEER 51 sp|O60216|RAD21_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 35 ms_run[1]:scan=1.1.6266.11 59.24332 3 2681.9848 2681.9808 K R 532 555 PSM AEAGEAGQATAEAECHR 52 sp|O95671-2|ASML_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 35 15-UNIMOD:4 ms_run[1]:scan=1.1.6856.11 75.29532 3 1756.7410 1756.7434 K T 244 261 PSM AISVHSTPEGCSSACK 53 sp|Q9NZI8|IF2B1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 35 11-UNIMOD:4,15-UNIMOD:4 ms_run[1]:scan=1.1.6577.10 67.68314 3 1689.7429 1689.7451 K M 243 259 PSM AAEEAPEEAPEDAAR 54 sp|Q9H9Z2|LN28A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 35 ms_run[1]:scan=1.1.7034.11 80.06533 2 1554.6810 1554.6797 K A 16 31 PSM KEDGSEVGVGGAQVTGSNTR 55 sp|Q13618|CUL3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 35 ms_run[1]:scan=1.1.7150.10 83.1983 3 1946.9287 1946.9294 K K 569 589 PSM AAEAAAAPAESAAPAAGEEPSKEEGEPK 56 sp|P80723|BASP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 35 ms_run[1]:scan=1.1.7687.8 97.63773 4 2635.2237 2635.2248 K K 122 150 PSM SYLSGGAGAAGGGGADPGNK 57 sp|P25490|TYY1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 35 ms_run[1]:scan=1.1.7687.11 97.64273 2 1662.7586 1662.7598 K K 184 204 PSM HTGPNSPDTANDGFVR 58 sp|P31943|HNRH1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 35 ms_run[1]:scan=1.1.7586.11 94.9009 2 1683.7572 1683.7601 K L 99 115 PSM ALVSGKPAESSAVAATEK 59 sp|O95182|NDUA7_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 35 ms_run[1]:scan=1.1.7654.10 96.73801 3 1714.9084 1714.9101 K K 75 93 PSM KQPPVSPGTALVGSQK 60 sp|P17096|HMGA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 35 ms_run[1]:scan=1.1.8101.8 108.8341 3 1592.8846 1592.8886 R E 31 47 PSM RQAVTNPNNTFYATK 61 sp|P38646|GRP75_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 35 ms_run[1]:scan=1.1.7916.9 103.8578 3 1723.8622 1723.8642 K R 107 122 PSM LPAAGGGAAGEPLK 62 sp|Q2Q1W2|LIN41_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 35 ms_run[1]:scan=1.1.7825.9 101.3643 2 1207.6538 1207.6561 R L 75 89 PSM TGVHHYSGNNIELGTACGK 63 sp|P62888|RL30_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 35 17-UNIMOD:4 ms_run[1]:scan=1.1.7883.10 102.9544 3 2013.9298 2013.9327 K Y 69 88 PSM AALSASEGEEVPQDK 64 sp|O95831|AIFM1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 35 ms_run[1]:scan=1.1.7845.10 101.9111 2 1529.7210 1529.7209 K A 113 128 PSM KQPPVSPGTALVGSQK 65 sp|P17096|HMGA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 35 ms_run[1]:scan=1.1.7984.11 105.7222 2 1592.8890 1592.8886 R E 31 47 PSM IGSCTQQDVELHVQK 66 sp|P14868|SYDC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 35 4-UNIMOD:4 ms_run[1]:scan=1.1.8452.9 118.3605 3 1740.8446 1740.8465 K I 127 142 PSM CTGGEVGATSALAPK 67 sp|P30050-2|RL12_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 35 1-UNIMOD:4 ms_run[1]:scan=1.1.8149.11 110.1426 2 1417.6852 1417.6871 R I 17 32 PSM SGEENPASKPTPVQDVQGDGR 68 sp|Q15102|PA1B3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 35 1-UNIMOD:1 ms_run[1]:scan=1.1.8442.11 118.0901 3 2209.0244 2209.0242 M W 2 23 PSM GDTPGHATPGHGGATSSAR 69 sp|O75533|SF3B1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34 ms_run[1]:scan=1.1.5791.2 46.37063 4 1732.7877 1732.7877 R K 271 290 PSM IHEGCEEPATHNALAK 70 sp|Q00610-2|CLH1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34 5-UNIMOD:4 ms_run[1]:scan=1.1.6473.11 64.8332 3 1775.8276 1775.8260 R I 866 882 PSM ADDKETCFAEEGK 71 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34 7-UNIMOD:4 ms_run[1]:scan=1.1.6818.9 74.27631 3 1498.6255 1498.6246 K K 585 598 PSM AEAGPEGVAPAPEGEKK 72 sp|Q9Y4L1|HYOU1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34 ms_run[1]:scan=1.1.6643.9 69.48264 3 1635.8101 1635.8104 K Q 670 687 PSM SVSTPSEAGSQDSGDGAVGSR 73 sp|Q13409-2|DC1I2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34 ms_run[1]:scan=1.1.6873.11 75.76172 3 1949.8552 1949.8563 K T 86 107 PSM PSETPQAEVGPTGCPHR 74 sp|P0DN79|CBSL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34 14-UNIMOD:4 ms_run[1]:scan=1.1.7068.9 80.98096 3 1818.8323 1818.8319 M S 2 19 PSM PSETPQAEVGPTGCPHR 75 sp|P0DN79|CBSL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34 14-UNIMOD:4 ms_run[1]:scan=1.1.7087.10 81.49278 3 1818.8326 1818.8319 M S 2 19 PSM AADPPAENSSAPEAEQGGAE 76 sp|P67809|YBOX1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34 ms_run[1]:scan=1.1.6949.10 77.77979 3 1896.7975 1896.7973 K - 305 325 PSM GHAGSVDSIAVDGSGTK 77 sp|Q9GZL7|WDR12_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34 ms_run[1]:scan=1.1.7367.9 89.05458 3 1556.7400 1556.7431 R F 187 204 PSM GEPAAAAAPEAGASPVEK 78 sp|P29966|MARCS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34 ms_run[1]:scan=1.1.7581.11 94.76437 2 1621.7928 1621.7947 K E 88 106 PSM AGGAAVVITEPEHTK 79 sp|Q9P258|RCC2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34 ms_run[1]:scan=1.1.7738.7 99.02693 3 1478.7700 1478.7729 K E 78 93 PSM TGVHHYSGNNIELGTACGK 80 sp|P62888|RL30_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34 17-UNIMOD:4 ms_run[1]:scan=1.1.7913.6 103.7709 4 2013.9273 2013.9327 K Y 69 88 PSM VDEVPDGAVKPPTNK 81 sp|O75475|PSIP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34 ms_run[1]:scan=1.1.7884.8 102.9787 3 1564.8064 1564.8097 R L 25 40 PSM KQPPVSPGTALVGSQK 82 sp|P17096|HMGA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34 ms_run[1]:scan=1.1.8003.11 106.239 2 1592.8894 1592.8886 R E 31 47 PSM THYSNIEANESEEVR 83 sp|P04632|CPNS1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34 ms_run[1]:scan=1.1.7743.10 99.1687 3 1776.7870 1776.7914 R Q 85 100 PSM SCSGVEFSTSGSSNTDTGK 84 sp|P45880-1|VDAC2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34 2-UNIMOD:4 ms_run[1]:scan=1.1.7847.11 101.9674 3 1906.7839 1906.7851 K V 61 80 PSM IHCTQTLLEGDGPK 85 sp|P29762|RABP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34 3-UNIMOD:4 ms_run[1]:scan=1.1.8511.11 119.9756 2 1567.7688 1567.7664 K T 94 108 PSM KQPPVSPGTALVGSQK 86 sp|P17096|HMGA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34 ms_run[1]:scan=1.1.8177.10 110.9036 3 1592.8858 1592.8886 R E 31 47 PSM ATAGDTHLGGEDFDNR 87 sp|P0DMV8-2|HS71A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34 ms_run[1]:scan=1.1.8315.5 114.6407 3 1674.7213 1674.7234 K L 166 182 PSM ELDDATEANEGLSR 88 sp|P35580-3|MYH10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34 ms_run[1]:scan=1.1.8391.11 116.7199 2 1518.6814 1518.6798 R E 1927 1941 PSM HGSYEDAVHSGALND 89 sp|P17987|TCPA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34 ms_run[1]:scan=1.1.8441.11 118.0628 2 1570.6646 1570.6648 K - 542 557 PSM MREDYDSVEQDGDEPGPQR 90 sp|Q9Y5S9|RBM8A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34 ms_run[1]:scan=1.1.8455.11 118.446 3 2221.9156 2221.9182 R S 50 69 PSM EEKEESDDEAAVEEEEEEK 91 sp|P14625|ENPL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 34 ms_run[1]:scan=1.1.8194.11 111.3688 3 2251.8952 2251.8975 K K 301 320 PSM EDLPAENGETKTEESPASDEAGEK 92 sp|P05114|HMGN1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 34 ms_run[1]:scan=1.1.7716.11 98.432 3 2533.092671 2532.098731 K E 72 96 PSM SETAPAETATPAPVEK 93 sp|P16401|H15_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 34 1-UNIMOD:1 ms_run[1]:scan=1.1.8329.10 115.0276 2 1639.7956 1639.7936 M S 2 18 PSM SGEENPASKPTPVQDVQGDGR 94 sp|Q15102|PA1B3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 34 1-UNIMOD:1 ms_run[1]:scan=1.1.8423.11 117.5755 3 2210.0262 2209.0242 M W 2 23 PSM HILLAVANDEELNQLLK 95 sp|O75367-3|H2AY_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33 ms_run[1]:scan=1.1.1681.3 12.00525 3 1932.0655 1932.0680 R G 80 97 PSM LLGGVTIAQGGVLPNIQAVLLPK 96 sp|P16104|H2AX_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33 ms_run[1]:scan=1.1.1683.3 12.05893 3 2270.3668 2270.3726 K K 97 120 PSM SGGGGGGGGSSWGGR 97 sp|Q13151|ROA0_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33 ms_run[1]:scan=1.1.6351.11 61.57033 2 1191.5018 1191.5018 K S 270 285 PSM NQGGYGGSSSSSSYGSGR 98 sp|P09651-2|ROA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33 ms_run[1]:scan=1.1.6364.11 61.928 2 1693.6952 1693.6928 R R 301 319 PSM GEGAGQPSTSAQGQPAAPAPQK 99 sp|P52926|HMGA2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33 ms_run[1]:scan=1.1.6516.11 66.00919 3 2033.9770 2033.9766 R R 5 27 PSM VDCTAHSDVCSAQGVR 100 sp|Q8NBS9|TXND5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33 3-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.6667.11 70.14135 3 1760.7565 1760.7570 K G 119 135 PSM NIIHGSDSVESAEK 101 sp|P15531-2|NDKA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33 ms_run[1]:scan=1.1.7161.8 83.48808 3 1484.7103 1484.7107 R E 140 154 PSM APKPDGPGGGPGGSHMGGNYGDDR 102 sp|P35637-2|FUS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33 ms_run[1]:scan=1.1.7175.8 83.84988 4 2251.9677 2251.9665 K R 448 472 PSM PAETPVATSPTATDSTSGDSSR 103 sp|P54727|RD23B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33 ms_run[1]:scan=1.1.7252.10 85.93626 3 2133.9670 2133.9662 K S 152 174 PSM TADDSATSDYCPAPK 104 sp|Q9UBC3-8|DNM3B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33 11-UNIMOD:4 ms_run[1]:scan=1.1.7069.11 81.01072 2 1597.6602 1597.6566 R R 321 336 PSM GEPAAAAAPEAGASPVEK 105 sp|P29966|MARCS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33 ms_run[1]:scan=1.1.7545.7 93.77151 3 1621.7917 1621.7947 K E 88 106 PSM IIAEGANGPTTPEADK 106 sp|P00367|DHE3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33 ms_run[1]:scan=1.1.7558.11 94.13382 2 1582.7826 1582.7838 K I 400 416 PSM SCVEEPEPEPEAAEGDGDKK 107 sp|P51858|HDGF_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33 2-UNIMOD:4 ms_run[1]:scan=1.1.7426.11 90.5811 3 2171.9158 2171.9164 K G 107 127 PSM KQPPVSPGTALVGSQK 108 sp|P17096|HMGA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33 ms_run[1]:scan=1.1.8022.4 106.7479 4 1592.8865 1592.8886 R E 31 47 PSM RSGVAYIAAPSGSAADK 109 sp|P31939-2|PUR9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33 ms_run[1]:scan=1.1.8000.11 106.1573 2 1619.8300 1619.8267 K V 552 569 PSM TGVHHYSGNNIELGTACGK 110 sp|P62888|RL30_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33 17-UNIMOD:4 ms_run[1]:scan=1.1.7893.3 103.2171 4 2013.9273 2013.9327 K Y 69 88 PSM KRPAPQQIQQVQQQAVQNR 111 sp|Q96GM5-2|SMRD1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33 ms_run[1]:scan=1.1.7914.10 103.8049 4 2244.2177 2244.2199 R N 101 120 PSM TGVHHYSGNNIELGTACGK 112 sp|P62888|RL30_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33 17-UNIMOD:4 ms_run[1]:scan=1.1.7905.11 103.56 3 2013.9304 2013.9327 K Y 69 88 PSM VDEVPDGAVKPPTNK 113 sp|O75475|PSIP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33 ms_run[1]:scan=1.1.7922.8 104.021 3 1564.8121 1564.8097 R L 25 40 PSM VQAAVGTSAAPVPSDNH 114 sp|P02649|APOE_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33 ms_run[1]:scan=1.1.7756.11 99.52679 2 1619.7888 1619.7904 K - 301 318 PSM VQIAANEETQEREEQMK 115 sp|P49321|NASP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33 ms_run[1]:scan=1.1.8085.9 108.4197 3 2031.9493 2031.9531 K E 456 473 PSM SCVEEPEPEPEAAEGDGDK 116 sp|P51858|HDGF_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33 2-UNIMOD:4 ms_run[1]:scan=1.1.7983.11 105.695 2 2043.8234 2043.8215 K K 107 126 PSM SQSSIVPEEEQAANKGEEK 117 sp|Q969G3-2|SMCE1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33 ms_run[1]:scan=1.1.7840.10 101.7745 3 2058.9655 2058.9705 R K 314 333 PSM GGGGPGGGGPGGGSAGGPSQPPGGGGPGIR 118 sp|Q92945|FUBP2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33 ms_run[1]:scan=1.1.7902.11 103.4776 3 2269.0564 2269.0585 R K 41 71 PSM GPVKPTGGPGGGGTQTQQQMNQLK 119 sp|P26196|DDX6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33 ms_run[1]:scan=1.1.7872.11 102.6535 3 2365.1752 2365.1809 R N 23 47 PSM DVACGANHTLVLDSQKR 120 sp|Q9P258|RCC2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33 4-UNIMOD:4 ms_run[1]:scan=1.1.8395.5 116.8175 4 1882.9241 1882.9319 R V 334 351 PSM KATDAEADVASLNR 121 sp|P09493-3|TPM1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33 ms_run[1]:scan=1.1.8420.8 117.4897 3 1459.7263 1459.7267 K R 77 91 PSM RPAEDMEEEQAFK 122 sp|P61978|HNRPK_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 33 ms_run[1]:scan=1.1.8319.8 114.7536 3 1578.6982 1578.6984 K R 22 35 PSM SETAPAAPAAPAPAEK 123 sp|P10412|H14_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 33 1-UNIMOD:1 ms_run[1]:scan=1.1.8126.11 109.5159 2 1520.7532 1519.7512 M T 2 18 PSM SETAPAETATPAPVEK 124 sp|P16401|H15_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 33 1-UNIMOD:1 ms_run[1]:scan=1.1.8310.10 114.5138 2 1639.7956 1639.7936 M S 2 18 PSM PVSSAASVYAGAGGSGSR 125 sp|P05783|K1C18_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.8133.8 109.7018 3 1579.757171 1579.759048 R I 28 46 PSM RVVDESDETENQEEK 126 sp|O75717|WDHD1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 ms_run[1]:scan=1.1.6067.11 53.79547 3 1805.7904 1805.7915 K A 1085 1100 PSM TLVLSNLSYSATEETLQEVFEK 127 sp|P19338|NUCL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 ms_run[1]:scan=1.1.1662.6 11.59475 3 2500.2544 2500.2584 K A 487 509 PSM AGAAGGPEEEAEKPVK 128 sp|Q8WW12|PCNP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 ms_run[1]:scan=1.1.6410.9 63.14262 3 1538.7589 1538.7576 R T 17 33 PSM CCAAADPHECYAK 129 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.6333.8 61.07573 3 1551.5929 1551.5905 K V 384 397 PSM GEGAGQPSTSAQGQPAAPAPQK 130 sp|P52926|HMGA2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 ms_run[1]:scan=1.1.6497.11 65.48705 3 2033.9770 2033.9766 R R 5 27 PSM AGNASKDEIDSAVK 131 sp|P23381|SYWC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 ms_run[1]:scan=1.1.6681.7 70.51881 3 1403.6881 1403.6892 K M 28 42 PSM SEDDESGAGELTR 132 sp|P33993|MCM7_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 ms_run[1]:scan=1.1.6905.11 76.61472 2 1364.5688 1364.5692 K E 309 322 PSM RQLEEAEEEAQR 133 sp|P35579|MYH9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 ms_run[1]:scan=1.1.6808.11 74.00761 2 1486.7018 1486.7011 K A 1877 1889 PSM SSGGREDLESSGLQR 134 sp|Q9UK76-2|JUPI1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 ms_run[1]:scan=1.1.7239.8 85.57713 3 1576.7449 1576.7441 K R 70 85 PSM SSQTSGTNEQSSAIVSAR 135 sp|O60763-2|USO1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 ms_run[1]:scan=1.1.7081.11 81.331 3 1808.8489 1808.8500 K D 776 794 PSM AADPPAENSSAPEAEQGGAE 136 sp|P67809|YBOX1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 ms_run[1]:scan=1.1.6968.10 78.29135 3 1896.7975 1896.7973 K - 305 325 PSM QGGGGGGGSVPGIER 137 sp|P52272|HNRPM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 ms_run[1]:scan=1.1.7300.10 87.25484 2 1283.6228 1283.6219 K M 389 404 PSM AQAAAPASVPAQAPK 138 sp|P47914|RL29_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 ms_run[1]:scan=1.1.7094.11 81.6849 2 1376.7436 1376.7412 K R 135 150 PSM RAGELTEDEVER 139 sp|P62269|RS18_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 ms_run[1]:scan=1.1.7103.11 81.93 2 1402.6702 1402.6688 K V 55 67 PSM DPSASPGDAGEQAIR 140 sp|P18206|VINC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 ms_run[1]:scan=1.1.7601.9 95.30123 3 1469.6692 1469.6746 R Q 286 301 PSM RDIQENDEEAVQVK 141 sp|O00231-2|PSD11_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 ms_run[1]:scan=1.1.7327.11 87.99398 3 1671.8020 1671.8064 K E 33 47 PSM HSLNSSSASTTEPDFQK 142 sp|P42704|LPPRC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 ms_run[1]:scan=1.1.7618.10 95.75542 3 1834.8271 1834.8333 K D 1021 1038 PSM SNVSDAVAQSTR 143 sp|P60174|TPIS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 ms_run[1]:scan=1.1.7331.9 88.09856 2 1233.5946 1233.5949 K I 232 244 PSM SEHPGLSIGDTAK 144 sp|P26583|HMGB2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 ms_run[1]:scan=1.1.7711.5 98.28547 3 1310.6452 1310.6466 K K 115 128 PSM FGQGGAGPVGGQGPR 145 sp|P23246|SFPQ_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 ms_run[1]:scan=1.1.7440.11 90.94131 2 1340.6586 1340.6586 R G 667 682 PSM AVTEQGAELSNEER 146 sp|P27348|1433T_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 ms_run[1]:scan=1.1.7458.6 91.40227 3 1531.7104 1531.7114 K N 28 42 PSM SVTEQGAELSNEER 147 sp|P63104|1433Z_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 ms_run[1]:scan=1.1.7694.11 97.8328 2 1547.7064 1547.7063 K N 28 42 PSM HTGPNSPDTANDGFVR 148 sp|P31943|HNRH1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 ms_run[1]:scan=1.1.7605.7 95.4037 3 1683.7528 1683.7601 K L 99 115 PSM HSLNSSSASTTEPDFQK 149 sp|P42704|LPPRC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 ms_run[1]:scan=1.1.7593.10 95.08935 3 1834.8322 1834.8333 K D 1021 1038 PSM QHLENDPGSNEDTDIPK 150 sp|O43396|TXNL1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 ms_run[1]:scan=1.1.7656.10 96.79266 3 1907.8459 1907.8497 K G 105 122 PSM KPPLLNNADSVQAK 151 sp|P09874|PARP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 ms_run[1]:scan=1.1.7777.8 100.0682 3 1493.8159 1493.8202 K V 748 762 PSM KPPLLNNADSVQAK 152 sp|P09874|PARP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 ms_run[1]:scan=1.1.7815.9 101.0929 3 1493.8159 1493.8202 K V 748 762 PSM YEDFKEEGSENAVK 153 sp|Q9NTK5|OLA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 ms_run[1]:scan=1.1.7813.10 101.0402 3 1643.7298 1643.7315 K A 350 364 PSM KEEEEEEEEYDEGSNLK 154 sp|Q14165|MLEC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 ms_run[1]:scan=1.1.7979.9 105.5827 3 2084.8552 2084.8545 K K 230 247 PSM EELQANGSAPAADKEEPAAAGSGAASPSAAEK 155 sp|P29966|MARCS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 ms_run[1]:scan=1.1.8020.11 106.7044 4 2981.3865 2981.3849 K G 56 88 PSM KPPLLNNADSVQAK 156 sp|P09874|PARP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 ms_run[1]:scan=1.1.7796.8 100.5741 3 1493.8159 1493.8202 K V 748 762 PSM QCQCTSVGAQNTVICSK 157 sp|P16422|EPCAM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 2-UNIMOD:4,4-UNIMOD:4,15-UNIMOD:4 ms_run[1]:scan=1.1.7917.10 103.8868 3 1939.8511 1939.8550 R L 45 62 PSM SCVEEPEPEPEAAEGDGDK 158 sp|P51858|HDGF_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 2-UNIMOD:4 ms_run[1]:scan=1.1.8002.11 106.2117 2 2043.8260 2043.8215 K K 107 126 PSM AGNEKEEGETADTVGCCSLR 159 sp|P11387|TOP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 16-UNIMOD:4,17-UNIMOD:4 ms_run[1]:scan=1.1.7838.11 101.7216 3 2181.9256 2181.9267 R V 489 509 PSM LITQTFSHHNQLAQK 160 sp|Q9Y266|NUDC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 ms_run[1]:scan=1.1.8164.6 110.5421 4 1764.9253 1764.9271 K T 54 69 PSM KLDEAVAEAHLGK 161 sp|P23526-2|SAHH_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 ms_run[1]:scan=1.1.8437.4 117.9426 3 1379.7364 1379.7408 K L 361 374 PSM HGSYEDAVHSGALND 162 sp|P17987|TCPA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 ms_run[1]:scan=1.1.8460.7 118.5766 3 1570.6588 1570.6648 K - 542 557 PSM LNFSHGTHEYHAETIK 163 sp|P14618-2|KPYM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 ms_run[1]:scan=1.1.8376.3 116.2954 5 1882.8946 1882.8962 R N 74 90 PSM STAGDTHLGGEDFDNR 164 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 32 ms_run[1]:scan=1.1.8259.11 113.1396 2 1690.7204 1690.7183 K M 221 237 PSM CCAAADPHECYAK 165 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 32 1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.7842.11 101.8308 2 1535.5632 1534.5632 K V 384 397 PSM CCAAADPHECYAK 166 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 32 1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.7823.11 101.3136 2 1535.5632 1534.5632 K V 384 397 PSM NQGGYGGSSSSSSYGSGR 167 sp|P09651|ROA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.6697.11 70.96368 2 1694.681647 1693.692819 R R 353 371 PSM SETAPAAPAAAPPAEK 168 sp|P16403|H12_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 32 1-UNIMOD:1 ms_run[1]:scan=1.1.7993.10 105.9653 3 1519.7512 1519.7513 M A 2 18 PSM AATASAGAGGIDGKPR 169 sp|Q02978|M2OM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 32 1-UNIMOD:1 ms_run[1]:scan=1.1.7357.11 88.7922 2 1440.7313 1440.7316 M T 2 18 PSM APKPDGPGGGPGGSHMGGNYGDDR 170 sp|P35637|FUS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.7199.10 84.49468 4 2250.971294 2251.966492 K R 449 473 PSM ALQEASEAYLVGLFEDTNLCAIHAK 171 sp|Q71DI3|H32_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1000663, ProteinPilot, ] 31 20-UNIMOD:4 ms_run[1]:scan=1.1.1702.2 12.24792 4 2762.3532941913204 2762.3585313359995 M R 92 117 PSM VEAKPEVQSQPPR 172 sp|Q9UN86-2|G3BP2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.6271.9 59.37843 3 1463.7718 1463.7732 R V 245 258 PSM GGSGGSYGGGGSGGGYGGGSGSR 173 sp|P35527|K1C9_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.6295.11 60.04573 3 1790.7199 1790.7205 R G 491 514 PSM DPAEGDGAQPEETPR 174 sp|Q14697|GANAB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.6461.11 64.52106 2 1567.6788 1567.6750 K D 192 207 PSM GEGAGQPSTSAQGQPAAPAPQK 175 sp|P52926|HMGA2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.6478.10 64.96568 3 2033.9770 2033.9766 R R 5 27 PSM VEDAADSATKPENLSSK 176 sp|P46013|KI67_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.6844.10 74.96616 3 1760.8432 1760.8428 K T 405 422 PSM SEENEEPMETDQNAKEEEK 177 sp|P34932|HSP74_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.6626.11 69.02098 3 2264.9239 2264.9226 K M 503 522 PSM GEAAAERPGEAAVASSPSK 178 sp|P29966|MARCS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.6523.11 66.20167 2 1783.8722 1783.8700 K A 12 31 PSM HSGPNSADSANDGFVR 179 sp|P52597|HNRPF_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.7021.7 79.7145 3 1629.7120 1629.7132 K L 99 115 PSM RDIQENDEEAVQVK 180 sp|O00231-2|PSD11_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.7308.10 87.47345 3 1671.8020 1671.8064 K E 33 47 PSM AAFTECCQAADK 181 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 6-UNIMOD:4,7-UNIMOD:4 ms_run[1]:scan=1.1.7073.10 81.11498 2 1370.5608 1370.5595 K A 187 199 PSM HEQNIDCGGGYVK 182 sp|P27797|CALR_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 7-UNIMOD:4 ms_run[1]:scan=1.1.6976.11 78.51185 2 1475.6452 1475.6463 K L 99 112 PSM AVTEQGAELSNEER 183 sp|P27348|1433T_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.7438.9 90.88645 3 1531.7104 1531.7114 K N 28 42 PSM GEPAAAAAPEAGASPVEK 184 sp|P29966|MARCS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.7575.10 94.59855 3 1621.7917 1621.7947 K E 88 106 PSM VLTGVAGEDAECHAAK 185 sp|O95373|IPO7_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 12-UNIMOD:4 ms_run[1]:scan=1.1.7399.9 89.88023 3 1626.7678 1626.7672 K L 725 741 PSM CGFCHVGEEENEAR 186 sp|Q8IWS0-3|PHF6_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 1-UNIMOD:4,4-UNIMOD:4 ms_run[1]:scan=1.1.7568.10 94.4064 3 1692.6598 1692.6620 K G 211 225 PSM EESESTAVGQAHSDISK 187 sp|Q02952-2|AKA12_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.7466.9 91.62313 3 1773.7981 1773.8017 K D 1518 1535 PSM QGGGGGGGSVPGIER 188 sp|P52272|HNRPM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.7319.11 87.7757 2 1283.6228 1283.6219 K M 389 404 PSM KNSVVEASEAAYK 189 sp|Q04917|1433F_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.7649.10 96.60172 2 1394.7040 1394.7041 K E 143 156 PSM WDQTADQTPGATPK 190 sp|O75533|SF3B1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.7564.11 94.29843 2 1514.6986 1514.7001 R K 200 214 PSM SSQSSSQQFSGIGR 191 sp|Q92841-1|DDX17_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.7934.8 104.3495 3 1454.6710 1454.6750 R S 592 606 PSM IQFKPDDGTTPER 192 sp|Q96AE4-2|FUBP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.8112.4 109.123 3 1502.7319 1502.7365 R I 308 321 PSM KQPPVSPGTALVGSQK 193 sp|P17096|HMGA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.7950.8 104.7872 3 1592.8885 1592.8886 R E 31 47 PSM AAVEDSGTTVETIK 194 sp|Q5VTR2|BRE1A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.8020.10 106.7027 2 1419.7096 1419.7093 K L 23 37 PSM GDATVSYEDPPTAK 195 sp|Q01844-2|EWS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.7902.10 103.4759 2 1449.6614 1449.6624 K A 338 352 PSM QEYDESGPSIVHR 196 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.8090.4 108.5412 3 1515.6922 1515.6954 K K 360 373 PSM QEYDESGPSIVHR 197 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.8050.6 107.5109 3 1515.6922 1515.6954 K K 360 373 PSM TPEAVESPQEASGVR 198 sp|Q7L190|DPPA4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.7860.11 102.3232 2 1555.7450 1555.7478 R W 215 230 PSM EDAGDNDDTEGAIGVR 199 sp|Q9H0S4-2|DDX47_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.7930.11 104.2449 2 1632.6872 1632.6863 R N 377 393 PSM ALLANQDSGEVQQDPK 200 sp|Q9NP81|SYSM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.8009.11 106.4028 2 1711.8376 1711.8377 R Y 119 135 PSM GAVAEDGDELRTEPEAK 201 sp|P27695|APEX1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.7785.10 100.2806 3 1785.8350 1785.8381 K K 8 25 PSM GGGGPGGGGPGGGSAGGPSQPPGGGGPGIR 202 sp|Q92945|FUBP2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.7863.11 102.4058 3 2269.0564 2269.0585 R K 41 71 PSM TLHPAVHAGILAR 203 sp|P31939-2|PUR9_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.8470.3 118.844 4 1354.7809 1354.7833 K N 66 79 PSM CTGGEVGATSALAPK 204 sp|P30050-2|RL12_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 1-UNIMOD:4 ms_run[1]:scan=1.1.8149.7 110.136 3 1417.6825 1417.6871 R I 17 32 PSM GGGGGGPGEGFDVAK 205 sp|Q9Y295|DRG1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.8227.10 112.2612 2 1260.5776 1260.5735 K T 47 62 PSM HAASTVQILGAEK 206 sp|Q9Y2X3|NOP58_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.8127.7 109.5363 2 1323.7118 1323.7146 K A 311 324 PSM VLEEANQAINPK 207 sp|Q92841-1|DDX17_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.8214.11 111.9089 2 1324.6990 1324.6986 K L 457 469 PSM IQALQQQADEAEDR 208 sp|P67936|TPM4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.8504.9 119.7807 3 1613.7628 1613.7645 K A 14 28 PSM ASGNYATVISHNPETK 209 sp|P62917|RL8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.8372.9 116.1954 3 1687.8148 1687.8165 R K 129 145 PSM STAGDTHLGGEDFDNR 210 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.8278.11 113.6556 3 1690.7176 1690.7183 K M 221 237 PSM SADGSAPAGEGEGVTLQR 211 sp|Q01650|LAT1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.8172.11 110.7688 2 1700.8004 1700.7966 K N 31 49 PSM KPDAYTEQLHNEEENEDAR 212 sp|Q9P0T7|TMEM9_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 31 ms_run[1]:scan=1.1.8384.9 116.5253 4 2286.9969 2286.9988 R S 118 137 PSM CCAAADPHECYAK 213 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 31 1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.7861.11 102.3507 2 1534.5619 1534.5634 K V 384 397 PSM CCAAADPHECYAK 214 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 31 1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.7804.11 100.7962 2 1535.5632 1534.5632 K V 384 397 PSM QEYDESGPSIVHR 215 sp|Q9BYX7|ACTBM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.8070.7 108.0316 3 1516.692971 1515.695386 K K 360 373 PSM SETAPAAPAAPAPAEK 216 sp|P10412|H14_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 31 1-UNIMOD:1 ms_run[1]:scan=1.1.8145.11 110.0336 2 1521.7532 1519.7512 M T 2 18 PSM GSVSNQQFAGGCAK 217 sp|Q9H9Z2|LN28A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 31 1-UNIMOD:1,12-UNIMOD:4 ms_run[1]:scan=1.1.8108.9 109.0227 2 1451.6443 1451.6458 M A 2 16 PSM LFIGGLSFETTEESLR 218 sp|P22626-2|ROA2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.1644.2 11.15205 2 1797.9150 1797.9149 K N 11 27 PSM NNRPSEGPLQTR 219 sp|Q00610-2|CLH1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.6442.5 63.993 3 1367.6884 1367.6906 K L 572 584 PSM NNRPSEGPLQTR 220 sp|Q00610-2|CLH1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.6423.7 63.48962 3 1367.6884 1367.6906 K L 572 584 PSM VAAQCSHAAVSAYK 221 sp|Q9Y3E5|PTH2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 5-UNIMOD:4 ms_run[1]:scan=1.1.6459.9 64.46608 3 1461.7015 1461.7034 K Q 82 96 PSM VGGTSDVEVNEK 222 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.6507.8 65.75632 2 1232.5880 1232.5885 K K 406 418 PSM TVEAEAAHGTVTR 223 sp|O75874|IDHC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.6380.7 62.3454 3 1340.6677 1340.6684 K H 302 315 PSM EEASGSSVTAEEAK 224 sp|P13010|XRCC5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.6166.11 56.47415 2 1393.6216 1393.6209 K K 689 703 PSM CCAAADPHECYAK 225 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.6352.8 61.59277 3 1551.5929 1551.5905 K V 384 397 PSM AVTEQGHELSNEER 226 sp|P31946-2|1433B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.6493.11 65.37772 2 1597.7358 1597.7332 K N 28 42 PSM AAPTAASDQPDSAATTEK 227 sp|Q9BRP8-2|PYM1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.6327.11 60.92043 2 1730.8024 1730.7959 R A 132 150 PSM KGDECELLGHSK 228 sp|P49411|EFTU_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 5-UNIMOD:4 ms_run[1]:scan=1.1.6791.4 73.5293 3 1371.6442 1371.6452 K N 286 298 PSM GDVTAEEAAGASPAK 229 sp|P49006|MRP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.6906.5 76.63057 3 1372.6447 1372.6470 R A 11 26 PSM VLATVTKPVGGDK 230 sp|Q02878|RL6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.6878.9 75.8956 2 1283.7446 1283.7449 K N 88 101 PSM RALANSLACQGK 231 sp|P04075-2|ALDOA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 9-UNIMOD:4 ms_run[1]:scan=1.1.6726.11 71.7591 2 1287.6716 1287.6717 K Y 385 397 PSM NGSLDSPGKQDTEEDEEEDEK 232 sp|Q9Y266|NUDC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.6725.11 71.7315 3 2349.9616 2349.9568 K D 134 155 PSM AAHSEGNTTAGLDMR 233 sp|P78371-2|TCPB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.7121.10 82.41354 3 1529.6920 1529.6892 R E 420 435 PSM HVGDLGNVTADK 234 sp|P00441|SODC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.7273.11 86.51473 2 1224.6090 1224.6099 R D 81 93 PSM QGGGGGGGSVPGIER 235 sp|P52272|HNRPM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.7281.10 86.73415 2 1283.6228 1283.6219 K M 389 404 PSM VTQDATPGSALDK 236 sp|Q01581|HMCS1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.7003.11 79.24825 2 1301.6474 1301.6463 K I 388 401 PSM AAFTECCQAADK 237 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 6-UNIMOD:4,7-UNIMOD:4 ms_run[1]:scan=1.1.7054.11 80.60905 2 1370.5608 1370.5595 K A 187 199 PSM AAFTECCQAADK 238 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 6-UNIMOD:4,7-UNIMOD:4 ms_run[1]:scan=1.1.7092.10 81.62881 2 1370.5608 1370.5595 K A 187 199 PSM AQAAAPASVPAQAPK 239 sp|P47914|RL29_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.7075.11 81.16972 2 1376.7436 1376.7412 K R 135 150 PSM YICENQDSISSK 240 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 3-UNIMOD:4 ms_run[1]:scan=1.1.7312.10 87.58263 2 1442.6380 1442.6347 K L 287 299 PSM RQLEEAEEEATR 241 sp|P35580-3|MYH10_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.7049.9 80.4693 2 1459.6924 1459.6902 K A 1905 1917 PSM GTQGATAGASSELDASK 242 sp|O76094|SRP72_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.6957.11 77.99667 2 1549.7220 1549.7220 K T 601 618 PSM GTSFDAAATSGGSASSEK 243 sp|P13804|ETFA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.7210.11 84.79538 2 1629.7150 1629.7118 R A 170 188 PSM FGQGGAGPVGGQGPR 244 sp|P23246|SFPQ_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.7446.3 91.0831 3 1340.6566 1340.6586 R G 667 682 PSM SVTEQGAELSNEER 245 sp|P63104|1433Z_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.7699.9 97.96507 3 1547.7037 1547.7063 K N 28 42 PSM VIGSGCNLDSAR 246 sp|P07195|LDHB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 6-UNIMOD:4 ms_run[1]:scan=1.1.7529.10 93.34057 2 1247.5922 1247.5928 R F 159 171 PSM VGQAVDVVGQAGKPK 247 sp|Q13200|PSMD2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.7485.11 92.14413 2 1451.8086 1451.8096 R T 846 861 PSM HTGPNSPDTANDGFVR 248 sp|P31943|HNRH1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.7624.9 95.91698 3 1683.7528 1683.7601 K L 99 115 PSM NEEPSEEEIDAPKPK 249 sp|Q9NR30|DDX21_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.7572.8 94.51283 3 1710.7921 1710.7948 K K 117 132 PSM QAEVANQETKEDLPAENGETK 250 sp|P05114|HMGN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.7629.11 96.05732 3 2300.0749 2300.0768 K T 62 83 PSM KQPPVSPGTALVGSQK 251 sp|P17096|HMGA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.7960.4 105.0552 4 1592.8849 1592.8886 R E 31 47 PSM NCPHIVVGTPGR 252 sp|Q13838-2|DX39B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 2-UNIMOD:4 ms_run[1]:scan=1.1.7759.5 99.59425 3 1305.6595 1305.6612 K I 179 191 PSM NCPHIVVGTPGR 253 sp|Q13838-2|DX39B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 2-UNIMOD:4 ms_run[1]:scan=1.1.7721.3 98.55527 3 1305.6592 1305.6612 K I 179 191 PSM RTSSAQVEGGVHSLHSYEK 254 sp|P12268|IMDH2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.7720.9 98.5381 4 2071.0025 2071.0083 K R 493 512 PSM VDEVPDGAVKPPTNK 255 sp|O75475|PSIP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.7903.8 103.5 3 1564.8049 1564.8097 R L 25 40 PSM IAECSSQLAEEEEK 256 sp|P35580-3|MYH10_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 4-UNIMOD:4 ms_run[1]:scan=1.1.7924.6 104.0724 3 1621.7095 1621.7141 R A 1029 1043 PSM GTVRPANDFNPDADAK 257 sp|P08133-2|ANXA6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.7801.10 100.7131 3 1686.7894 1686.7962 K A 323 339 PSM THYSNIEANESEEVR 258 sp|P04632|CPNS1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.7764.10 99.7324 3 1776.7870 1776.7914 R Q 85 100 PSM VSVADHSLHLSK 259 sp|Q13162|PRDX4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.8039.11 107.2218 2 1291.6876 1291.6884 R A 67 79 PSM NCPHIVVGTPGR 260 sp|Q13838-2|DX39B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 2-UNIMOD:4 ms_run[1]:scan=1.1.7740.3 99.0748 3 1305.6592 1305.6612 K I 179 191 PSM EFHLNESGDPSSK 261 sp|Q01105-2|SET_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.8038.6 107.1862 3 1445.6413 1445.6423 K S 142 155 PSM VDEVPDGAVKPPTNK 262 sp|O75475|PSIP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.7941.7 104.5393 3 1564.8046 1564.8097 R L 25 40 PSM QVLVAPGNAGTACSEK 263 sp|P22102|PUR2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 13-UNIMOD:4 ms_run[1]:scan=1.1.8007.11 106.3481 2 1600.7886 1600.7879 K I 29 45 PSM GTEASSGTEAATGLEGEEK 264 sp|Q8IY81|SPB1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.8022.11 106.7595 2 1822.8110 1822.8068 K D 594 613 PSM QCQCTSVGAQNTVICSK 265 sp|P16422|EPCAM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 2-UNIMOD:4,4-UNIMOD:4,15-UNIMOD:4 ms_run[1]:scan=1.1.7912.11 103.7517 2 1939.8562 1939.8550 R L 45 62 PSM ILEQEEEEEQAGKPGEPSK 266 sp|Q9BXP5-2|SRRT_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.7924.10 104.0791 3 2125.9996 2126.0015 R K 267 286 PSM KLDEAVAEAHLGK 267 sp|P23526-2|SAHH_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.8418.7 117.434 3 1379.7364 1379.7408 K L 361 374 PSM KATDAEADVASLNR 268 sp|P09493-3|TPM1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.8401.9 116.9829 3 1459.7263 1459.7267 K R 77 91 PSM SIGTANRPMGAGEALR 269 sp|Q12906-7|ILF3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.8292.9 114.0291 3 1599.8128 1599.8151 K R 258 274 PSM LSDDNTIGKEEIQQR 270 sp|Q13813|SPTN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.8121.9 109.3762 3 1744.8562 1744.8591 K L 1830 1845 PSM KPLLESGTLGTK 271 sp|P22314|UBA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.8464.10 118.6916 2 1242.7158 1242.7183 R G 593 605 PSM TPVEPEVAIHR 272 sp|P60866-2|RS20_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.8277.4 113.6169 3 1246.6651 1246.6670 K I 9 20 PSM AVAGNISDPGLQK 273 sp|P18206|VINC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.8168.9 110.6563 2 1268.6702 1268.6725 K S 803 816 PSM VLEEANQAINPK 274 sp|Q92841-1|DDX17_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.8210.11 111.8008 2 1324.6990 1324.6986 K L 457 469 PSM DPDASKPEDWDER 275 sp|P27797|CALR_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.8338.7 115.2653 3 1558.6522 1558.6536 K A 210 223 PSM RPAEDMEEEQAFK 276 sp|P61978|HNRPK_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.8300.7 114.24 3 1578.6985 1578.6984 K R 22 35 PSM DINAYNCEEPTEK 277 sp|P30041|PRDX6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 7-UNIMOD:4 ms_run[1]:scan=1.1.8134.11 109.7341 2 1581.6624 1581.6617 K L 85 98 PSM TYDPSGDSTLPTCSK 278 sp|Q9Y2X3|NOP58_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 13-UNIMOD:4 ms_run[1]:scan=1.1.8362.11 115.9251 2 1627.7048 1627.7036 K K 427 442 PSM IEALQNHENESVYK 279 sp|P52292|IMA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.8208.9 111.7432 3 1672.8028 1672.8056 K A 473 487 PSM IEALQNHENESVYK 280 sp|P52292|IMA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.8189.9 111.2296 3 1672.8028 1672.8056 K A 473 487 PSM STAGDTHLGGEDFDNR 281 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.8297.8 114.1613 3 1690.7176 1690.7183 K M 221 237 PSM HITTISDETSEQVTR 282 sp|Q06546|GABPA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.8209.8 111.7685 3 1715.8294 1715.8326 K W 151 166 PSM MEEESGAPGVPSGNGAPGPK 283 sp|P52272|HNRPM_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.8177.11 110.9053 2 1866.8454 1866.8418 K G 18 38 PSM AAAQLLQSQAQQSGAQQTK 284 sp|Q9NVA2-2|SEP11_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 ms_run[1]:scan=1.1.8394.11 116.8008 2 1956.0062 1956.0024 K K 410 429 PSM TGVHHYSGNNIELGTACGK 285 sp|P62888|RL30_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 30 17-UNIMOD:4 ms_run[1]:scan=1.1.7874.7 102.7021 4 2013.9273 2013.9327 K Y 69 88 PSM HQGVMVGMGQK 286 sp|P62736|ACTA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.6936.9 77.42705 2 1171.564447 1170.563783 R D 42 53 PSM SETAPAAPAAAPPAEK 287 sp|P16403|H12_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 30 1-UNIMOD:1 ms_run[1]:scan=1.1.7994.11 105.9941 2 1519.7517 1519.7513 M A 2 18 PSM VPEPNENVGDAVQTK 288 sp|Q7Z3K3|POGZ_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.8386.11 116.5835 2 1596.778847 1595.779115 K L 450 465 PSM LASGVEGSDIPDDGK 289 sp|O95747|OXSR1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.8372.11 116.1988 2 1459.682647 1458.683818 K L 503 518 PSM HLQLAIRGDEELDSLIK 290 sp|P0C0S5|H2AZ_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.2174.2 15.60273 4 1949.0549 1949.0582 R A 86 103 PSM GLDVDSLVIEHIQVNK 291 sp|P18621-3|RL17_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.1657.3 11.46945 3 1777.9546 1777.9574 K A 106 122 PSM SQRPEESEPLEK 292 sp|Q5TFE4-2|NT5D1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.6315.7 60.58792 3 1427.6899 1427.6892 R K 295 307 PSM FGGSGSQVDSAR 293 sp|Q13200|PSMD2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.6409.10 63.1171 2 1166.5326 1166.5316 R M 358 370 PSM RSELSQDAEPAGSQETK 294 sp|Q9BVJ6-3|UT14A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.6399.9 62.84573 3 1831.8496 1831.8548 K D 381 398 PSM GHLENNPALEK 295 sp|P05388-2|RLA0_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.6471.11 64.78087 2 1220.6134 1220.6149 R L 67 78 PSM VSQGSKDPAEGDGAQPEETPR 296 sp|Q14697|GANAB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.6391.10 62.63842 3 2153.9842 2153.9825 R D 186 207 PSM TDNAGDQHGGGGGGGGGAGAAGGGGGGENYDDPHK 297 sp|P14866|HNRPL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.6173.11 56.66745 4 2980.2001 2980.1953 K T 63 98 PSM GAFGKPQGTVAR 298 sp|P27635|RL10_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.6535.5 66.52143 3 1187.6398 1187.6411 R V 117 129 PSM HLIPAANTGESK 299 sp|P62258|1433E_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.6666.3 70.1006 3 1236.6457 1236.6462 K V 107 119 PSM GDVTAEEAAGASPAK 300 sp|P49006|MRP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.6897.11 76.40805 2 1372.6476 1372.6470 R A 11 26 PSM FDDGAGGDNEVQR 301 sp|P35998|PRS7_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.6853.11 75.2133 2 1378.5740 1378.5750 R T 285 298 PSM SGSMDPSGAHPSVR 302 sp|Q07666|KHDR1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.6564.5 67.318 3 1383.6208 1383.6201 R Q 18 32 PSM AAEEAPEEAPEDAAR 303 sp|Q9H9Z2|LN28A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.7037.8 80.14159 3 1554.6823 1554.6797 K A 16 31 PSM APKPDGPGGGPGGSHMGGNYGDDR 304 sp|P35637-2|FUS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.7133.8 82.73143 4 2251.9693 2251.9665 K R 448 472 PSM YLAEVAAGDDKK 305 sp|P63104|1433Z_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.7094.10 81.68324 2 1278.6456 1278.6456 R G 128 140 PSM AAFTECCQAADK 306 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 6-UNIMOD:4,7-UNIMOD:4 ms_run[1]:scan=1.1.7072.7 81.08365 3 1370.5588 1370.5595 K A 187 199 PSM KGTVEGFEPADNK 307 sp|P37108|SRP14_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.7261.6 86.17615 3 1390.6711 1390.6729 K C 43 56 PSM EESGVSVSNSQPTNESHSIK 308 sp|Q99808|S29A1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.7100.9 81.84505 3 2114.9752 2114.9716 K A 264 284 PSM LGDQGPPEEAEDR 309 sp|O00592-2|PODXL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.6922.11 77.05662 2 1411.6208 1411.6215 K F 413 426 PSM HEQNIDCGGGYVK 310 sp|P27797|CALR_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 7-UNIMOD:4 ms_run[1]:scan=1.1.6984.7 78.7243 3 1475.6437 1475.6463 K L 99 112 PSM KGDSNANSDVCAAALR 311 sp|Q8IZL8|PELP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 11-UNIMOD:4 ms_run[1]:scan=1.1.7291.9 87.00705 3 1647.7615 1647.7635 R G 512 528 PSM QAASSLQQASLK 312 sp|P38646|GRP75_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.7397.8 89.83252 2 1230.6562 1230.6568 R L 635 647 PSM GNLGAGNGNLQGPR 313 sp|P43243|MATR3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.7351.10 88.63125 2 1323.6662 1323.6644 R H 374 388 PSM YICENQDSISSK 314 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 3-UNIMOD:4 ms_run[1]:scan=1.1.7331.11 88.1019 2 1442.6380 1442.6347 K L 287 299 PSM DPSASPGDAGEQAIR 315 sp|P18206|VINC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.7618.11 95.75708 2 1469.6726 1469.6746 R Q 286 301 PSM SVTEQGAELSNEER 316 sp|P63104|1433Z_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.7675.11 97.31562 2 1547.7064 1547.7063 K N 28 42 PSM NQQITHANNTVSNFK 317 sp|Q92598-4|HS105_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.7511.10 92.85101 3 1714.8346 1714.8387 K R 56 71 PSM LREDENAEPVGTTYQK 318 sp|Q16643-3|DREB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.7346.11 88.50032 2 1848.8888 1848.8853 R T 150 166 PSM QSSGPGASSGTSGDHGELVVR 319 sp|P29692-3|EF1D_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.7457.11 91.38406 3 1983.9217 1983.9246 R I 39 60 PSM APLKPYPVSPSDK 320 sp|P41252|SYIC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.7852.7 102.0976 3 1397.7508 1397.7554 K V 1039 1052 PSM AGGAAVVITEPEHTK 321 sp|Q9P258|RCC2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.7719.9 98.51085 3 1478.7700 1478.7729 K E 78 93 PSM SQAPGQPGASQWGSR 322 sp|Q96EP5-2|DAZP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.7790.9 100.4132 3 1512.7039 1512.7070 K V 195 210 PSM RSGVAYIAAPSGSAADK 323 sp|P31939-2|PUR9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.7995.7 106.0146 3 1619.8252 1619.8267 K V 552 569 PSM SGVISGGASDLK 324 sp|Q14683|SMC1A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.7746.9 99.24925 2 1089.5648 1089.5666 K A 649 661 PSM AHNNELEPTPGNTLR 325 sp|P24928|RPB1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.7941.10 104.5443 3 1661.8099 1661.8121 K Q 720 735 PSM TPAQYDASELK 326 sp|P07355-2|ANXA2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.8063.11 107.8582 2 1221.5868 1221.5877 K A 123 134 PSM TNLDESDVQPVK 327 sp|Q9Y3I0|RTCB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.8078.10 108.2414 2 1343.6546 1343.6569 R E 129 141 PSM QSSYSQQPYNNQGQQQNMESSGSQGGR 328 sp|Q92804-2|RBP56_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.7723.11 98.62321 4 2974.2505 2974.2496 K A 72 99 PSM EELQANGSAPAADKEEPAAAGSGAASPSAAEK 329 sp|P29966|MARCS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.8001.11 106.1846 4 2981.3865 2981.3849 K G 56 88 PSM QEYDESGPSIVHR 330 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.8110.5 109.0702 3 1515.6922 1515.6954 K K 360 373 PSM EYSSELNAPSQESDSHPR 331 sp|P49756|RBM25_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.7772.10 99.94122 3 2031.8713 2031.8770 R K 217 235 PSM TGTITTFEHAHNMR 332 sp|P13639|EF2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.8499.4 119.6361 4 1614.7505 1614.7573 K V 482 496 PSM KPLLESGTLGTK 333 sp|P22314|UBA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.8446.3 118.1861 3 1242.7138 1242.7183 R G 593 605 PSM YELISETGGSHDK 334 sp|Q12906-7|ILF3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.8149.8 110.1376 3 1434.6616 1434.6627 K R 545 558 PSM SAAMLGNSEDHTALSR 335 sp|O60749-2|SNX2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.8370.7 116.1376 3 1658.7685 1658.7682 K A 230 246 PSM HLCQQLQAEQAAAEK 336 sp|Q14980|NUMA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 3-UNIMOD:4 ms_run[1]:scan=1.1.8238.9 112.5601 3 1723.8301 1723.8311 K R 1365 1380 PSM DVACGANHTLVLDSQKR 337 sp|Q9P258|RCC2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 4-UNIMOD:4 ms_run[1]:scan=1.1.8402.11 117.0125 3 1882.9231 1882.9319 R V 334 351 PSM SSLEDGCLSCGR 338 sp|Q9UBC3-8|DNM3B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 7-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.8120.9 109.3489 2 1339.5488 1339.5497 K K 367 379 PSM CTGGEVGATSALAPK 339 sp|P30050-2|RL12_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 1-UNIMOD:4 ms_run[1]:scan=1.1.8130.11 109.6248 2 1417.6852 1417.6871 R I 17 32 PSM LTRDETNYGIPQR 340 sp|P63244|RACK1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.8393.11 116.774 2 1561.7846 1561.7849 K A 45 58 PSM TIAQGNLSNTDVQAAK 341 sp|P22695|QCR2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.8298.11 114.1932 2 1629.8314 1629.8322 K N 360 376 PSM TPDTSTYCYETAEK 342 sp|P46821|MAP1B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 8-UNIMOD:4 ms_run[1]:scan=1.1.8332.11 115.1107 2 1664.6872 1664.6876 R I 2034 2048 PSM VVQVSAGDSHTAALTDDGR 343 sp|P18754-2|RCC1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.8444.11 118.1448 3 1897.9084 1897.9130 K V 152 171 PSM SSGSPYGGGYGSGGGSGGYGSR 344 sp|P51991|ROA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.8171.11 110.7415 2 1909.7860 1909.7827 R R 355 377 PSM IDDIADGAVKPPPNK 345 sp|Q7Z4V5-3|HDGR2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.8435.7 117.8933 3 1548.8098 1548.8148 R Y 25 40 PSM KQPPVSPGTALVGSQK 346 sp|P17096|HMGA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.7953.5 104.8647 4 1592.8849 1592.8886 R E 31 47 PSM KPALQSSVVATSK 347 sp|Q9H307|PININ_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 29 ms_run[1]:scan=1.1.6732.4 71.91267 3 1314.7513 1314.7507 K E 109 122 PSM KHEAFESDLAAHQDR 348 sp|P12814|ACTN1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.7361.8 88.89339 4 1753.813694 1752.817960 K V 436 451 PSM PGNQNTQVTEAWNK 349 sp|Q9UQ80|PA2G4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.8509.10 119.9193 2 1586.749047 1585.748484 K V 159 173 PSM GSVSNQQFAGGCAK 350 sp|Q9H9Z2|LN28A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 29 1-UNIMOD:1,12-UNIMOD:4 ms_run[1]:scan=1.1.8088.11 108.5018 2 1451.6443 1451.6458 M A 2 16 PSM SETAPAETATPAPVEK 351 sp|P16401|H15_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 29 1-UNIMOD:1 ms_run[1]:scan=1.1.8304.10 114.3521 3 1639.7933 1639.7936 M S 2 18 PSM AAADGGGPGGASVGTEEDGGGVGHR 352 sp|A6NHR9|SMHD1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 29 1-UNIMOD:1 ms_run[1]:scan=1.1.8201.9 111.5544 3 2178.9515 2178.9521 M T 2 27 PSM GRDVIAQSQSGTGK 353 sp|P38919|IF4A3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.6070.11 53.8773 2 1402.7144 1402.7165 K T 75 89 PSM LFIGGLSFETTEESLR 354 sp|P22626-2|ROA2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.1641.10 11.09162 2 1797.9150 1797.9149 K N 11 27 PSM RAPSSGDDQSSSSTQPPR 355 sp|Q9BXF3|CECR2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.5845.6 47.74007 3 1858.8433 1858.8405 R E 602 620 PSM SDGAPASDSKPGSSEAAPSSK 356 sp|P80723|BASP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.5922.9 49.81445 3 1931.8735 1931.8708 K E 164 185 PSM LLQDSVDFSLADAINTEFK 357 sp|P08670|VIME_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.1641.5 11.08328 3 2125.0540 2125.0579 R N 79 98 PSM QALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQK 358 sp|P14866|HNRPL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 13-UNIMOD:4 ms_run[1]:scan=1.1.1667.2 11.6943 5 4387.0696 4387.0855 R I 139 179 PSM DRDYSDHPSGGSYR 359 sp|P38159-2|RBMX_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.6357.5 61.72507 4 1610.6741 1610.6710 R D 256 270 PSM DRDYSDHPSGGSYR 360 sp|P38159-2|RBMX_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.6379.3 62.31244 4 1610.6741 1610.6710 R D 256 270 PSM ATCAPQHGAPGPGPADASK 361 sp|P21333-2|FLNA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 3-UNIMOD:4 ms_run[1]:scan=1.1.6144.7 55.86217 4 1788.8221 1788.8213 K V 2533 2552 PSM SGGGGGGGGSSWGGR 362 sp|Q13151|ROA0_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.6332.10 61.05225 2 1191.5018 1191.5018 K S 270 285 PSM DSYVGDEAQSK 363 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.6472.10 64.80521 2 1197.5162 1197.5150 K R 51 62 PSM KPNEGADGQWK 364 sp|Q8NC51-3|PAIRB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.6258.11 59.02234 2 1228.5838 1228.5836 R K 295 306 PSM PGSDTIKPDVQK 365 sp|Q06830|PRDX1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.6411.6 63.165 3 1283.6743 1283.6721 K S 179 191 PSM QSNASSDVEVEEK 366 sp|O75475|PSIP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.6425.11 63.54823 2 1420.6334 1420.6318 K E 101 114 PSM EDSQRPGAHLTVK 367 sp|P09651-2|ROA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.6382.3 62.39143 4 1436.7377 1436.7372 R K 93 106 PSM IEDVGSDEEDDSGK 368 sp|P08238|HS90B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.6507.11 65.76131 2 1493.6018 1493.6005 K D 250 264 PSM TCVADESAENCDK 369 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 2-UNIMOD:4,11-UNIMOD:4 ms_run[1]:scan=1.1.6148.11 55.97603 2 1497.5738 1497.5712 K S 76 89 PSM EDSVKPGAHLTVK 370 sp|P51991|ROA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.6714.4 71.41801 4 1379.7417 1379.7409 R K 114 127 PSM GDVTAEEAAGASPAK 371 sp|P49006|MRP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.6913.5 76.81197 3 1372.6447 1372.6470 R A 11 26 PSM AAAAAAALQAK 372 sp|P36578|RL4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.6644.9 69.50983 2 955.5450 955.5450 K S 354 365 PSM GGVDHAAAFGR 373 sp|Q9HC38-2|GLOD4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.6898.2 76.41898 3 1056.5092 1056.5101 K I 191 202 PSM KIIEDCSNSEETVK 374 sp|Q93008-1|USP9X_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 6-UNIMOD:4 ms_run[1]:scan=1.1.6731.9 71.89333 3 1650.7753 1650.7770 K L 2288 2302 PSM GEAAAERPGEAAVASSPSK 375 sp|P29966|MARCS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.6523.10 66.2 3 1783.8709 1783.8700 K A 12 31 PSM TPSPKEEDEEPESPPEK 376 sp|Q9H1E3-2|NUCKS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.6572.10 67.54565 3 1923.8572 1923.8585 K K 162 179 PSM IETNENNLESAK 377 sp|Q07065|CKAP4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.6910.11 76.74393 2 1360.6454 1360.6470 K G 567 579 PSM EDSVKPGAHLTVK 378 sp|P51991|ROA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.6695.11 70.90885 2 1379.7408 1379.7409 R K 114 127 PSM NSLQEQQEEEEEARK 379 sp|P35580-3|MYH10_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.6792.11 73.5685 3 1845.8350 1845.8340 K N 1367 1382 PSM KGESQTDIEITR 380 sp|P49368|TCPG_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7279.8 86.67558 3 1375.6927 1375.6943 K E 249 261 PSM AQAAAPASVPAQAPK 381 sp|P47914|RL29_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7084.9 81.40948 3 1376.7403 1376.7412 K R 135 150 PSM HSHTNLSISTGVTK 382 sp|Q5T7N2|LITD1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7097.6 81.75832 3 1480.7620 1480.7634 K L 572 586 PSM HSGPNSADSANDGFVR 383 sp|P52597|HNRPF_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7006.11 79.3274 3 1629.7120 1629.7132 K L 99 115 PSM SEETLDEGPPK 384 sp|Q00688|FKBP3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7021.9 79.71783 2 1200.5522 1200.5510 K Y 100 111 PSM VAEDEAEAAAAAK 385 sp|P08195-2|4F2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7048.10 80.4437 2 1244.5882 1244.5884 K F 47 60 PSM NCTIVSPDAGGAK 386 sp|P60891|PRPS1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 2-UNIMOD:4 ms_run[1]:scan=1.1.7131.10 82.681 2 1288.6104 1288.6082 R R 164 177 PSM YICENQDSISSK 387 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 3-UNIMOD:4 ms_run[1]:scan=1.1.7293.10 87.06335 2 1442.6380 1442.6347 K L 287 299 PSM HEQNIDCGGGYVK 388 sp|P27797|CALR_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 7-UNIMOD:4 ms_run[1]:scan=1.1.6995.8 79.02715 3 1475.6437 1475.6463 K L 99 112 PSM KYEEIDNAPEER 389 sp|P49411|EFTU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7155.11 83.33604 2 1491.6844 1491.6841 K A 91 103 PSM TEGTQEADQYADEK 390 sp|Q02952-2|AKA12_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7100.11 81.84838 2 1583.6662 1583.6587 K T 1163 1177 PSM VASLEESEGNKQDLK 391 sp|Q07065|CKAP4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7129.11 82.62922 3 1645.8163 1645.8159 K A 273 288 PSM IEYNDQNDGSCDVK 392 sp|O75369-2|FLNB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 11-UNIMOD:4 ms_run[1]:scan=1.1.7090.11 81.57623 2 1655.6750 1655.6733 K Y 594 608 PSM RLQGQLEQGDDTAAER 393 sp|Q8NE71-2|ABCF1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7062.11 80.82484 3 1785.8620 1785.8605 R L 358 374 PSM SEDEAGCSSVDEESYK 394 sp|Q7L4I2-2|RSRC2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 7-UNIMOD:4 ms_run[1]:scan=1.1.7312.11 87.5843 2 1790.6840 1790.6788 K T 328 344 PSM AADPPAENSSAPEAEQGGAE 395 sp|P67809|YBOX1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.6930.11 77.26873 3 1896.7975 1896.7973 K - 305 325 PSM VAVAAASKPHVEIR 396 sp|P29762|RABP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7482.3 92.0487 4 1446.8257 1446.8307 K Q 32 46 PSM FATHGAALTVK 397 sp|Q8WXF1|PSPC1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7661.3 96.91762 3 1114.6108 1114.6135 R N 151 162 PSM LHNAIEGGTQLSR 398 sp|O60832|DKC1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7511.6 92.84435 3 1394.7229 1394.7266 R A 159 172 PSM LLETTDRPDGHQNNLR 399 sp|Q14974|IMB1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7460.6 91.45578 4 1877.9321 1877.9344 K S 510 526 PSM RGPQLVCTGSDDGTVK 400 sp|Q96DI7-2|SNR40_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 7-UNIMOD:4 ms_run[1]:scan=1.1.7636.10 96.24718 3 1688.8120 1688.8152 R L 162 178 PSM NSDEADLVPAK 401 sp|P83916|CBX1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7691.9 97.74789 2 1157.5562 1157.5564 K E 140 151 PSM NSDEADLVPAK 402 sp|P83916|CBX1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7653.10 96.7108 2 1157.5562 1157.5564 K E 140 151 PSM TNEAQAIETAR 403 sp|Q5JXB2|UE2NL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7478.9 91.94935 2 1202.5852 1202.5891 K A 132 143 PSM SDAGLESDTAMK 404 sp|Q9NR30|DDX21_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7427.7 90.60342 2 1223.5312 1223.5340 R K 7 19 PSM VYVGNLGNNGNK 405 sp|P84103-2|SRSF3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7679.11 97.42515 2 1247.6202 1247.6258 K T 12 24 PSM ENSGAAEKPVTIHATPEGTSEACR 406 sp|Q9Y6M1-1|IF2B2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 23-UNIMOD:4 ms_run[1]:scan=1.1.7559.9 94.15797 4 2511.1621 2511.1660 K M 233 257 PSM FGQGGAGPVGGQGPR 407 sp|P23246|SFPQ_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7460.11 91.46412 2 1340.6586 1340.6586 R G 667 682 PSM ENEVEEVKEEGPK 408 sp|Q8NC51-3|PAIRB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7708.8 98.20856 3 1514.7094 1514.7100 K E 259 272 PSM GEPAAAAAPEAGASPVEK 409 sp|P29966|MARCS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7543.11 93.72359 2 1621.7928 1621.7947 K E 88 106 PSM NEEPSEEEIDAPKPK 410 sp|Q9NR30|DDX21_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7591.10 95.03533 3 1710.7921 1710.7948 K K 117 132 PSM LIQSHPESAEDLQEK 411 sp|Q13813|SPTN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7661.11 96.93095 2 1722.8426 1722.8424 R C 1299 1314 PSM SCVEEPEPEPEAAEGDGDKK 412 sp|P51858|HDGF_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 2-UNIMOD:4 ms_run[1]:scan=1.1.7404.11 90.01147 3 2171.9158 2171.9164 K G 107 127 PSM ERHPGSFDVVHVK 413 sp|P62701|RS4X_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7999.3 106.1169 4 1505.7725 1505.7739 R D 199 212 PSM ASIHEAWTDGK 414 sp|O43707|ACTN4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7981.5 105.6306 3 1213.5700 1213.5727 K E 422 433 PSM DQTPDENDQVIVK 415 sp|Q9NZI8|IF2B1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.8034.7 107.0799 3 1499.7073 1499.7104 R I 526 539 PSM ENEVEEVKEEGPK 416 sp|Q8NC51-3|PAIRB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7727.8 98.72762 3 1514.7094 1514.7100 K E 259 272 PSM IAECSSQLAEEEEK 417 sp|P35580-3|MYH10_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 4-UNIMOD:4 ms_run[1]:scan=1.1.7919.9 103.9402 3 1621.7095 1621.7141 R A 1029 1043 PSM IVGPSGAAVPCK 418 sp|P21333-2|FLNA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 11-UNIMOD:4 ms_run[1]:scan=1.1.7746.10 99.25092 2 1154.6086 1154.6118 K V 1008 1020 PSM HHAAYVNNLNVTEEK 419 sp|P04179-2|SODM_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7929.11 104.2175 3 1737.8299 1737.8434 K Y 54 69 PSM TGAEGAVLDEAK 420 sp|P33176|KINH_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.8013.8 106.5074 2 1159.5700 1159.5721 K N 241 253 PSM IDEPLEGSEDR 421 sp|P61978|HNRPK_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7950.11 104.7923 2 1258.5668 1258.5677 K I 423 434 PSM IDEPLEGSEDR 422 sp|P61978|HNRPK_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7969.11 105.3137 2 1258.5668 1258.5677 K I 423 434 PSM ADEASELACPTPK 423 sp|P49327|FAS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 9-UNIMOD:4 ms_run[1]:scan=1.1.7970.10 105.3393 2 1387.6274 1387.6289 K E 2194 2207 PSM CVANNQVETLEK 424 sp|P42704|LPPRC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 1-UNIMOD:4 ms_run[1]:scan=1.1.7946.10 104.6809 2 1403.6720 1403.6715 R L 930 942 PSM DGMDNQGGYGSVGR 425 sp|P31942-2|HNRH3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7730.11 98.81485 2 1411.5770 1411.5787 R M 273 287 PSM GDATVSYEDPPTAK 426 sp|Q01844-2|EWS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7883.11 102.9561 2 1449.6594 1449.6624 K A 338 352 PSM KPPLLNNADSVQAK 427 sp|P09874|PARP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7795.6 100.5436 3 1493.8159 1493.8202 K V 748 762 PSM TPEAVESPQEASGVR 428 sp|Q7L190|DPPA4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7841.10 101.8017 2 1555.7450 1555.7478 R W 215 230 PSM VDNDENEHQLSLR 429 sp|P06748-2|NPM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7786.9 100.3053 3 1567.7194 1567.7226 K T 33 46 PSM VDNDENEHQLSLR 430 sp|P06748-2|NPM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7766.8 99.78132 3 1567.7200 1567.7226 K T 33 46 PSM RSGVAYIAAPSGSAADK 431 sp|P31939-2|PUR9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.8011.6 106.4491 3 1619.8252 1619.8267 K V 552 569 PSM IAECSSQLAEEEEK 432 sp|P35580-3|MYH10_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 4-UNIMOD:4 ms_run[1]:scan=1.1.7916.11 103.8611 2 1621.7142 1621.7141 R A 1029 1043 PSM IAECSSQLAEEEEK 433 sp|P35580-3|MYH10_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 4-UNIMOD:4 ms_run[1]:scan=1.1.7935.11 104.3819 2 1621.7142 1621.7141 R A 1029 1043 PSM SCSGVEFSTSGSSNTDTGK 434 sp|P45880-1|VDAC2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 2-UNIMOD:4 ms_run[1]:scan=1.1.7828.11 101.4491 2 1906.7856 1906.7851 K V 61 80 PSM RAVAGDASESALLK 435 sp|P05023-4|AT1A1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.8164.7 110.5437 3 1386.7438 1386.7467 K C 445 459 PSM SYCAEIAHNVSSK 436 sp|P62910|RL32_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 3-UNIMOD:4 ms_run[1]:scan=1.1.8404.8 117.0602 3 1464.6622 1464.6667 K N 94 107 PSM SYCAEIAHNVSSK 437 sp|P62910|RL32_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 3-UNIMOD:4 ms_run[1]:scan=1.1.8385.10 116.5544 3 1464.6622 1464.6667 K N 94 107 PSM KGPSGYGFNLHSDK 438 sp|O14745|NHRF1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.8502.6 119.7212 3 1505.7211 1505.7263 K S 159 173 PSM ELRDEEQTAESIK 439 sp|Q14566|MCM6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.8193.8 111.3367 3 1546.7437 1546.7474 K N 314 327 PSM RPAEDMEEEQAFK 440 sp|P61978|HNRPK_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.8338.8 115.267 3 1578.6982 1578.6984 K R 22 35 PSM LGEVVNTHGPVEPDK 441 sp|P30419|NMT1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.8260.8 113.162 3 1589.8030 1589.8049 K D 128 143 PSM RAAAEVNQDYGLDPK 442 sp|P07954-2|FUMH_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.8320.7 114.7789 3 1645.8031 1645.8060 K I 58 73 PSM GAEAANVTGPGGVPVQGSK 443 sp|P67809|YBOX1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.8132.10 109.6779 3 1694.8564 1694.8588 K Y 119 138 PSM KTCTTVAFTQVNSEDK 444 sp|P62424|RL7A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 3-UNIMOD:4 ms_run[1]:scan=1.1.8406.10 117.1166 3 1827.8698 1827.8673 R G 197 213 PSM HIYYITGETK 445 sp|P07900-2|HS90A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.8431.10 117.7898 2 1223.6152 1223.6186 K D 612 622 PSM SVSLTGAPESVQK 446 sp|Q92945|FUBP2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.8459.10 118.5542 2 1301.6810 1301.6827 R A 191 204 PSM NASDMPETITSR 447 sp|Q8TCT9-2|HM13_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.8439.10 118.0069 2 1320.5970 1320.5980 K D 62 74 PSM VSEFNVSSEGSGEK 448 sp|Q9BVJ6-3|UT14A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.8133.11 109.7068 2 1454.6512 1454.6525 K L 71 85 PSM APVPGTPDSLSSGSSR 449 sp|Q9UJZ1-2|STML2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.8318.11 114.7316 2 1513.7364 1513.7373 K D 277 293 PSM AREQAEAEVASLNR 450 sp|P06753-2|TPM3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.8188.11 111.2055 2 1542.7744 1542.7750 R R 41 55 PSM DINAYNCEEPTEK 451 sp|P30041|PRDX6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 7-UNIMOD:4 ms_run[1]:scan=1.1.8153.11 110.2514 2 1581.6624 1581.6617 K L 85 98 PSM EQIVPKPEEEVAQK 452 sp|P18621-3|RL17_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.8152.9 110.2209 3 1622.8507 1622.8515 K K 154 168 PSM ASGNYATVISHNPETK 453 sp|P62917|RL8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.8391.8 116.7149 3 1687.8148 1687.8165 R K 129 145 PSM LPNQTHPDVPVGDESQAR 454 sp|Q9NP81|SYSM_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.8301.11 114.2735 3 1958.9428 1958.9446 K V 170 188 PSM TATDEAYKDPSNLQGK 455 sp|Q13813|SPTN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7510.7 92.81876 3 1736.8159 1736.8217 K V 595 611 PSM FQETSDEFEAARK 456 sp|Q14683|SMC1A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.8326.10 114.9464 3 1556.7295 1556.7107 K R 1038 1051 PSM YELISETGGSHDK 457 sp|Q12906-7|ILF3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.8130.9 109.6215 3 1434.6616 1434.6627 K R 545 558 PSM KATDAEADVASLNR 458 sp|P09493-3|TPM1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.8420.7 117.4881 3 1459.7263 1459.7267 K R 77 91 PSM VDDSSEDKTEFTVK 459 sp|P49588|SYAC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7949.10 104.7632 3 1598.7280 1598.7312 K N 551 565 PSM LREDENAEPVGTTYQK 460 sp|Q16643-3|DREB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7350.11 88.60633 3 1848.8863 1848.8853 R T 150 166 PSM RNVESGEEELASK 461 sp|Q96HS1-2|PGAM5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.6737.9 72.05895 3 1446.6940 1446.6950 K L 76 89 PSM VTIAQGGVLPNIQAVLLPK 462 sp|P0C0S8|H2A1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.1659.4 11.5123 3 1930.1578 1930.1615 R K 101 120 PSM APAPKPELIAAEK 463 sp|Q9Y5K6|CD2AP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7988.5 105.8212 3 1333.7563 1333.7605 K K 347 360 PSM RMGESDDSILR 464 sp|P63220|RS21_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 ms_run[1]:scan=1.1.7998.4 106.0913 3 1277.6011 1277.6034 R L 61 72 PSM ALVDGPCTQVR 465 sp|P50914|RL14_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 7-UNIMOD:4 ms_run[1]:scan=1.1.8370.10 116.1426 2 1214.6074 1214.6078 R R 36 47 PSM HLSSCAAPAPLTSAER 466 sp|Q6IBS0|TWF2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 28 5-UNIMOD:4 ms_run[1]:scan=1.1.8040.10 107.2473 3 1666.8055 1666.8097 K E 137 153 PSM AEPPKAPEQEQAAPGPAAGGEAPK 467 sp|P80723|BASP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.7373.11 89.2182 3 2298.133271 2297.128790 K A 98 122 PSM VQIAANEETQEREEQMK 468 sp|P49321|NASP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.8065.11 107.9096 3 2032.950971 2031.953133 K E 456 473 PSM SETAPAAPAAAPPAEK 469 sp|P16403|H12_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 28 1-UNIMOD:1 ms_run[1]:scan=1.1.8013.11 106.5124 2 1519.7517 1519.7513 M A 2 18 PSM AAAAAGTATSQR 470 sp|Q9Y2Z0|SGT1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 28 1-UNIMOD:1 ms_run[1]:scan=1.1.7010.8 79.42773 2 1116.5509 1116.5518 M F 2 14 PSM QVHPDTGISSK 471 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 28 1-UNIMOD:28 ms_run[1]:scan=1.1.6950.10 77.80683 2 1150.5623 1150.5613 K A 48 59 PSM VCDSCYDSIKDEDR 472 sp|Q8IWB7|WDFY1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 28 2-UNIMOD:4,5-UNIMOD:4 ms_run[1]:scan=1.1.7920.9 103.9676 3 1761.699371 1760.698165 R T 343 357 PSM AATASAGAGGIDGKPR 473 sp|Q02978|M2OM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 28 1-UNIMOD:1 ms_run[1]:scan=1.1.7376.11 89.29655 2 1440.7313 1440.7316 M T 2 18 PSM ITDSAGHILYSK 474 sp|P49755|TMEDA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.8252.11 112.9479 2 1302.657447 1303.677216 K E 76 88 PSM YHTVNGHNCEVR 475 sp|P09651-2|ROA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 9-UNIMOD:4 ms_run[1]:scan=1.1.6066.3 53.75493 4 1484.6557 1484.6579 K K 167 179 PSM GPHHLDNSSPGPGSEAR 476 sp|Q8WWM7-3|ATX2L_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.6039.8 53.022 4 1713.7781 1713.7819 R G 383 400 PSM HLQLAIRGDEELDSLIK 477 sp|P0C0S5|H2AZ_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.2324.2 16.60927 4 1949.0557 1949.0582 R A 86 103 PSM QVHPDTGISSK 478 sp|Q99880|H2B1L_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.6089.8 54.37695 2 1167.5880 1167.5884 K A 48 59 PSM VHGPGIQSGTTNKPNK 479 sp|P21333-2|FLNA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.5976.2 51.28598 4 1633.8557 1633.8536 R F 1360 1376 PSM TLASSSSSSSSSSGAETPK 480 sp|Q9Y467|SALL2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.6057.11 53.52268 2 1756.8010 1756.7963 K Q 253 272 PSM HLQLAIRGDEELDSLIK 481 sp|P0C0S5|H2AZ_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.2399.2 17.1097 4 1949.0557 1949.0582 R A 86 103 PSM KVEEEEDESALK 482 sp|Q14566|MCM6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.6514.8 65.94915 3 1404.6607 1404.6620 R R 733 745 PSM ITAAQHSVTGSAVSK 483 sp|Q13492-2|PICAL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.6300.10 60.18172 3 1455.7660 1455.7682 R T 10 25 PSM HECQANGPEDLNR 484 sp|P60981-2|DEST_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 3-UNIMOD:4 ms_run[1]:scan=1.1.6362.8 61.86768 3 1538.6560 1538.6532 K A 116 129 PSM LGGSQEDQIK 485 sp|P37837|TALDO_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.6448.10 64.16572 2 1073.5360 1073.5353 K N 72 82 PSM SVQAGNPGGPGPGGR 486 sp|Q96AE4-2|FUBP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.6167.11 56.50182 2 1306.6390 1306.6378 R G 344 359 PSM RDHALLEEQSK 487 sp|O43707|ACTN4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.6316.8 60.61725 3 1324.6759 1324.6735 K Q 633 644 PSM TVEAEAAHGTVTR 488 sp|O75874|IDHC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.6361.11 61.84497 2 1340.6678 1340.6684 K H 302 315 PSM PGPTPSGTNVGSSGR 489 sp|P60468|SC61B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.6310.11 60.45657 2 1369.6600 1369.6586 M S 2 17 PSM NSRPEANEALER 490 sp|Q9Y696|CLIC4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.6423.8 63.49128 3 1384.6690 1384.6694 K G 131 143 PSM HSEAATAQREEWK 491 sp|Q14103-3|HNRPD_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.6479.6 64.98624 3 1541.7205 1541.7222 R M 86 99 PSM EDIYSGGGGGGSR 492 sp|Q13151|ROA0_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.6556.3 67.09505 3 1210.5208 1210.5215 K S 177 190 PSM VSSDNVADLHEK 493 sp|P28074|PSB5_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.6822.5 74.37556 3 1312.6240 1312.6259 R Y 246 258 PSM VSSDNVADLHEK 494 sp|P28074|PSB5_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.6842.5 74.90347 3 1312.6240 1312.6259 R Y 246 258 PSM LKGELESSDQVR 495 sp|Q9P2E9|RRBP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.6780.8 73.23399 3 1359.6967 1359.6994 K E 1184 1196 PSM QVTQEEGQQLAR 496 sp|P62070-4|RRAS2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.6865.6 75.53381 3 1385.6881 1385.6899 R Q 142 154 PSM KIIEDQQESLNK 497 sp|P05455|LA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.6874.10 75.78747 3 1443.7546 1443.7569 K W 317 329 PSM MRPGVACSVSQAQK 498 sp|P32969|RL9_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 7-UNIMOD:4 ms_run[1]:scan=1.1.6668.11 70.16875 3 1517.7439 1517.7443 R D 128 142 PSM ERNTDQASMPENTVAQK 499 sp|P35580-3|MYH10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.6847.11 75.04951 3 1917.8827 1917.8850 K L 364 381 PSM QVTQEEGQQLAR 500 sp|P62070-4|RRAS2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.6857.10 75.32111 2 1385.6904 1385.6899 R Q 142 154 PSM LAVDEEENADNNTK 501 sp|P02786|TFR1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.6896.11 76.38212 2 1560.6874 1560.6903 K A 40 54 PSM AISVHSTPEGCSSACK 502 sp|Q9NZI8|IF2B1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 11-UNIMOD:4,15-UNIMOD:4 ms_run[1]:scan=1.1.6558.11 67.1634 3 1689.7429 1689.7451 K M 243 259 PSM TIEAEAAHGTVTR 503 sp|P48735|IDHP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.6964.5 78.17437 3 1354.6828 1354.6841 K H 341 354 PSM RQLEEAEEEATR 504 sp|P35580-3|MYH10_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.7068.7 80.97763 3 1459.6909 1459.6902 K A 1905 1917 PSM HQGVMVGMGQK 505 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 5-UNIMOD:35,8-UNIMOD:35 ms_run[1]:scan=1.1.6927.10 77.18715 2 1202.5516 1202.5536 R D 40 51 PSM DGEEAGAYDGPR 506 sp|P30101|PDIA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.7197.11 84.4419 2 1235.5046 1235.5054 R T 108 120 PSM HTVDDGLDIRK 507 sp|Q86VP6|CAND1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.7279.5 86.67059 3 1267.6486 1267.6521 K A 1073 1084 PSM EAMEDGEIDGNK 508 sp|P19338|NUCL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.7046.10 80.38915 2 1306.5342 1306.5347 K V 628 640 PSM CASQVGMTAPGTR 509 sp|Q99439|CNN2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 1-UNIMOD:4 ms_run[1]:scan=1.1.7127.11 82.57563 2 1334.6084 1334.6071 K R 215 228 PSM TPCNAGTFSQPEK 510 sp|O43684-2|BUB3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 3-UNIMOD:4 ms_run[1]:scan=1.1.7157.11 83.38885 2 1435.6422 1435.6402 R V 127 140 PSM YICENQDSISSK 511 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 3-UNIMOD:4 ms_run[1]:scan=1.1.7286.8 86.86837 3 1442.6362 1442.6347 K L 287 299 PSM YICENQDSISSK 512 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 3-UNIMOD:4 ms_run[1]:scan=1.1.7301.8 87.27885 3 1442.6365 1442.6347 K L 287 299 PSM EATNPPVIQEEKPK 513 sp|P30101|PDIA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.7210.8 84.79038 3 1578.8248 1578.8253 R K 483 497 PSM TKFETEQALR 514 sp|P08727|K1C19_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.7409.4 90.12935 3 1221.6376 1221.6353 R L 167 177 PSM SNVSDAVAQSTR 515 sp|P60174|TPIS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.7350.5 88.59635 3 1233.5929 1233.5949 K I 232 244 PSM KHEAFESDLAAHQDR 516 sp|O43707|ACTN4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.7342.8 88.38937 4 1752.8181 1752.8179 K V 455 470 PSM LLETTDRPDGHQNNLR 517 sp|Q14974|IMB1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.7439.9 90.91222 4 1877.9321 1877.9344 K S 510 526 PSM AHQITDESLESTR 518 sp|O00161-2|SNP23_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.7635.7 96.21481 3 1485.7006 1485.7059 R R 13 26 PSM TPASPVVHIR 519 sp|P14866|HNRPL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.7582.10 94.7901 2 1075.6114 1075.6138 K G 98 108 PSM HTGPNSPDTANDGFVR 520 sp|P31943|HNRH1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.7444.7 91.03795 3 1683.7579 1683.7601 K L 99 115 PSM VDATAETDLAK 521 sp|P13667|PDIA4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.7554.9 94.02084 2 1132.5588 1132.5612 K R 235 246 PSM NSDEADLVPAK 522 sp|P83916|CBX1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.7672.8 97.22812 2 1157.5562 1157.5564 K E 140 151 PSM TAIHEVMEQGR 523 sp|P25205-2|MCM3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.7602.5 95.32103 3 1269.6100 1269.6136 R V 465 476 PSM MDSTANEVEAVK 524 sp|P07237|PDIA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.7711.9 98.29214 2 1292.5904 1292.5918 K V 425 437 PSM EENAEQQALAAK 525 sp|Q9UQE7|SMC3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.7519.10 93.06865 2 1300.6240 1300.6259 R R 475 487 PSM NNASTDYDLSDK 526 sp|P39023|RL3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.7519.11 93.07032 2 1341.5662 1341.5684 K S 301 313 PSM DGMDNQGGYGSVGR 527 sp|P31942-2|HNRH3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.7711.11 98.29546 2 1411.5770 1411.5787 R M 273 287 PSM STSLETQDDDNIR 528 sp|Q6IA86-2|ELP2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.7552.11 93.9694 2 1492.6620 1492.6641 K L 216 229 PSM ILTTASSHEFEHTK 529 sp|Q16851|UGPA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.7501.11 92.5809 2 1599.7888 1599.7893 K K 39 53 PSM QHLENDPGSNEDTDIPK 530 sp|O43396|TXNL1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.7637.10 96.27455 3 1907.8459 1907.8497 K G 105 122 PSM ERHPGSFDVVHVK 531 sp|P62701|RS4X_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.8001.3 106.1713 4 1505.7725 1505.7739 R D 199 212 PSM KEELVAEQALK 532 sp|Q9Y6E2|BZW2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.7945.4 104.6435 3 1256.6962 1256.6976 K H 310 321 PSM ASHEEVEGLVEK 533 sp|Q08380|LG3BP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.7900.7 103.4161 3 1325.6443 1325.6463 R I 334 346 PSM NGQVIGIGAGQQSR 534 sp|P31939-2|PUR9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.8035.5 107.1035 3 1383.7195 1383.7219 K I 437 451 PSM VANVSAAEDSVSQR 535 sp|Q9NY93-2|DDX56_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.7931.4 104.2606 3 1431.6949 1431.6954 R A 115 129 PSM QGRPVVICDKEDTETIK 536 sp|Q06210|GFPT1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 8-UNIMOD:4 ms_run[1]:scan=1.1.7917.6 103.8802 4 1987.0013 1987.0044 R N 631 648 PSM VDNDENEHQLSLR 537 sp|P06748-2|NPM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.7805.7 100.817 3 1567.7194 1567.7226 K T 33 46 PSM SVEAAAELSAK 538 sp|P20962|PTMS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.7758.9 99.5749 2 1074.5522 1074.5557 K D 5 16 PSM LLLQVQHASK 539 sp|P12236|ADT3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.8086.10 108.4476 2 1135.6682 1135.6713 K Q 34 44 PSM FATHAAALSVR 540 sp|P23246|SFPQ_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.8042.2 107.2883 3 1142.6176 1142.6196 R N 366 377 PSM LNGGLGTSMGCK 541 sp|Q16851|UGPA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 11-UNIMOD:4 ms_run[1]:scan=1.1.7909.10 103.6678 2 1193.5510 1193.5533 K G 113 125 PSM LGSTEVASNVPK 542 sp|Q9Y5A9-2|YTHD2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.7837.11 101.6943 2 1200.6322 1200.6350 K V 144 156 PSM CVANNQVETLEK 543 sp|P42704|LPPRC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 1-UNIMOD:4 ms_run[1]:scan=1.1.7947.10 104.7083 2 1403.6720 1403.6715 R L 930 942 PSM VDNDENEHQLSLR 544 sp|P06748-2|NPM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.7747.8 99.27486 3 1567.7200 1567.7226 K T 33 46 PSM VDDSSEDKTEFTVK 545 sp|P49588|SYAC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.7935.10 104.3802 2 1598.7334 1598.7312 K N 551 565 PSM TSSGDASSLSIEETNK 546 sp|O43290|SNUT1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.8105.10 108.9435 2 1624.7466 1624.7428 K L 110 126 PSM KLDEAVAEAHLGK 547 sp|P23526-2|SAHH_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.8422.3 117.5354 4 1379.7369 1379.7408 K L 361 374 PSM RFASGGCDNLIK 548 sp|P55735-2|SEC13_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 7-UNIMOD:4 ms_run[1]:scan=1.1.8150.6 110.1616 3 1336.6519 1336.6558 K L 167 179 PSM TIQGHLQSENFK 549 sp|O15042-2|SR140_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.8158.6 110.3788 3 1400.7007 1400.7048 R Q 635 647 PSM DVACGANHTLVLDSQKR 550 sp|Q9P258|RCC2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 4-UNIMOD:4 ms_run[1]:scan=1.1.8414.5 117.3226 4 1882.9241 1882.9319 R V 334 351 PSM RQQEQQVPILEK 551 sp|P49327|FAS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.8426.4 117.6447 3 1494.8128 1494.8154 R F 1105 1117 PSM TDSLAHCISEDCR 552 sp|Q9Y530|OARD1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 7-UNIMOD:4,12-UNIMOD:4 ms_run[1]:scan=1.1.8438.5 117.9714 3 1562.6443 1562.6453 K M 27 40 PSM HQAFEAELHANADR 553 sp|Q13813|SPTN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.8182.10 111.04 3 1607.7436 1607.7440 K I 1592 1606 PSM IQALQQQADEAEDR 554 sp|P67936|TPM4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.8485.10 119.265 3 1613.7628 1613.7645 K A 14 28 PSM ALAAGGYDVEK 555 sp|P16401|H15_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.8153.7 110.2447 2 1092.5428 1092.5451 K N 68 79 PSM ALAAAGYDVEK 556 sp|P10412|H14_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.8410.8 117.2197 2 1106.5600 1106.5608 K N 65 76 PSM ALAAAGYDVEK 557 sp|P10412|H14_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.8429.9 117.7339 2 1106.5600 1106.5608 K N 65 76 PSM VYVGNLGTGAGK 558 sp|Q16629-4|SRSF7_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.8376.9 116.3055 2 1134.6032 1134.6033 K G 13 25 PSM FAAATGATPIAGR 559 sp|P08865|RSSA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.8373.9 116.223 2 1202.6394 1202.6408 K F 90 103 PSM ELAAQLNEEAK 560 sp|Q9Y5B9|SP16H_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.8230.10 112.3429 2 1214.6140 1214.6142 K R 480 491 PSM LNQDQLDAVSK 561 sp|Q14444-2|CAPR1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.8237.10 112.5343 2 1229.6240 1229.6252 R Y 88 99 PSM RPELLTHSTTEVTQPR 562 sp|P78347-2|GTF2I_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.8271.10 113.4643 3 1863.9772 1863.9803 K T 499 515 PSM HSEAFEALQQK 563 sp|Q07065|CKAP4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.8162.11 110.4959 2 1286.6228 1286.6255 R S 395 406 PSM SVSLTGAPESVQK 564 sp|Q92945|FUBP2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.8478.10 119.0745 2 1301.6810 1301.6827 R A 191 204 PSM VLEEANQAINPK 565 sp|Q92841-1|DDX17_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.8195.11 111.396 2 1324.6990 1324.6986 K L 457 469 PSM LEGEACGVYTPR 566 sp|P18065|IBP2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 6-UNIMOD:4 ms_run[1]:scan=1.1.8453.11 118.3912 2 1350.6220 1350.6238 R C 93 105 PSM LCTSVTESEVAR 567 sp|O75439|MPPB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 2-UNIMOD:4 ms_run[1]:scan=1.1.8282.11 113.7635 2 1350.6444 1350.6449 R A 388 400 PSM AAECNIVVTQPR 568 sp|Q08211|DHX9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 4-UNIMOD:4 ms_run[1]:scan=1.1.8217.9 111.9873 2 1356.6822 1356.6820 R R 435 447 PSM LLATEQEDAAVAK 569 sp|Q9P2E9|RRBP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.8165.11 110.5777 2 1357.7072 1357.7089 K S 708 721 PSM IQTQPGYANTLR 570 sp|Q00325-2|MPCP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.8494.10 119.5099 2 1360.7062 1360.7099 R D 189 201 PSM AQAELVGTADEATR 571 sp|P30049|ATPD_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.8262.11 113.2216 2 1430.6970 1430.7001 K A 137 151 PSM YEQGTGCWQGPNR 572 sp|P14314-2|GLU2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 7-UNIMOD:4 ms_run[1]:scan=1.1.8309.10 114.4868 2 1551.6528 1551.6525 K S 462 475 PSM EQIVPKPEEEVAQK 573 sp|P18621-3|RL17_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.8171.9 110.7382 3 1622.8507 1622.8515 K K 154 168 PSM TYDPSGDSTLPTCSK 574 sp|Q9Y2X3|NOP58_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 13-UNIMOD:4 ms_run[1]:scan=1.1.8381.11 116.4462 2 1627.7048 1627.7036 K K 427 442 PSM EVEEQHEVNEQLQAR 575 sp|Q9P2M7|CING_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.8153.9 110.248 3 1836.8596 1836.8602 R I 1128 1143 PSM CLDCQEHLCDNCVR 576 sp|Q2Q1W2|LIN41_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 1-UNIMOD:4,4-UNIMOD:4,9-UNIMOD:4,12-UNIMOD:4 ms_run[1]:scan=1.1.8169.11 110.6869 3 1877.7259 1877.7277 R A 212 226 PSM EGEEPTVYSDEEEPKDESAR 577 sp|O00264-2|PGRC1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.8156.10 110.3311 3 2294.9647 2294.9662 K K 121 141 PSM LQLQEQLQAETELCAEAEELR 578 sp|P35579|MYH9_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 14-UNIMOD:4 ms_run[1]:scan=1.1.1641.9 11.08995 3 2500.2058 2500.2115 K A 883 904 PSM EELQANGSAPAADKEEPAAAGSGAASPSAAEK 579 sp|P29966|MARCS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.8217.11 111.9906 4 2981.3513 2981.3849 K G 56 88 PSM GDTPGHATPGHGGATSSAR 580 sp|O75533|SF3B1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.5768.3 45.85377 4 1732.7877 1732.7877 R K 271 290 PSM DGEQHEDLNEVAK 581 sp|O95831|AIFM1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.6942.10 77.59075 3 1482.6556 1482.6586 K L 594 607 PSM LKDDEVAQLK 582 sp|P07195|LDHB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.7510.7 92.81876 2 1157.6264 1157.6292 K K 309 319 PSM LGDQGPPEEAEDR 583 sp|O00592-2|PODXL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.6932.11 77.32252 2 1411.6208 1411.6215 K F 413 426 PSM SEHPGLSIGDTAK 584 sp|P26583|HMGB2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.7692.7 97.7718 3 1310.6452 1310.6466 K K 115 128 PSM SSGGREDLESSGLQR 585 sp|Q9UK76-2|JUPI1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.7220.9 85.06136 3 1576.7449 1576.7441 K R 70 85 PSM GHTDSVQDISFDHSGK 586 sp|P43034|LIS1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 27 ms_run[1]:scan=1.1.8496.2 119.551 4 1728.7685 1728.7704 K L 148 164 PSM IVGPSGAAVPCK 587 sp|P21333|FLNA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 27 11-UNIMOD:4 ms_run[1]:scan=1.1.7727.11 98.73262 2 1155.611647 1154.611779 K V 1008 1020 PSM HPGSFDVVHVK 588 sp|P62701|RS4X_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.8244.5 112.7182 3 1221.626171 1220.630206 R D 201 212 PSM RDIQENDEEAVQVK 589 sp|O00231|PSD11_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.7350.10 88.60467 3 1672.804271 1671.806393 K E 33 47 PSM ATAAETSASEPEAESK 590 sp|Q15020|SART3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 27 1-UNIMOD:1 ms_run[1]:scan=1.1.7512.11 92.88 2 1619.7137 1619.7157 M A 2 18 PSM AADISESSGADCK 591 sp|O43583|DENR_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 27 1-UNIMOD:1,12-UNIMOD:4 ms_run[1]:scan=1.1.7711.10 98.2938 2 1351.5544 1351.5557 M G 2 15 PSM HLQLAIRGDEELDSLIK 592 sp|Q71UI9|H2AV_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2102.2 15.101 3 1950.051671 1949.058191 R A 86 103 PSM SVTEQGAELSNEER 593 sp|P63104|1433Z_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.7697.10 97.91243 2 1546.695447 1547.706344 K N 28 42 PSM RQQPGPSEHIER 594 sp|P50552|VASP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6074.5 53.97625 4 1432.7229 1432.7171 K R 143 155 PSM YHTVNGHNCEVR 595 sp|P09651-2|ROA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 9-UNIMOD:4 ms_run[1]:scan=1.1.6047.5 53.23723 4 1484.6557 1484.6579 K K 167 179 PSM HLQLAIRGDEELDSLIK 596 sp|P0C0S5|H2AZ_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.2249.2 16.10492 4 1949.0557 1949.0582 R A 86 103 PSM IECDDKGDGSCDVR 597 sp|P21333-2|FLNA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 3-UNIMOD:4,11-UNIMOD:4 ms_run[1]:scan=1.1.6065.11 53.74138 2 1624.6468 1624.6458 K Y 621 635 PSM VHGPGIQSGTTNKPNK 598 sp|P21333-2|FLNA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.5978.6 51.34248 4 1633.8557 1633.8536 R F 1360 1376 PSM VTWLVSWTENIQGSIK 599 sp|P11387|TOP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.1663.3 11.62767 3 1859.9740 1859.9781 K Y 410 426 PSM KPNEGADGQWK 600 sp|Q8NC51-3|PAIRB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6260.6 59.06927 3 1228.5847 1228.5836 R K 295 306 PSM IHEGCEEPATHNALAK 601 sp|Q00610-2|CLH1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 5-UNIMOD:4 ms_run[1]:scan=1.1.6483.4 65.09213 4 1775.8233 1775.8260 R I 866 882 PSM MKDTDSEEEIR 602 sp|P0DP23|CALM1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6372.6 62.13328 3 1351.5937 1351.5925 K E 77 88 PSM SCCSCCPVGCAK 603 sp|Q8N339|MT1M_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 2-UNIMOD:4,3-UNIMOD:4,5-UNIMOD:4,6-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.6190.8 57.13268 3 1444.5049 1444.5026 K C 32 44 PSM ETYGEMADCCAK 604 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 6-UNIMOD:35,9-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.6426.8 63.56915 3 1449.5215 1449.5210 R Q 106 118 PSM HECQANGPEDLNR 605 sp|P60981-2|DEST_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 3-UNIMOD:4 ms_run[1]:scan=1.1.6343.8 61.3463 3 1538.6560 1538.6532 K A 116 129 PSM ANESSPKPVGPPPER 606 sp|Q9BQI0-3|AIF1L_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6422.9 63.46695 3 1560.7906 1560.7896 K D 122 137 PSM ADGGTQVIDTK 607 sp|P09622|DLDH_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6483.11 65.1038 2 1103.5454 1103.5459 K N 167 178 PSM TENNDHINLK 608 sp|P61956-2|SUMO2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6508.9 65.78557 2 1196.5770 1196.5785 K V 12 22 PSM SGAEVEAGDAAER 609 sp|Q8IY67-2|RAVR1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6337.10 61.1869 2 1260.5576 1260.5582 K R 17 30 PSM VNGDASPAAAESGAK 610 sp|P29966|MARCS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6121.10 55.23875 2 1343.6312 1343.6317 K E 41 56 PSM PGPTPSGTNVGSSGR 611 sp|P60468|SC61B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6330.11 61.00023 2 1369.6600 1369.6586 M S 2 17 PSM GMGTVEGGDQSNPK 612 sp|Q13428-3|TCOF_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6269.11 59.32637 2 1375.6030 1375.6038 K S 1425 1439 PSM EDSQRPGAHLTVK 613 sp|P09651-2|ROA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6371.10 62.11383 2 1436.7374 1436.7372 R K 93 106 PSM EGGDGEEQDVGDAGR 614 sp|Q8N1G4|LRC47_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6263.11 59.16043 2 1489.5942 1489.5917 R L 292 307 PSM EGPSGSGDSQLSASSR 615 sp|Q12789-3|TF3C1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6489.11 65.26833 2 1520.6722 1520.6703 K S 743 759 PSM NYQQNYQNSESGEK 616 sp|P67809|YBOX1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6437.11 63.866 2 1687.7086 1687.7074 R N 157 171 PSM EDIYSGGGGGGSR 617 sp|Q13151|ROA0_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6557.9 67.13261 3 1210.5208 1210.5215 K S 177 190 PSM SESPKEPEQLR 618 sp|P09651-2|ROA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6522.5 66.16422 3 1298.6464 1298.6466 K K 4 15 PSM VIACDGGGGALGHPK 619 sp|O75380|NDUS6_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 4-UNIMOD:4 ms_run[1]:scan=1.1.6856.8 75.29031 3 1407.6907 1407.6929 R V 84 99 PSM KLGAGEGGEASVSPEK 620 sp|Q13428-3|TCOF_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6522.8 66.16922 3 1514.7547 1514.7576 K T 1367 1383 PSM SSAEVIAQAR 621 sp|Q16555-2|DPYL2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6846.8 75.01736 2 1030.5366 1030.5407 K K 223 233 PSM APEQEQAAPGPAAGGEAPK 622 sp|P80723|BASP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6690.11 70.77187 3 1774.8487 1774.8486 K A 103 122 PSM EAAGTTAAAGTGGATEQPPR 623 sp|O43290|SNUT1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6593.10 68.12431 3 1812.8587 1812.8602 K H 12 32 PSM VLANPGNSQVAR 624 sp|Q14974|IMB1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6741.11 72.17263 2 1224.6566 1224.6575 R V 43 55 PSM SGGGGGGGLGSGGSIR 625 sp|P35527|K1C9_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6672.11 70.27855 2 1231.5906 1231.5906 R S 14 30 PSM HLIPAANTGESK 626 sp|P62258|1433E_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6647.11 69.59476 2 1236.6480 1236.6462 K V 107 119 PSM VAEVEGEQVDNK 627 sp|O95202|LETM1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6583.11 67.8499 2 1315.6260 1315.6256 K A 452 464 PSM ADTQTYQPYNK 628 sp|P84090|ERH_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6897.10 76.40638 2 1327.6034 1327.6044 R D 74 85 PSM SRAEAALEEESR 629 sp|Q969G3-2|SMCE1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6899.10 76.45827 2 1346.6392 1346.6426 K Q 147 159 PSM TTTAAAVASTGPSSR 630 sp|P27816-6|MAP4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6522.10 66.17255 2 1376.6888 1376.6896 K S 810 825 PSM IFSGSSHQDLSQK 631 sp|P60891|PRPS1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6866.11 75.56955 2 1432.6946 1432.6947 K I 6 19 PSM NSLQEQQEEEEEARK 632 sp|P35580-3|MYH10_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6773.11 73.04705 3 1845.8350 1845.8340 K N 1367 1382 PSM QEYDESGPSIVHRK 633 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7227.5 85.24464 4 1643.7897 1643.7903 K C 360 374 PSM RAGELTEDEVER 634 sp|P62269|RS18_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7112.6 82.1662 3 1402.6699 1402.6688 K V 55 67 PSM AAEEAPEEAPEDAAR 635 sp|Q9H9Z2|LN28A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7050.10 80.49828 3 1554.6823 1554.6797 K A 16 31 PSM IIHEDGYSEDECK 636 sp|P08754|GNAI3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 12-UNIMOD:4 ms_run[1]:scan=1.1.6971.8 78.36996 3 1593.6613 1593.6617 K Q 55 68 PSM IIHEDGYSEEECR 637 sp|P04899-4|GNAI2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 12-UNIMOD:4 ms_run[1]:scan=1.1.7280.9 86.70486 3 1635.6838 1635.6835 K Q 55 68 PSM SGGVGGSNTNWK 638 sp|P27694|RFA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6922.10 77.05495 2 1162.5384 1162.5367 K T 432 444 PSM FCDNSSAIQGK 639 sp|O15067|PUR4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 2-UNIMOD:4 ms_run[1]:scan=1.1.6944.11 77.64657 2 1225.5402 1225.5397 K E 269 280 PSM PAEKPAETPVATSPTATDSTSGDSSR 640 sp|P54727|RD23B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7125.11 82.52209 4 2559.1941 2559.1936 K S 148 174 PSM VMQQQQQTTQQQLPQK 641 sp|Q15459|SF3A1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6924.10 77.10772 3 1940.9725 1940.9738 K V 116 132 PSM ASNGDAWVEAHGK 642 sp|P38646|GRP75_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7311.11 87.55701 2 1340.6116 1340.6109 R L 147 160 PSM ASMQQQQQLASAR 643 sp|Q9Y3Y2-3|CHTOP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6926.11 77.16232 2 1445.7032 1445.7045 R N 39 52 PSM ETGYVVERPSTTK 644 sp|Q9NYF8-2|BCLF1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7151.11 83.22743 2 1465.7416 1465.7413 K D 461 474 PSM IIEDCSNSEETVK 645 sp|Q93008-1|USP9X_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 5-UNIMOD:4 ms_run[1]:scan=1.1.6971.11 78.37497 2 1522.6792 1522.6821 K L 2289 2302 PSM TADDSATSDYCPAPK 646 sp|Q9UBC3-8|DNM3B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 11-UNIMOD:4 ms_run[1]:scan=1.1.7050.11 80.49995 2 1597.6602 1597.6566 R R 321 336 PSM VDNSSLTGESEPQTR 647 sp|P05023-4|AT1A1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7194.11 84.36044 2 1618.7466 1618.7435 K S 213 228 PSM TEQGEEEEEEEDEEEEEK 648 sp|P98175-5|RBM10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7220.11 85.0647 2 2224.8194 2224.8138 R A 174 192 PSM EHDPVGQMVNNPK 649 sp|P55060-3|XPO2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7533.4 93.43943 3 1463.6788 1463.6827 K I 913 926 PSM LSSEMNTSTVNSAR 650 sp|P20700|LMNB1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7495.6 92.40932 3 1495.6897 1495.6936 R E 277 291 PSM YLANIEQQHGNSGR 651 sp|Q9UKX7-2|NUP50_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7407.4 90.07725 3 1585.7572 1585.7597 K N 165 179 PSM TPASPVVHIR 652 sp|P14866|HNRPL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7592.3 95.05074 3 1075.6129 1075.6138 K G 98 108 PSM VVGCSCVVVK 653 sp|P25398|RS12_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 4-UNIMOD:4,6-UNIMOD:4 ms_run[1]:scan=1.1.7449.8 91.16945 2 1105.5602 1105.5624 K D 103 113 PSM AGGPATPLSPTR 654 sp|Q03252|LMNB2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7394.9 89.75285 2 1123.5978 1123.5986 R L 29 41 PSM LATNTSAPDLK 655 sp|P27816-6|MAP4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7488.9 92.22307 2 1129.5842 1129.5979 R N 923 934 PSM NEEPSEEEIDAPKPK 656 sp|Q9NR30|DDX21_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7610.10 95.54124 3 1710.7921 1710.7948 K K 117 132 PSM PVTIHATPEGTSEACR 657 sp|Q9Y6M1-1|IF2B2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 15-UNIMOD:4 ms_run[1]:scan=1.1.7450.10 91.19883 3 1724.8123 1724.8152 K M 241 257 PSM LKDDEVAQLK 658 sp|P07195|LDHB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7488.11 92.2264 2 1157.6264 1157.6292 K K 309 319 PSM TPDGQGLSTYK 659 sp|Q5VYK3|ECM29_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7410.11 90.16738 2 1165.5604 1165.5615 K E 1057 1068 PSM VEIIANDQGNR 660 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7427.8 90.60675 2 1227.6208 1227.6207 R I 26 37 PSM AGELTEDEVER 661 sp|P62269|RS18_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7695.10 97.85835 2 1246.5652 1246.5677 R V 56 67 PSM VIGSGCNLDSAR 662 sp|P07195|LDHB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 6-UNIMOD:4 ms_run[1]:scan=1.1.7510.9 92.8221 2 1247.5922 1247.5928 R F 159 171 PSM DGGSGNSTIIVSR 663 sp|Q7Z6Z7-2|HUWE1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7556.10 94.07738 2 1261.6248 1261.6263 R S 2359 2372 PSM ISSDLDGHPVPK 664 sp|P29401-2|TKT_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7614.5 95.63975 3 1263.6421 1263.6459 K Q 103 115 PSM TIDEGDADEVTK 665 sp|Q7LBC6|KDM3B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7317.10 87.71931 2 1291.5774 1291.5780 K Q 1589 1601 PSM TENCLSSCVDR 666 sp|Q9Y5J9|TIM8B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 4-UNIMOD:4,8-UNIMOD:4 ms_run[1]:scan=1.1.7400.11 89.90912 2 1339.5508 1339.5497 R F 52 63 PSM EAPPMEKPEVVK 667 sp|P62841|RS15_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7551.11 93.94218 2 1352.6982 1352.7010 K T 66 78 PSM SISADDDLQESSR 668 sp|P18615-3|NELFE_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7668.10 97.1213 2 1421.6278 1421.6270 R R 120 133 PSM GEDEEENNLEVR 669 sp|P04843|RPN1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7675.10 97.31395 2 1431.6106 1431.6113 K E 90 102 PSM YKPESEELTAER 670 sp|P07237|PDIA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7517.8 93.01092 3 1450.6906 1450.6939 K I 327 339 PSM VGQAVDVVGQAGKPK 671 sp|Q13200|PSMD2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7498.8 92.49443 3 1451.8081 1451.8096 R T 846 861 PSM LSSEMNTSTVNSAR 672 sp|P20700|LMNB1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7491.11 92.30845 2 1495.6916 1495.6936 R E 277 291 PSM HELQANCYEEVK 673 sp|P23528|COF1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 7-UNIMOD:4 ms_run[1]:scan=1.1.7709.7 98.23421 3 1518.6754 1518.6773 K D 133 145 PSM HELQANCYEEVK 674 sp|P23528|COF1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 7-UNIMOD:4 ms_run[1]:scan=1.1.7690.8 97.7192 3 1518.6754 1518.6773 K D 133 145 PSM HELQANCYEEVK 675 sp|P23528|COF1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 7-UNIMOD:4 ms_run[1]:scan=1.1.7671.6 97.19728 3 1518.6754 1518.6773 K D 133 145 PSM GVEEEEEDGEMRE 676 sp|P62306|RUXF_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7655.11 96.76708 2 1536.5884 1536.5886 R - 74 87 PSM VEQLGAEGNVEESQK 677 sp|Q9Y383-3|LC7L2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7569.11 94.4356 2 1615.7694 1615.7689 K V 137 152 PSM QGIETPEDQNDLRK 678 sp|Q15637-4|SF01_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7647.9 96.54568 3 1641.7942 1641.7958 K M 228 242 PSM LLETTDRPDGHQNNLR 679 sp|Q14974|IMB1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7452.11 91.25263 3 1877.9344 1877.9344 K S 510 526 PSM FGVAPDHPEVK 680 sp|P22570-3|ADRO_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7905.3 103.5466 3 1194.5983 1194.6033 R N 123 134 PSM TRTEELIVQTK 681 sp|Q9BYT8|NEUL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7753.5 99.4347 3 1316.7271 1316.7300 K Q 59 70 PSM FHHTFSTEIAK 682 sp|P13667|PDIA4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7855.7 102.1798 3 1316.6500 1316.6513 K F 336 347 PSM SGGTEGLLAEK 683 sp|Q9UHB9-4|SRP68_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.8045.10 107.3833 2 1060.5378 1060.5400 R L 229 240 PSM GTVRPANDFNPDADAK 684 sp|P08133-2|ANXA6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7782.9 100.2003 3 1686.7894 1686.7962 K A 323 339 PSM VLTVINQTQK 685 sp|P42766|RL35_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.8058.8 107.7241 2 1142.6622 1142.6659 R E 57 67 PSM IVGPSGAAVPCK 686 sp|P21333-2|FLNA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 11-UNIMOD:4 ms_run[1]:scan=1.1.7753.10 99.44303 2 1154.6086 1154.6118 K V 1008 1020 PSM FEDVVNQSSPK 687 sp|Q01085-2|TIAR_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7912.9 103.7484 2 1248.5958 1248.5986 R N 210 221 PSM IDEPLEGSEDR 688 sp|P61978|HNRPK_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7988.10 105.8295 2 1258.5668 1258.5677 K I 423 434 PSM SEVAAGGGSWDDR 689 sp|Q66K74-2|MAP1S_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.8015.11 106.5671 2 1305.5602 1305.5586 R L 287 300 PSM EGNPEEDLTADK 690 sp|P40121-2|CAPG_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7975.10 105.4756 2 1316.5734 1316.5732 K A 217 229 PSM IGQQPQQPGAPPQQDYTK 691 sp|Q92945|FUBP2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7894.11 103.258 3 1979.9680 1979.9701 K A 629 647 PSM VVTDTDETELAR 692 sp|P05198|IF2A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.8007.9 106.3448 2 1347.6522 1347.6518 K Q 277 289 PSM LVQTAAQQVAEDK 693 sp|Q53FT3|HIKES_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7860.10 102.3216 2 1399.7278 1399.7307 R F 10 23 PSM ETYGEMADCCAK 694 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 9-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.7977.11 105.5318 2 1433.5254 1433.5261 R Q 106 118 PSM DQTPDENDQVIVK 695 sp|Q9NZI8|IF2B1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.8029.11 106.9517 2 1499.7102 1499.7104 R I 526 539 PSM VYAVATSTNTPCAR 696 sp|Q10570|CPSF1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 12-UNIMOD:4 ms_run[1]:scan=1.1.7844.10 101.8838 2 1509.7230 1509.7246 K I 1033 1047 PSM QDHAQQLATAAEER 697 sp|Q14980|NUMA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7872.10 102.6518 2 1566.7356 1566.7386 R E 579 593 PSM VDNDENEHQLSLR 698 sp|P06748-2|NPM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7773.2 99.95392 4 1567.7193 1567.7226 K T 33 46 PSM QIVGTPVNSEDSDTR 699 sp|Q5QJE6|TDIF2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7799.11 100.6603 2 1616.7640 1616.7642 K Q 228 243 PSM ICDECNYGSYQGR 700 sp|Q7RTV0|PHF5A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 2-UNIMOD:4,5-UNIMOD:4 ms_run[1]:scan=1.1.8049.11 107.4924 2 1620.6324 1620.6297 R C 45 58 PSM TGTITTFEHAHNMR 701 sp|P13639|EF2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.8480.4 119.1189 4 1614.7505 1614.7573 K V 482 496 PSM VLEEANQAINPK 702 sp|Q92841-1|DDX17_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.8202.7 111.578 3 1324.6969 1324.6986 K L 457 469 PSM GAVHQLCQSLAGK 703 sp|P09417-2|DHPR_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 7-UNIMOD:4 ms_run[1]:scan=1.1.8471.6 118.8764 3 1367.6950 1367.6980 K N 124 137 PSM SRAEAESMYQIK 704 sp|P05787-2|K2C8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.8136.7 109.7817 3 1411.6756 1411.6765 R Y 302 314 PSM SSFYPDGGDQETAK 705 sp|Q9NYF8-2|BCLF1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.8320.6 114.7773 3 1500.6361 1500.6369 R T 317 331 PSM ITHQIVDRPGQQTSVIGR 706 sp|O00541-2|PESC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.8216.7 111.9566 4 2004.0841 2004.0865 R C 368 386 PSM QEYDESGPSIVHR 707 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.8211.7 111.8212 3 1515.6919 1515.6954 K K 360 373 PSM QEYDESGPSIVHR 708 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.8148.8 110.1104 3 1515.6919 1515.6954 K K 360 373 PSM ALAAGGYDVEK 709 sp|P16401|H15_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.8172.9 110.7654 2 1092.5426 1092.5451 K N 68 79 PSM ALAAAGYDVEK 710 sp|P10412|H14_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.8448.8 118.2493 2 1106.5600 1106.5608 K N 65 76 PSM LAAIAESGVER 711 sp|P28072|PSB6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.8256.10 113.0559 2 1114.5948 1114.5982 R Q 210 221 PSM GFDTSSSSSNSAASSSFK 712 sp|P49790-2|NU153_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.8205.8 111.6605 3 1752.7429 1752.7439 K F 845 863 PSM TEEGPTLSYGR 713 sp|P43243|MATR3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.8466.10 118.7465 2 1208.5642 1208.5673 R D 150 161 PSM AADLNGDLTATR 714 sp|Q15293-2|RCN1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.8495.10 119.537 2 1216.6008 1216.6048 K E 126 138 PSM LFVSGACDASAK 715 sp|P62873-2|GBB1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 7-UNIMOD:4 ms_run[1]:scan=1.1.8248.9 112.8347 2 1224.5792 1224.5809 R L 198 210 PSM DQVANSAFVER 716 sp|P07900-2|HS90A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.8473.11 118.9395 2 1234.5922 1234.5942 K L 622 633 PSM GISVHISNAEPK 717 sp|Q13148|TADBP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.8307.8 114.4298 2 1250.6588 1250.6619 K H 252 264 PSM VGMVETNSQDRPVDDVK 718 sp|Q9Y3C6|PPIL1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.8293.11 114.0592 3 1887.8953 1887.8997 R I 142 159 PSM VLEEANQAINPK 719 sp|Q92841-1|DDX17_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.8221.7 112.0927 3 1324.6969 1324.6986 K L 457 469 PSM LNQPPEDGISSVK 720 sp|O43684-2|BUB3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.8343.10 115.406 2 1382.7040 1382.7041 K F 9 22 PSM NPSDSAVHSPFTK 721 sp|Q14157-1|UBP2L_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.8364.5 115.9698 3 1385.6551 1385.6575 K R 408 421 PSM AQAELVGTADEATR 722 sp|P30049|ATPD_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.8243.11 112.7007 2 1430.6970 1430.7001 K A 137 151 PSM SQGGEPTYNVAVGR 723 sp|P35080-2|PROF2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.8499.11 119.6477 2 1433.6874 1433.6899 K A 92 106 PSM LGNYAGAVQDCER 724 sp|O43765|SGTA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 11-UNIMOD:4 ms_run[1]:scan=1.1.8467.11 118.7755 2 1451.6452 1451.6463 K A 138 151 PSM SAEDYNSSNALNVK 725 sp|Q13153-2|PAK1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.8480.11 119.1305 2 1510.6876 1510.6899 K A 149 163 PSM ELAGHTGYLSCCR 726 sp|P62873-2|GBB1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 11-UNIMOD:4,12-UNIMOD:4 ms_run[1]:scan=1.1.8156.7 110.3261 3 1522.6648 1522.6657 R F 138 151 PSM YEQGTGCWQGPNR 727 sp|P14314-2|GLU2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 7-UNIMOD:4 ms_run[1]:scan=1.1.8290.11 113.9789 2 1551.6528 1551.6525 K S 462 475 PSM QAEETYENIPGQSK 728 sp|O00410-3|IPO5_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.8355.11 115.7342 2 1592.7328 1592.7318 K I 46 60 PSM PGLVDSNPAPPESQEK 729 sp|Q14061|COX17_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.8274.11 113.5474 2 1663.8042 1663.8053 M K 2 18 PSM TAENATSGETLEENEAGD 730 sp|Q9UQ80|PA2G4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.8122.11 109.4067 2 1836.7526 1836.7497 K - 377 395 PSM TEEGEIDYSAEEGENRR 731 sp|Q8WVV9-5|HNRLL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.8244.10 112.7265 3 1982.8432 1982.8453 K E 27 44 PSM MQHNLEQQIQAR 732 sp|Q13813|SPTN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.8109.7 109.0465 3 1494.7291 1494.7361 R N 2304 2316 PSM RQLEEAEEEAQR 733 sp|P35579|MYH9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6822.9 74.38223 3 1486.7005 1486.7011 K A 1877 1889 PSM GNLGAGNGNLQGPR 734 sp|P43243|MATR3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7332.11 88.12878 2 1323.6704 1323.6644 R H 374 388 PSM RQAVTNPNNTFYATK 735 sp|P38646|GRP75_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7909.4 103.6578 4 1723.8609 1723.8642 K R 107 122 PSM AEDGATPSPSNETPK 736 sp|P29966|MARCS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6289.11 59.87973 2 1499.6746 1499.6740 K K 138 153 PSM HEAFESDLAAHQDR 737 sp|O43707|ACTN4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7968.4 105.2746 4 1624.7245 1624.7230 K V 456 470 PSM KNSVVEASEAAYK 738 sp|Q04917|1433F_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7646.8 96.51687 3 1394.7037 1394.7041 K E 143 156 PSM QNAQCLHGDIAQSQR 739 sp|Q9BQ39|DDX50_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 5-UNIMOD:4 ms_run[1]:scan=1.1.6780.11 73.23898 3 1724.8003 1724.8013 K E 413 428 PSM LDYGQHVVAGTPGR 740 sp|P38919|IF4A3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.8496.5 119.556 3 1468.7389 1468.7423 K V 153 167 PSM RLHGLDEEAEQK 741 sp|P33991|MCM4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6581.8 67.78982 3 1423.7053 1423.7055 K L 428 440 PSM QGIETPEDQNDLRK 742 sp|Q15637-4|SF01_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.7628.10 96.02811 3 1641.7942 1641.7958 K M 228 242 PSM CTGGEVGATSALAPK 743 sp|P30050-2|RL12_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 1-UNIMOD:4 ms_run[1]:scan=1.1.8151.6 110.1888 3 1417.6825 1417.6871 R I 17 32 PSM LLQHGINADDK 744 sp|Q96P70|IPO9_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 ms_run[1]:scan=1.1.6718.4 71.5275 3 1222.6327 1222.6306 K R 866 877 PSM KLVIVGDGACGK 745 sp|P08134|RHOC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 26 10-UNIMOD:4 ms_run[1]:scan=1.1.7737.5 98.99622 3 1215.6619 1215.6646 K T 7 19 PSM AAFTECCQAADK 746 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 26 6-UNIMOD:4,7-UNIMOD:4 ms_run[1]:scan=1.1.7053.7 80.57516 3 1371.556571 1370.559486 K A 187 199 PSM HQGVMVGMGQK 747 sp|P62736|ACTA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.6955.9 77.93975 2 1171.564447 1170.563783 R D 42 53 PSM QEYDESGPSIVHRK 748 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 26 1-UNIMOD:28 ms_run[1]:scan=1.1.8349.7 115.5641 3 1628.7662 1626.7632 K C 360 374 PSM NQGGYGGSSSSSSYGSGR 749 sp|P09651|ROA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.6566.11 67.38275 2 1694.681447 1693.692819 R R 353 371 PSM TDNAGDQHGGGGGGGGGAGAAGGGGGGENYDDPHK 750 sp|P14866|HNRPL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.6257.11 58.99477 4 2982.189694 2980.195259 K T 63 98 PSM SETAPAAPAAAPPAEK 751 sp|P16403|H12_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 26 1-UNIMOD:1 ms_run[1]:scan=1.1.7975.11 105.4773 2 1519.7517 1519.7513 M A 2 18 PSM CGETGHVAINCSK 752 sp|P62633|CNBP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 26 1-UNIMOD:385,1-UNIMOD:4,11-UNIMOD:4 ms_run[1]:scan=1.1.7650.11 96.63067 2 1414.5943 1414.5964 R T 140 153 PSM LGDQGPPEEAEDR 753 sp|O00592|PODXL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.6902.10 76.53567 2 1412.625647 1411.621552 K F 445 458 PSM TGVHHYSGNNIELGTACGK 754 sp|P62888|RL30_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 26 17-UNIMOD:4 ms_run[1]:scan=1.1.8222.9 112.1231 4 2014.916494 2013.932673 K Y 69 88 PSM GVQVETISPGDGR 755 sp|P62942|FKB1A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 26 ms_run[1]:scan=1.1.8468.9 118.7995 2 1314.6582 1313.6572 M T 2 15 PSM AAEAAAAPAESAAPAAGEEPSKEEGEPK 756 sp|P80723|BASP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.7718.11 98.48687 3 2634.243971 2635.224934 K K 122 150 PSM FATHAAALSVR 757 sp|P23246|SFPQ_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.8054.7 107.6189 2 1143.619047 1142.619642 R N 366 377 PSM IRYESLTDPSK 758 sp|Q58FF8|H90B2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.8509.5 119.9109 3 1306.660571 1307.672131 K L 54 65 PSM RPLEDGDQPDAK 759 sp|Q96AE4-2|FUBP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6089.5 54.36695 3 1339.6393 1339.6368 K K 65 77 PSM AGAHLQGGAK 760 sp|P04406|G3P_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.5699.2 44.54598 2 908.4826 908.4828 K R 108 118 PSM TIADHCPDSACK 761 sp|P35221-2|CTNA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 6-UNIMOD:4,11-UNIMOD:4 ms_run[1]:scan=1.1.6097.9 54.57987 3 1373.5714 1373.5704 R Q 762 774 PSM HLQLAIRGDEELDSLIK 762 sp|P0C0S5|H2AZ_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.2480.2 17.6473 4 1949.0557 1949.0582 R A 86 103 PSM HSGASAEVQKEEEK 763 sp|Q99615|DNJC7_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.5836.5 47.498 3 1527.7171 1527.7165 R K 413 427 PSM QVHPDTGISSK 764 sp|Q99880|H2B1L_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6083.5 54.21347 3 1167.5926 1167.5884 K A 48 59 PSM AYVVLGQFLVLK 765 sp|O75531|BAF_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.1651.3 11.31287 2 1348.8068 1348.8119 K K 42 54 PSM LFIGGLSFETTDESLR 766 sp|P09651-2|ROA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.1640.10 11.06498 2 1783.8948 1783.8992 K S 16 32 PSM YHTINGHNAEVR 767 sp|P22626-2|ROA2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6285.4 59.75753 4 1409.6817 1409.6800 K K 162 174 PSM KPITDDDVDR 768 sp|P53618|COPB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6244.3 58.62342 3 1172.5702 1172.5673 K I 603 613 PSM DRDYSDHPSGGSYR 769 sp|P38159-2|RBMX_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6399.2 62.83407 4 1610.6733 1610.6710 R D 256 270 PSM KPNEGADGQWK 770 sp|Q8NC51-3|PAIRB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6281.4 59.64693 3 1228.5847 1228.5836 R K 295 306 PSM HVPGGGNVQIQNK 771 sp|P27816-6|MAP4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6425.7 63.54156 3 1346.7067 1346.7055 K K 1016 1029 PSM GSGSRPGIEGDTPR 772 sp|Q14195-2|DPYL3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6404.5 62.97237 3 1384.6690 1384.6695 R R 74 88 PSM QSNASSDVEVEEK 773 sp|O75475|PSIP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6413.9 63.22478 3 1420.6327 1420.6318 K E 101 114 PSM NIDEHANEDVER 774 sp|P61026|RAB10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6477.7 64.93338 3 1439.6266 1439.6277 R M 106 118 PSM EEIQETQTPTHSR 775 sp|Q9BYG3|MK67I_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6195.9 57.27325 3 1554.7306 1554.7274 K K 272 285 PSM TVGVEPAADGK 776 sp|P46779|RL28_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6329.10 60.9719 2 1042.5310 1042.5295 K G 48 59 PSM EVVEEAENGR 777 sp|P06454-2|PTMA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6430.10 63.67667 2 1130.5214 1130.5204 K D 22 32 PSM SEASSSPPVVTSSSHSR 778 sp|P48431|SOX2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6260.10 59.07593 3 1700.7967 1700.7966 K A 246 263 PSM VQESADELQK 779 sp|P84085|ARF5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6429.10 63.65047 2 1145.5542 1145.5564 R M 100 110 PSM IEGDETSTEAATR 780 sp|P52434-4|RPAB3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6273.11 59.4373 2 1378.6206 1378.6212 R L 99 112 PSM ETPAATEAPSSTPK 781 sp|P80723|BASP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6337.11 61.18857 2 1385.6692 1385.6674 K A 185 199 PSM ESEPQAAAEPAEAK 782 sp|P80723|BASP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6409.8 63.11377 3 1426.6579 1426.6575 K E 39 53 PSM LQAENDASKEEVK 783 sp|P33176|KINH_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6206.8 57.57727 3 1459.7170 1459.7154 R E 477 490 PSM TCVADESAENCDK 784 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 2-UNIMOD:4,11-UNIMOD:4 ms_run[1]:scan=1.1.6129.10 55.45945 3 1497.5734 1497.5712 K S 76 89 PSM NQGGGLSSSGAGEGQGPK 785 sp|P07814|SYEP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6215.11 57.83249 2 1586.7278 1586.7285 K K 992 1010 PSM QEEENPAEETGEEK 786 sp|O43768-4|ENSA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6384.11 62.45723 2 1617.6688 1617.6642 K Q 5 19 PSM RLPDAHSDYAR 787 sp|Q96PK6|RBM14_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6634.2 69.22536 4 1299.6309 1299.6320 R Y 637 648 PSM KEDAENLAAAQR 788 sp|Q9Y6D6|BIG1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6529.7 66.35975 3 1314.6460 1314.6527 K D 1643 1655 PSM GEAAAERPGEAAVASSPSK 789 sp|P29966|MARCS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6531.7 66.41473 4 1783.8725 1783.8700 K A 12 31 PSM SEDDESGAGELTR 790 sp|P33993|MCM7_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6915.9 76.8706 3 1364.5702 1364.5692 K E 309 322 PSM KVEEEEDESALK 791 sp|Q14566|MCM6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6533.6 66.46812 3 1404.6607 1404.6620 R R 733 745 PSM KIIEDQQESLNK 792 sp|P05455|LA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6893.9 76.30048 3 1443.7540 1443.7569 K W 317 329 PSM AGFAGDDAPR 793 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6906.7 76.6339 2 975.4412 975.4410 K A 19 29 PSM EGVHGGLINK 794 sp|P07737|PROF1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6564.6 67.31966 2 1022.5510 1022.5509 K K 117 127 PSM TPGPGAQSALR 795 sp|P62263|RS14_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6749.10 72.39142 2 1053.5556 1053.5567 K A 107 118 PSM AAIISAEGDSK 796 sp|P35232|PHB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6860.8 75.39986 2 1060.5394 1060.5400 K A 209 220 PSM AAIISAEGDSK 797 sp|P35232|PHB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6841.11 74.88618 2 1060.5394 1060.5400 K A 209 220 PSM LAEEESCREDVTR 798 sp|Q92896|GSLG1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 7-UNIMOD:4 ms_run[1]:scan=1.1.6551.10 66.96937 3 1592.7106 1592.7100 K V 112 125 PSM SGGVGGSNTNWK 799 sp|P27694|RFA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6902.9 76.534 2 1162.5384 1162.5367 K T 432 444 PSM AIEENNNFSK 800 sp|P16949|STMN1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6795.10 73.6494 2 1164.5400 1164.5411 K M 86 96 PSM STSSHGTDEMESSSYR 801 sp|Q8IWS0-3|PHF6_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6620.11 68.85622 3 1759.6969 1759.6955 R D 180 196 PSM QLHQSCQTDDGEDDLK 802 sp|P61201-2|CSN2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 6-UNIMOD:4 ms_run[1]:scan=1.1.6590.11 68.04305 3 1887.7927 1887.7905 R K 181 197 PSM DETGELSSADEK 803 sp|Q92900-2|RENT1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6828.10 74.54048 2 1279.5428 1279.5415 K R 582 594 PSM AGDDEPEYEDGR 804 sp|Q9Y6K1|DNM3A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6651.11 69.7039 2 1351.5178 1351.5164 K G 277 289 PSM ATHDGAPELGAGGTR 805 sp|Q9BXW7-2|HDHD5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6587.9 67.95685 3 1408.6660 1408.6695 K Q 302 317 PSM SSLSNNECGSLDK 806 sp|Q5UIP0|RIF1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 8-UNIMOD:4 ms_run[1]:scan=1.1.6805.11 73.92523 2 1409.6080 1409.6093 K T 1148 1161 PSM CEDLETQTQSEK 807 sp|O00592-2|PODXL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 1-UNIMOD:4 ms_run[1]:scan=1.1.6542.11 66.72338 2 1466.6184 1466.6195 K Q 312 324 PSM TVYHAEEVQCDGR 808 sp|Q16527|CSRP2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 10-UNIMOD:4 ms_run[1]:scan=1.1.6811.11 74.08984 2 1562.6802 1562.6784 R S 16 29 PSM AGLESGAEPGDGDSDTTK 809 sp|O60832|DKC1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6833.11 74.67265 2 1705.7334 1705.7279 K K 481 499 PSM ALTSADGASEEQSQNDEDNQGSEK 810 sp|Q92552-2|RT27_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6656.11 69.84042 3 2509.0354 2509.0324 K L 303 327 PSM SGGNEVSIEER 811 sp|Q15061|WDR43_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7010.11 79.43273 2 1175.5426 1175.5418 K L 431 442 PSM KLDAQVQELHAK 812 sp|P35580-3|MYH10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7287.5 86.89082 4 1378.7549 1378.7568 K V 1277 1289 PSM TLHPDLGTDK 813 sp|P00338-3|LDHA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6996.4 79.04795 3 1095.5560 1095.5560 K D 242 252 PSM RFPGYDSESK 814 sp|P46777|RL5_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7303.2 87.3234 3 1184.5474 1184.5462 K E 179 189 PSM SEETLDEGPPK 815 sp|Q00688|FKBP3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7029.6 79.92315 3 1200.5482 1200.5510 K Y 100 111 PSM HPQPGAVELAAK 816 sp|P27708|PYR1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7120.5 82.37849 3 1216.6543 1216.6564 R H 2025 2037 PSM QEYDESGPSIVHRK 817 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7246.8 85.76857 4 1643.7897 1643.7903 K C 360 374 PSM YLAEVAAGDDKK 818 sp|P63104|1433Z_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7071.5 81.05375 3 1278.6454 1278.6456 R G 128 140 PSM IIEDQQESLNK 819 sp|P05455|LA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7151.6 83.2191 3 1315.6618 1315.6619 K W 318 329 PSM AGFAGDDAPR 820 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6926.7 77.15565 2 975.4412 975.4410 K A 19 29 PSM TAVCDIPPR 821 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 4-UNIMOD:4 ms_run[1]:scan=1.1.7253.6 85.95695 2 1027.5130 1027.5121 K G 351 360 PSM LFQECCPHSTDR 822 sp|P61978|HNRPK_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 5-UNIMOD:4,6-UNIMOD:4 ms_run[1]:scan=1.1.7306.10 87.41875 3 1548.6439 1548.6450 K V 180 192 PSM AATAAADFTAK 823 sp|Q9Y3F4-2|STRAP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7266.9 86.31866 2 1036.5192 1036.5189 K V 87 98 PSM EKEDAQEVELQEGK 824 sp|Q02952-2|AKA12_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7136.8 82.8124 3 1630.7686 1630.7686 K V 1639 1653 PSM GHIISDGGCSCPGDVAK 825 sp|Q9P2T1-2|GMPR2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 9-UNIMOD:4,11-UNIMOD:4 ms_run[1]:scan=1.1.7255.9 86.01691 3 1728.7573 1728.7560 K A 232 249 PSM LVSSDPEINTK 826 sp|Q9Y266|NUDC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7302.11 87.31115 2 1201.6200 1201.6190 R K 257 268 PSM LAQQISDEASR 827 sp|Q93008-1|USP9X_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7048.9 80.44203 2 1216.6066 1216.6048 R Y 1221 1232 PSM LAQQISDEASR 828 sp|Q93008-1|USP9X_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7067.9 80.95435 2 1216.6066 1216.6048 R Y 1221 1232 PSM DGEEAGAYDGPR 829 sp|P30101|PDIA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7216.11 84.95692 2 1235.5046 1235.5054 R T 108 120 PSM VAEDEAEAAAAAK 830 sp|P08195-2|4F2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7029.11 79.93148 2 1244.5882 1244.5884 K F 47 60 PSM MDATANDVPSDR 831 sp|P13667|PDIA4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6968.11 78.29301 2 1290.5498 1290.5510 K Y 583 595 PSM QTYSTEPNNLK 832 sp|P46779|RL28_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7032.11 80.01144 2 1293.6214 1293.6201 K A 23 34 PSM GTDDSMTLQSQK 833 sp|O00422|SAP18_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6951.11 77.83556 2 1309.5818 1309.5820 K F 115 127 PSM LCTSATESEVAR 834 sp|P31930|QCR1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 2-UNIMOD:4 ms_run[1]:scan=1.1.7113.11 82.20148 2 1322.6134 1322.6136 R G 379 391 PSM LMELHGEGSSSGK 835 sp|P61247|RS3A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6981.8 78.64373 3 1330.6171 1330.6187 K A 228 241 PSM TPCNAGTFSQPEK 836 sp|O43684-2|BUB3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 3-UNIMOD:4 ms_run[1]:scan=1.1.7179.11 83.95865 2 1435.6422 1435.6402 R V 127 140 PSM LQSIGTENTEENR 837 sp|P04075-2|ALDOA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7116.10 82.28014 2 1489.7022 1489.7008 R R 98 111 PSM AEAGPEGVAPAPEGEK 838 sp|Q9Y4L1|HYOU1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7247.11 85.80095 2 1507.7146 1507.7154 K K 670 686 PSM LFQECCPHSTDR 839 sp|P61978|HNRPK_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 5-UNIMOD:4,6-UNIMOD:4 ms_run[1]:scan=1.1.7287.9 86.89748 3 1548.6439 1548.6450 K V 180 192 PSM AAEEAPEEAPEDAAR 840 sp|Q9H9Z2|LN28A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7053.11 80.58183 2 1554.6810 1554.6797 K A 16 31 PSM AEQLGAEGNVDESQK 841 sp|Q9NQ29|LUC7L_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.6956.11 77.96986 2 1573.7246 1573.7220 K I 140 155 PSM LALSQNQQSSGAAGPTGK 842 sp|O95232|LC7L3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7267.11 86.34956 2 1713.8678 1713.8646 R N 107 125 PSM FATHGAALTVK 843 sp|Q8WXF1|PSPC1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7642.5 96.40275 3 1114.6108 1114.6135 R N 151 162 PSM LKDDEVAQLK 844 sp|P07195|LDHB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7507.4 92.73217 3 1157.6272 1157.6292 K K 309 319 PSM SLKDEDVLQK 845 sp|Q9NZ01|TECR_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7699.3 97.95506 3 1173.6205 1173.6241 K L 58 68 PSM DLEAHIDSANK 846 sp|P35579|MYH9_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7484.4 92.10519 3 1211.5762 1211.5782 K N 1621 1632 PSM FACHSASLTVR 847 sp|Q15233-2|NONO_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 3-UNIMOD:4 ms_run[1]:scan=1.1.7673.7 97.25408 3 1247.6107 1247.6081 R N 54 65 PSM LITKPSEGTTLR 848 sp|P49959-3|MRE11_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7486.6 92.1633 3 1314.7480 1314.7507 K V 420 432 PSM LLETTDRPDGHQNNLR 849 sp|Q14974|IMB1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7485.5 92.13413 4 1877.9321 1877.9344 K S 510 526 PSM HYGGLTGLNK 850 sp|P18669|PGAM1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7550.8 93.90975 2 1058.5522 1058.5509 R A 91 101 PSM QADVNLVNAK 851 sp|O43175|SERA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7549.10 93.88578 2 1070.5686 1070.5720 K L 385 395 PSM LQETLSAADR 852 sp|P78527|PRKDC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7550.9 93.91142 2 1102.5614 1102.5618 R C 15 25 PSM VVGCSCVVVK 853 sp|P25398|RS12_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 4-UNIMOD:4,6-UNIMOD:4 ms_run[1]:scan=1.1.7468.7 91.67422 2 1105.5602 1105.5624 K D 103 113 PSM HTGPNSPDTANDGFVR 854 sp|P31943|HNRH1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7646.10 96.5202 3 1683.7528 1683.7601 K L 99 115 PSM AGGPATPLSPTR 855 sp|Q03252|LMNB2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7414.9 90.2698 2 1123.5978 1123.5986 R L 29 41 PSM AGGPTTPLSPTR 856 sp|P20700|LMNB1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7463.11 91.54522 2 1153.6074 1153.6091 R L 15 27 PSM AVEIVTSTSAAK 857 sp|Q14966-3|ZN638_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7555.10 94.04992 2 1175.6354 1175.6398 K T 783 795 PSM LACDVDQVTR 858 sp|P78527|PRKDC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 3-UNIMOD:4 ms_run[1]:scan=1.1.7642.10 96.41109 2 1175.5592 1175.5605 R Q 972 982 PSM KEDALLYQSK 859 sp|P50402|EMD_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7497.10 92.47057 2 1193.6276 1193.6292 K G 79 89 PSM SNFSNSADDIK 860 sp|P45973|CBX5_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7487.9 92.19558 2 1196.5284 1196.5309 K S 92 103 PSM EGALCEENMR 861 sp|P13639|EF2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 5-UNIMOD:4 ms_run[1]:scan=1.1.7446.11 91.09644 2 1207.4952 1207.4961 K G 689 699 PSM EGDVLTPEQAR 862 sp|Q9UKD2|MRT4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7651.11 96.65798 2 1213.5896 1213.5939 K V 178 189 PSM LEGNTVGVEAAR 863 sp|P46060|RAGP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7326.11 87.9668 2 1214.6244 1214.6255 R V 56 68 PSM QAASSLQQASLK 864 sp|P38646|GRP75_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7377.11 89.32238 2 1230.6562 1230.6568 R L 635 647 PSM TNQELQEINR 865 sp|P07355-2|ANXA2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7691.10 97.74955 2 1243.6152 1243.6156 R V 154 164 PSM FACHSASLTVR 866 sp|Q15233-2|NONO_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 3-UNIMOD:4 ms_run[1]:scan=1.1.7692.6 97.77013 3 1247.6107 1247.6081 R N 54 65 PSM INISEGNCPER 867 sp|Q15365|PCBP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 8-UNIMOD:4 ms_run[1]:scan=1.1.7540.6 93.63338 3 1287.5833 1287.5877 R I 47 58 PSM INISEGNCPER 868 sp|Q15365|PCBP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 8-UNIMOD:4 ms_run[1]:scan=1.1.7535.11 93.50539 2 1287.5852 1287.5877 R I 47 58 PSM NSNPALNDNLEK 869 sp|O00299|CLIC1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7714.11 98.37742 2 1327.6342 1327.6368 K G 120 132 PSM NQNSWGTGEDVK 870 sp|P20700|LMNB1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7619.11 95.78415 2 1333.5884 1333.5899 K V 517 529 PSM QLEEEQQALQK 871 sp|P07951-2|TPM2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7549.11 93.88745 2 1342.6708 1342.6728 K K 38 49 PSM RLAPEYEAAATR 872 sp|P30101|PDIA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7566.11 94.35312 2 1346.6932 1346.6942 K L 62 74 PSM IRVDVADQAQDK 873 sp|P23588|IF4B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7544.11 93.75095 2 1356.6976 1356.6997 R D 166 178 PSM YLAEVACGDDRK 874 sp|P27348|1433T_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 7-UNIMOD:4 ms_run[1]:scan=1.1.7379.8 89.36877 3 1395.6463 1395.6452 R Q 128 140 PSM GEDEEENNLEVR 875 sp|P04843|RPN1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7694.10 97.83113 2 1431.6106 1431.6113 K E 90 102 PSM YICENQDSISSK 876 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 3-UNIMOD:4 ms_run[1]:scan=1.1.7351.11 88.63292 2 1442.6380 1442.6347 K L 287 299 PSM QVQHILASASPSGR 877 sp|O94979-2|SC31A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7537.8 93.55485 3 1449.7672 1449.7688 R A 179 193 PSM DPSASPGDAGEQAIR 878 sp|P18206|VINC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7599.10 95.24983 2 1469.6726 1469.6746 R Q 286 301 PSM QCVENADLPEGEK 879 sp|Q99460-2|PSMD1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 2-UNIMOD:4 ms_run[1]:scan=1.1.7692.10 97.7768 2 1487.6562 1487.6562 K K 111 124 PSM ETNISYSQEADDR 880 sp|O00116|ADAS_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7589.11 94.98275 2 1526.6470 1526.6485 K V 170 183 PSM IEQVDKEDEITEK 881 sp|Q9Y2X3|NOP58_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7433.11 90.761 2 1574.7688 1574.7675 K K 445 458 PSM GEPAAAAAPEAGASPVEK 882 sp|P29966|MARCS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7600.11 95.27803 2 1621.7958 1621.7947 K E 88 106 PSM KQPPVSPGTALVGSQK 883 sp|P17096|HMGA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8026.3 106.8563 4 1592.8865 1592.8886 R E 31 47 PSM ASIHEAWTDGK 884 sp|O43707|ACTN4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7962.4 105.1103 3 1213.5700 1213.5727 K E 422 433 PSM GTVIIIANHGDR 885 sp|Q16851|UGPA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8059.2 107.7398 3 1264.6864 1264.6888 K I 474 486 PSM VCALLSCTSHK 886 sp|P15121|ALDR_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 2-UNIMOD:4,7-UNIMOD:4 ms_run[1]:scan=1.1.7830.3 101.4901 3 1274.6092 1274.6111 R D 298 309 PSM VCALLSCTSHK 887 sp|P15121|ALDR_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 2-UNIMOD:4,7-UNIMOD:4 ms_run[1]:scan=1.1.7811.4 100.9755 3 1274.6092 1274.6111 R D 298 309 PSM SSDAFTTQHALR 888 sp|O95239-2|KIF4A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7828.6 101.4408 3 1332.6373 1332.6422 R Q 507 519 PSM EHLLQSNIGTGEK 889 sp|Q5VTR2|BRE1A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8006.7 106.314 3 1424.7256 1424.7259 K E 809 822 PSM HVLVTLGEK 890 sp|P60660-2|MYL6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8039.8 107.2169 2 994.5790 994.5811 R M 111 120 PSM LRSDAGLESDTAMK 891 sp|Q9NR30|DDX21_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7737.8 99.00121 3 1492.7407 1492.7191 K K 5 19 PSM DQTPDENDQVIVK 892 sp|Q9NZI8|IF2B1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8023.6 106.7788 3 1499.7073 1499.7104 R I 526 539 PSM SQAPGQPGASQWGSR 893 sp|Q96EP5-2|DAZP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7770.9 99.88708 3 1512.7039 1512.7070 K V 195 210 PSM ENEVEEVKEEGPK 894 sp|Q8NC51-3|PAIRB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7746.8 99.24758 3 1514.7094 1514.7100 K E 259 272 PSM LDSPAGTALSPSGHTK 895 sp|P32322-3|P5CR1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7856.10 102.2123 3 1537.7710 1537.7736 K L 319 335 PSM AAGIDEQENWHEGK 896 sp|P28838-2|AMPL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8028.9 106.9212 3 1582.7014 1582.7012 K E 74 88 PSM SPDEAYAIAK 897 sp|Q9P2R7-2|SUCB1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7841.7 101.7967 2 1063.5156 1063.5186 K K 57 67 PSM TALIHDGLAR 898 sp|P25398|RS12_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8027.2 106.8821 3 1065.5908 1065.5931 K G 24 34 PSM SVEAAAELSAK 899 sp|P20962|PTMS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7778.8 100.0944 2 1074.5522 1074.5557 K D 5 16 PSM FAEALGSTEAK 900 sp|P78347-2|GTF2I_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7960.6 105.0585 2 1122.5542 1122.5557 K A 437 448 PSM VLTVINQTQK 901 sp|P42766|RL35_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8059.11 107.7548 2 1142.6622 1142.6659 R E 57 67 PSM VLTVINQTQK 902 sp|P42766|RL35_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8055.10 107.6497 2 1142.6622 1142.6659 R E 57 67 PSM VLTVINQTQK 903 sp|P42766|RL35_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8061.10 107.8047 2 1142.6622 1142.6659 R E 57 67 PSM QLQQAQAAGAEQEVEK 904 sp|P39748-2|FEN1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7858.11 102.2686 3 1726.8445 1726.8486 K F 46 62 PSM YLAEVAAGDDK 905 sp|P63104|1433Z_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7927.9 104.1595 2 1150.5496 1150.5506 R K 128 139 PSM YLAEVAAGDDK 906 sp|P63104|1433Z_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7924.7 104.0741 2 1150.5496 1150.5506 R K 128 139 PSM NADLNAQTVVK 907 sp|Q9Y520-4|PRC2C_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7846.8 101.935 2 1171.6156 1171.6197 K V 1516 1527 PSM AAHLCAEAALR 908 sp|Q9UQ80|PA2G4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 5-UNIMOD:4 ms_run[1]:scan=1.1.7759.2 99.58925 3 1181.5945 1181.5975 K L 145 156 PSM AVENSSTAIGIR 909 sp|P25788-2|PSA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8054.2 107.6105 3 1216.6378 1216.6411 K C 30 42 PSM SFGSTCQLSEK 910 sp|P11388-4|TOP2A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 6-UNIMOD:4 ms_run[1]:scan=1.1.7839.11 101.7489 2 1242.5522 1242.5551 K F 468 479 PSM DNKPEEEEQVIHEDDERPSEK 911 sp|Q6VMQ6-2|MCAF1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7997.10 106.0739 4 2551.1325 2551.1310 K N 527 548 PSM FGGLAAGEDNGQR 912 sp|O00116|ADAS_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7920.10 103.9693 2 1290.5922 1290.5953 K G 491 504 PSM VSVADHSLHLSK 913 sp|Q13162|PRDX4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8038.2 107.1796 4 1291.6833 1291.6884 R A 67 79 PSM FSGDLDDQTCR 914 sp|P05455|LA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 10-UNIMOD:4 ms_run[1]:scan=1.1.7827.11 101.4219 2 1312.5328 1312.5354 K E 236 247 PSM FSGDLDDQTCR 915 sp|P05455|LA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 10-UNIMOD:4 ms_run[1]:scan=1.1.7846.10 101.9384 2 1312.5328 1312.5354 K E 236 247 PSM IYIDSNNNPER 916 sp|Q00610-2|CLH1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7789.10 100.3876 2 1333.6232 1333.6262 K F 882 893 PSM SSLEDGCLSCGR 917 sp|Q9UBC3-8|DNM3B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 7-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.8101.11 108.8391 2 1339.5488 1339.5497 K K 367 379 PSM TNLDESDVQPVK 918 sp|Q9Y3I0|RTCB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8058.10 107.7274 2 1343.6546 1343.6569 R E 129 141 PSM SEPIPESNDGPVK 919 sp|P30101|PDIA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7782.11 100.2036 2 1367.6556 1367.6569 K V 367 380 PSM NGQVIGIGAGQQSR 920 sp|P31939-2|PUR9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8020.9 106.701 2 1383.7208 1383.7219 K I 437 451 PSM SSQSSSQQFSGIGR 921 sp|Q92841-1|DDX17_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7915.11 103.8338 2 1454.6716 1454.6750 R S 592 606 PSM EQSICAAEEQPAEDGQGETNK 922 sp|Q9UGP8|SEC63_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 5-UNIMOD:4 ms_run[1]:scan=1.1.7802.11 100.742 3 2289.9640 2289.9655 K N 486 507 PSM RQAVTNPNNTFYATK 923 sp|P38646|GRP75_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7903.11 103.505 2 1723.8634 1723.8642 K R 107 122 PSM ELAQIAGRPTEDEDEK 924 sp|O15355|PPM1G_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7950.10 104.7906 3 1799.8507 1799.8537 K E 113 129 PSM SVDPDSPAEASGLR 925 sp|O14745|NHRF1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8471.10 118.883 2 1399.6584 1399.6579 R A 181 195 PSM GNVFSSPTAAGTPNK 926 sp|Q05682|CALD1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8504.11 119.7841 2 1446.7076 1446.7103 K E 719 734 PSM ALAAGGYDVEK 927 sp|P16401|H15_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8161.3 110.4554 3 1092.5416 1092.5451 K N 68 79 PSM TYHALSNLPK 928 sp|O00231-2|PSD11_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8165.5 110.5677 3 1142.6080 1142.6084 K A 176 186 PSM DHAVVVGVYRPPPK 929 sp|P22087|FBRL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8215.3 111.9229 4 1532.8441 1532.8464 R V 305 319 PSM DHAVVVGVYRPPPK 930 sp|P22087|FBRL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8196.5 111.4131 4 1532.8441 1532.8464 R V 305 319 PSM HGLTEADVGITK 931 sp|Q96PZ0-2|PUS7_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8369.3 116.1035 3 1239.6430 1239.6459 K F 107 119 PSM KPLLESGTLGTK 932 sp|P22314|UBA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8450.7 118.3024 3 1242.7138 1242.7183 R G 593 605 PSM TPVEPEVAIHR 933 sp|P60866-2|RS20_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8296.4 114.1279 3 1246.6651 1246.6670 K I 9 20 PSM EQVANSAFVER 934 sp|P08238|HS90B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8225.6 112.1999 3 1248.6061 1248.6098 K V 492 503 PSM GISVHISNAEPK 935 sp|Q13148|TADBP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8326.5 114.9381 3 1250.6590 1250.6619 K H 252 264 PSM DGSDEPGTAACPNGSFHCTNTGYK 936 sp|P14314-2|GLU2B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 11-UNIMOD:4,18-UNIMOD:4 ms_run[1]:scan=1.1.8509.11 119.9209 3 2542.0216 2542.0125 K P 60 84 PSM AEITLVATKPEK 937 sp|Q9UBF2-2|COPG2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8417.8 117.4086 3 1298.7412 1298.7445 K L 591 603 PSM IQTQPGYANTLR 938 sp|Q00325-2|MPCP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8508.6 119.8852 3 1360.7071 1360.7099 R D 189 201 PSM TSSAQVEGGVHSLHSYEK 939 sp|P12268|IMDH2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8309.5 114.4785 4 1914.9085 1914.9072 R R 494 512 PSM AGDLLEDSPK 940 sp|P51858|HDGF_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8433.6 117.8375 2 1043.5124 1043.5135 R R 158 168 PSM TGLAVTVGQAK 941 sp|Q13428-3|TCOF_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8239.10 112.5892 2 1043.5960 1043.5975 K S 706 717 PSM EQIVPKPEEEVAQK 942 sp|P18621-3|RL17_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8190.9 111.2568 3 1622.8507 1622.8515 K K 154 168 PSM ATAGDTHLGGEDFDNR 943 sp|P0DMV8-2|HS71A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8318.10 114.7299 3 1674.7213 1674.7234 K L 166 182 PSM HLCQQLQAEQAAAEK 944 sp|Q14980|NUMA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 3-UNIMOD:4 ms_run[1]:scan=1.1.8242.8 112.6681 3 1723.8301 1723.8311 K R 1365 1380 PSM DMVGIAQTGSGK 945 sp|Q92841-1|DDX17_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8307.7 114.4281 2 1162.5638 1162.5652 R T 131 143 PSM EGIVQTEQIR 946 sp|Q6P1J9|CDC73_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8375.8 116.2764 2 1171.6178 1171.6197 K S 162 172 PSM VILGSEAAQQHPEEVR 947 sp|Q9NY33-4|DPP3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8496.8 119.561 3 1761.8914 1761.9009 R G 96 112 PSM ALVDGPCTQVR 948 sp|P50914|RL14_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 7-UNIMOD:4 ms_run[1]:scan=1.1.8389.11 116.6656 2 1214.6074 1214.6078 R R 36 47 PSM TPVEPEVAIHR 949 sp|P60866-2|RS20_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8258.11 113.1124 2 1246.6650 1246.6670 K I 9 20 PSM EQVANSAFVER 950 sp|P08238|HS90B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8223.8 112.1486 2 1248.6090 1248.6098 K V 492 503 PSM DLGLAQDSATSTK 951 sp|P31937|3HIDH_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8212.11 111.8549 2 1305.6444 1305.6412 K S 285 298 PSM GLSEDTTEETLK 952 sp|P19338|NUCL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8330.9 115.053 2 1321.6250 1321.6249 K E 578 590 PSM DVQNFPAATDEK 953 sp|O60610|DIAP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8310.8 114.5105 2 1333.6140 1333.6150 R D 1072 1084 PSM QDAQDLYEAGEK 954 sp|P09525-2|ANXA4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8330.10 115.0547 2 1365.6080 1365.6048 R K 91 103 PSM TNHIYVSSDDIK 955 sp|Q6P2Q9|PRP8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8127.8 109.538 2 1390.6718 1390.6729 R E 2087 2099 PSM SQGGEPTYNVAVGR 956 sp|P35080-2|PROF2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8480.10 119.1289 2 1433.6874 1433.6899 K A 92 106 PSM TEGDGVYTLNNEK 957 sp|P00738|HPT_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8367.10 116.0602 2 1438.6580 1438.6576 R Q 119 132 PSM EYAEDDNIYQQK 958 sp|Q96FW1|OTUB1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8379.11 116.3912 2 1514.6546 1514.6525 K I 60 72 PSM HLVGVCYTEDEAK 959 sp|P08574|CY1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 6-UNIMOD:4 ms_run[1]:scan=1.1.8454.6 118.4103 3 1519.6960 1519.6977 R E 134 147 PSM EEGETADTVGCCSLR 960 sp|P11387|TOP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 11-UNIMOD:4,12-UNIMOD:4 ms_run[1]:scan=1.1.8160.11 110.4417 2 1682.6896 1682.6876 K V 494 509 PSM KIDGAEPLTPEETEEK 961 sp|P28370|SMCA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8296.9 114.1363 3 1784.8678 1784.8680 K E 834 850 PSM EESDDEAAVEEEEEEK 962 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8250.11 112.8931 2 1865.7206 1865.7174 K K 304 320 PSM RQAVTNPNNTFYATK 963 sp|P38646|GRP75_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7897.8 103.3353 3 1723.8622 1723.8642 K R 107 122 PSM AEGDVAALNR 964 sp|P67936|TPM4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7156.7 83.35582 2 1014.5104 1014.5094 K R 45 55 PSM SGNALFHASTLHR 965 sp|Q14152-2|EIF3A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8469.6 118.8219 3 1409.7121 1409.7164 K L 252 265 PSM KNSVVEASEAAYK 966 sp|Q04917|1433F_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7657.4 96.80998 3 1394.7037 1394.7041 K E 143 156 PSM DKPHVNVGTIGHVDHGK 967 sp|P49411|EFTU_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7216.6 84.94859 4 1808.9253 1808.9282 R T 54 71 PSM RPELLTHSTTEVTQPR 968 sp|P78347-2|GTF2I_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8278.7 113.6489 4 1863.9757 1863.9803 K T 499 515 PSM KLDYGQHVVAGTPGR 969 sp|P38919|IF4A3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7901.6 103.4419 4 1596.8341 1596.8373 R V 152 167 PSM VTIAQGGVLPNIQAVLLPK 970 sp|P0C0S8|H2A1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.1637.11 10.98443 3 1930.1548 1930.1615 R K 101 120 PSM AGKGEVTFEDVK 971 sp|Q9UJS0-2|CMC2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.8039.7 107.2152 3 1278.6424 1278.6456 K Q 102 114 PSM YVLEDGPEEDRK 972 sp|Q15813-2|TBCE_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 ms_run[1]:scan=1.1.7912.4 103.7401 3 1448.6755 1448.6783 R E 89 101 PSM KPVEEYANCHLAR 973 sp|P02787|TRFE_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 25 9-UNIMOD:4 ms_run[1]:scan=1.1.7519.5 93.06032 4 1585.7681 1585.7671 R A 588 601 PSM QEYDESGPSIVHR 974 sp|Q9BYX7|ACTBM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.8129.7 109.591 3 1517.712971 1515.695386 K K 360 373 PSM FATHAAALSVR 975 sp|P23246|SFPQ_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.8052.8 107.5679 2 1143.619047 1142.619642 R N 366 377 PSM SETAPAAPAAAPPAEK 976 sp|P16403|H12_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 25 1-UNIMOD:1 ms_run[1]:scan=1.1.7995.4 106.0096 3 1519.7512 1519.7513 M A 2 18 PSM SVDPDSPAEASGLR 977 sp|O14745|NHRF1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.8475.6 118.9857 3 1400.680871 1399.657937 R A 181 195 PSM SVDPDSPAEASGLR 978 sp|O14745|NHRF1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.8475.5 118.984 3 1400.680871 1399.657937 R A 181 195 PSM KPEDWDERPK 979 sp|P27824|CALX_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 25 ms_run[1]:scan=1.1.6689.6 70.73611 3 1299.6332 1298.6252 R I 283 293 PSM AELGAGGDGHR 980 sp|Q14244|MAP7_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 25 1-UNIMOD:1 ms_run[1]:scan=1.1.6722.9 71.6457 2 1080.4995 1080.4943 M G 2 13 PSM DCHLAQVPSHTVVAR 981 sp|P02787|TRFE_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 25 2-UNIMOD:4 ms_run[1]:scan=1.1.8291.4 113.9939 4 1689.841294 1688.841673 K S 259 274 PSM MNNSGADEIGK 982 sp|Q96EP5|DAZP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 25 1-UNIMOD:1 ms_run[1]:scan=1.1.8331.10 115.0819 2 1177.5062 1176.5072 - L 1 12 PSM FRPDMEEEEAK 983 sp|Q99436|PSB7_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.7696.4 97.87543 3 1380.608471 1379.602731 K N 185 196 PSM QVHPDTGISSK 984 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 25 1-UNIMOD:28 ms_run[1]:scan=1.1.6969.11 78.32032 2 1150.5623 1150.5613 K A 48 59 PSM SGTVDPQELQK 985 sp|P30626|SORCN_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.7393.5 89.73068 2 1201.600047 1200.598632 R A 117 128 PSM RLEEEEAAAEK 986 sp|Q5T280|CI114_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.6264.6 59.17987 3 1272.610871 1273.615010 K E 56 67 PSM KQEEFDVANNGSSQANK 987 sp|P29144|TPP2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.6974.11 78.45715 3 1863.851171 1864.855134 R L 152 169 PSM YICENQDSISSK 988 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 25 3-UNIMOD:4 ms_run[1]:scan=1.1.7293.9 87.06168 2 1441.624447 1442.634759 K L 287 299 PSM RPGVTGENSNEVAK 989 sp|Q7Z3K3-2|POGZ_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6031.10 52.80382 3 1456.7287 1456.7270 K L 253 267 PSM IDASKNEEDEGHSNSSPR 990 sp|Q14103-3|HNRPD_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.5872.5 48.44738 4 1970.8585 1970.8566 K H 68 86 PSM LEGGSGGDSEVQR 991 sp|P62195-2|PRS8_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6066.11 53.76826 2 1289.5874 1289.5848 R T 251 264 PSM RPLEDGDQPDAK 992 sp|Q96AE4-2|FUBP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6112.8 54.98665 3 1339.6387 1339.6368 K K 65 77 PSM ELNSNHDGADETSEK 993 sp|Q01105-2|SET_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.5861.8 48.15222 3 1644.6850 1644.6863 K E 12 27 PSM YFAGNLASGGAAGATSLCFVYPLDFAR 994 sp|P12236|ADT3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 18-UNIMOD:4 ms_run[1]:scan=1.1.1655.6 11.4168 3 2795.3332 2795.3377 R T 112 139 PSM ELVSDANQHVK 995 sp|P30153|2AAA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6492.5 65.34037 3 1238.6251 1238.6255 K S 332 343 PSM HKSETDTSLIR 996 sp|P40227-2|TCPZ_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6460.4 64.48345 3 1285.6603 1285.6626 K G 153 164 PSM IHEGCEEPATHNALAK 997 sp|Q00610-2|CLH1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 5-UNIMOD:4 ms_run[1]:scan=1.1.6464.5 64.58998 4 1775.8233 1775.8260 R I 866 882 PSM HHIETGGGQLPAK 998 sp|Q92616|GCN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6229.7 58.21298 3 1343.6944 1343.6946 R L 2538 2551 PSM CGETGHVAINCSK 999 sp|P62633-2|CNBP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 1-UNIMOD:4,11-UNIMOD:4 ms_run[1]:scan=1.1.6277.11 59.54797 3 1431.6235 1431.6235 R T 133 146 PSM EDSQRPGAHLTVK 1000 sp|P09651-2|ROA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6363.8 61.89537 3 1436.7370 1436.7372 R K 93 106 PSM HSEAATAQREEWK 1001 sp|Q14103-3|HNRPD_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6498.7 65.50777 3 1541.7205 1541.7222 R M 86 99 PSM CCAAADPHECYAK 1002 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.6314.7 60.56033 3 1551.5929 1551.5905 K V 384 397 PSM TVAQSQQLETNSQR 1003 sp|P40938-2|RFC3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6517.11 66.03678 3 1588.7584 1588.7805 K D 114 128 PSM IINADSEDPK 1004 sp|P35998|PRS7_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6450.10 64.22072 2 1100.5350 1100.5349 K Y 101 111 PSM DAVTYTEHAK 1005 sp|P62805|H4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6363.11 61.90037 2 1133.5348 1133.5353 R R 69 79 PSM QVQQHQGNLDASGPAR 1006 sp|Q96SQ9-2|CP2S1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6226.11 58.13663 3 1704.8290 1704.8292 R D 251 267 PSM LGIHEDSTNR 1007 sp|P08238|HS90B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6326.6 60.8858 3 1140.5554 1140.5523 K R 439 449 PSM VPVHDVTDASK 1008 sp|P21333-2|FLNA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6242.11 58.58117 2 1166.5942 1166.5932 K V 1440 1451 PSM SVSSASEHSTTEPSPAAR 1009 sp|Q9H6K5-2|PRR36_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6133.11 55.57173 3 1799.8300 1799.8286 K R 208 226 PSM IVQAEGEAEAAK 1010 sp|Q99623|PHB2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6453.10 64.30309 2 1214.6146 1214.6142 K M 225 237 PSM SVSGTDVQEECR 1011 sp|P49321|NASP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 11-UNIMOD:4 ms_run[1]:scan=1.1.6397.11 62.79652 2 1365.5840 1365.5831 K E 244 256 PSM QSNASSDVEVEEK 1012 sp|O75475|PSIP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6406.11 63.03693 2 1420.6334 1420.6318 K E 101 114 PSM ESEPQAAAEPAEAK 1013 sp|P80723|BASP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6389.10 62.58627 2 1426.6580 1426.6575 K E 39 53 PSM ESEPQAAAEPAEAK 1014 sp|P80723|BASP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6408.11 63.09145 2 1426.6584 1426.6575 K E 39 53 PSM AGQSAAGAAPGGGVDTR 1015 sp|P21333-2|FLNA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6278.11 59.57563 2 1441.6908 1441.6910 R D 8 25 PSM DSSGQHVDVSPTSQR 1016 sp|Q99798|ACON_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6421.10 63.44257 3 1598.7280 1598.7285 K L 550 565 PSM SVSGTDVQEECREK 1017 sp|P49321|NASP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 11-UNIMOD:4 ms_run[1]:scan=1.1.6241.9 58.55002 3 1622.7229 1622.7206 K G 244 258 PSM RQAEQLSAAGEGGDAGR 1018 sp|Q9NRX1|PNO1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6422.11 63.47028 3 1671.7948 1671.7924 K M 30 47 PSM NYQQNYQNSESGEK 1019 sp|P67809|YBOX1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6456.11 64.38715 2 1687.7086 1687.7074 R N 157 171 PSM NQTAEKEEFEHQQK 1020 sp|P11142|HSP7C_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6157.11 56.22553 3 1744.8007 1744.8016 K E 584 598 PSM GAFGKPQGTVAR 1021 sp|P27635|RL10_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6554.3 67.04 3 1187.6398 1187.6411 R V 117 129 PSM VLANPGNSQVAR 1022 sp|Q14974|IMB1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6751.5 72.43802 3 1224.6559 1224.6575 R V 43 55 PSM RTHNDIIHNENMR 1023 sp|P15311|EZRI_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6591.3 68.05735 4 1648.7845 1648.7852 K Q 547 560 PSM NIEEHASADVEK 1024 sp|P61006|RAB8A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6544.7 66.77171 3 1340.6194 1340.6208 R M 105 117 PSM GPSSVEDIK 1025 sp|P06748-2|NPM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6826.5 74.48016 2 930.4654 930.4658 K A 211 220 PSM IISSIEQKEENK 1026 sp|P62258|1433E_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6871.10 75.70518 3 1416.7417 1416.7460 R G 62 74 PSM AAAAAAALQAK 1027 sp|P36578|RL4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6639.9 69.37397 2 955.5450 955.5450 K S 354 365 PSM AGFAGDDAPR 1028 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6886.6 76.10945 2 975.4412 975.4410 K A 19 29 PSM SGINCPIQK 1029 sp|P61916|NPC2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 5-UNIMOD:4 ms_run[1]:scan=1.1.6800.8 73.78332 2 1015.5110 1015.5121 K D 95 104 PSM APVQPQQSPAAAPGGTDEKPSGK 1030 sp|Q13200|PSMD2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6639.10 69.37563 4 2217.1037 2217.1026 K E 9 32 PSM STTTGHLIYK 1031 sp|Q5VTE0|EF1A3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6904.10 76.58718 2 1119.5908 1119.5924 K C 21 31 PSM LSSQISAGEEK 1032 sp|Q86UE4|LYRIC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6641.10 69.42997 2 1147.5708 1147.5721 K W 293 304 PSM LVSDGNINSDR 1033 sp|Q01082-3|SPTB2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6867.9 75.59368 2 1188.5726 1188.5735 R I 1222 1233 PSM TPSPKEEDEEPESPPEK 1034 sp|Q9H1E3-2|NUCKS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6553.11 67.02592 3 1923.8572 1923.8585 K K 162 179 PSM VLATVTKPVGGDK 1035 sp|Q02878|RL6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6892.6 76.26933 3 1283.7451 1283.7449 K N 88 101 PSM KPALQSSVVATSK 1036 sp|Q9H307|PININ_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6718.11 71.53917 2 1314.7506 1314.7507 K E 109 122 PSM YTQSNSVCYAK 1037 sp|P31939-2|PUR9_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 8-UNIMOD:4 ms_run[1]:scan=1.1.6679.11 70.47045 2 1319.5844 1319.5816 K N 426 437 PSM TEELKPQVEEK 1038 sp|Q9UN86-2|G3BP2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6629.11 69.10343 2 1328.6816 1328.6823 K N 206 217 PSM ETMVTSTTEPSR 1039 sp|P14314-2|GLU2B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6832.11 74.64647 2 1337.6124 1337.6133 K C 485 497 PSM SSPELEDTATSSK 1040 sp|P46013|KI67_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6758.11 72.63876 2 1350.6134 1350.6151 K R 2827 2840 PSM GGPAEGQLQENDR 1041 sp|Q07157-2|ZO1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6626.10 69.01932 2 1369.6216 1369.6222 K V 62 75 PSM CEDLETQTQSEK 1042 sp|O00592-2|PODXL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 1-UNIMOD:4 ms_run[1]:scan=1.1.6561.11 67.24568 2 1466.6184 1466.6195 K Q 312 324 PSM RVLIAAHGNSLR 1043 sp|P18669|PGAM1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7109.2 82.07815 4 1305.7613 1305.7629 K G 180 192 PSM TLHPDLGTDK 1044 sp|P00338-3|LDHA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6977.3 78.52597 3 1095.5560 1095.5560 K D 242 252 PSM RESQSVEEALK 1045 sp|P49915|GUAA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7052.5 80.5446 3 1274.6446 1274.6466 K K 278 289 PSM IIEDQQESLNK 1046 sp|P05455|LA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7151.7 83.22076 3 1315.6618 1315.6619 K W 318 329 PSM GDVTAEEAAGASPAK 1047 sp|P49006|MRP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6934.6 77.36813 3 1372.6447 1372.6470 R A 11 26 PSM AQAAAPASVPAQAPK 1048 sp|P47914|RL29_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7094.6 81.67657 3 1376.7403 1376.7412 K R 135 150 PSM RAGELTEDEVER 1049 sp|P62269|RS18_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7093.6 81.64937 3 1402.6699 1402.6688 K V 55 67 PSM HGFEAASIK 1050 sp|P35580-3|MYH10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7082.6 81.35005 2 958.4872 958.4872 R E 43 52 PSM RQLEEAEEEATR 1051 sp|P35580-3|MYH10_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7047.8 80.4131 3 1459.6909 1459.6902 K A 1905 1917 PSM AAHSEGNTTAGLDMR 1052 sp|P78371-2|TCPB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7102.5 81.89278 3 1529.6920 1529.6892 R E 420 435 PSM AATAAADFTAK 1053 sp|Q9Y3F4-2|STRAP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7285.9 86.84254 2 1036.5192 1036.5189 K V 87 98 PSM EGELTVAQGR 1054 sp|Q03252|LMNB2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7116.8 82.2768 2 1058.5364 1058.5356 R V 139 149 PSM VGSVLQEGCGK 1055 sp|P31040-2|SDHA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 9-UNIMOD:4 ms_run[1]:scan=1.1.7094.8 81.6799 2 1132.5552 1132.5547 R I 480 491 PSM IAVAAQNCYK 1056 sp|P60174|TPIS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 8-UNIMOD:4 ms_run[1]:scan=1.1.7187.10 84.16875 2 1136.5638 1136.5648 K V 97 107 PSM CCTESLVNR 1057 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 1-UNIMOD:4,2-UNIMOD:4 ms_run[1]:scan=1.1.7043.10 80.30737 2 1137.4912 1137.4907 K R 500 509 PSM GGPGGPGGPGGPMGR 1058 sp|Q01844-2|EWS_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6966.10 78.23675 2 1206.5600 1206.5564 R M 399 414 PSM STESLQANVQR 1059 sp|P26373|RL13_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7003.10 79.24658 2 1231.6164 1231.6157 K L 106 117 PSM EAHEPLAVADAK 1060 sp|Q9Y2X3|NOP58_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7153.9 83.27893 2 1249.6300 1249.6302 K L 82 94 PSM EDSSSTEFVEK 1061 sp|O60749-2|SNX2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7181.11 84.0109 2 1256.5438 1256.5408 K R 107 118 PSM EAALVQQEEEK 1062 sp|Q15020-4|SART3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6983.11 78.70351 2 1272.6188 1272.6197 K A 551 562 PSM QTYSTEPNNLK 1063 sp|P46779|RL28_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7012.11 79.48537 2 1293.6214 1293.6201 K A 23 34 PSM AKLEEQAQQIR 1064 sp|P02649|APOE_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7036.11 80.1196 2 1312.7090 1312.7099 R L 259 270 PSM IIEDQQESLNK 1065 sp|P05455|LA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7153.10 83.2806 2 1315.6620 1315.6619 K W 318 329 PSM EAQELSQNSAIK 1066 sp|Q9NR30|DDX21_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7071.10 81.06208 2 1316.6568 1316.6572 K Q 450 462 PSM TIQVDNTDAEGR 1067 sp|P28838-2|AMPL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6947.11 77.72749 2 1317.6180 1317.6161 K L 326 338 PSM KGESQTDIEITR 1068 sp|P49368|TCPG_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7271.11 86.4596 2 1375.6920 1375.6943 K E 249 261 PSM CASQSGMTAYGTR 1069 sp|Q99439|CNN2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 1-UNIMOD:4 ms_run[1]:scan=1.1.6984.11 78.73096 2 1388.5796 1388.5813 K R 175 188 PSM TGQAPGYSYTAANK 1070 sp|P99999|CYC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7301.10 87.28218 2 1427.6680 1427.6681 K N 41 55 PSM AEAGPEGVAPAPEGEK 1071 sp|Q9Y4L1|HYOU1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7266.11 86.322 2 1507.7146 1507.7154 K K 670 686 PSM LFQECCPHSTDR 1072 sp|P61978|HNRPK_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 5-UNIMOD:4,6-UNIMOD:4 ms_run[1]:scan=1.1.7268.11 86.37698 2 1548.6460 1548.6450 K V 180 192 PSM SETAPAETATPAPVEK 1073 sp|P16401|H15_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7190.11 84.25169 2 1597.7868 1597.7835 M S 2 18 PSM SSGHSSSELSPDAVEK 1074 sp|Q9UQ35|SRRM2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6997.11 79.08685 3 1615.7314 1615.7325 R A 1378 1394 PSM VDNSSLTGESEPQTR 1075 sp|P05023-4|AT1A1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7175.11 83.85488 2 1618.7466 1618.7435 K S 213 228 PSM TPASPVVHIR 1076 sp|P14866|HNRPL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7573.4 94.53358 3 1075.6129 1075.6138 K G 98 108 PSM RLAPEYEAAATR 1077 sp|P30101|PDIA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7581.7 94.7577 3 1346.6932 1346.6942 K L 62 74 PSM LDDHALTGASDSR 1078 sp|Q12788|TBL3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7501.6 92.57256 3 1356.6226 1356.6270 R V 616 629 PSM RTEEGPTLSYGR 1079 sp|P43243|MATR3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7712.6 98.31438 3 1364.6656 1364.6684 R D 149 161 PSM LRECELSPGVNR 1080 sp|Q9BXP5-2|SRRT_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 4-UNIMOD:4 ms_run[1]:scan=1.1.7630.8 96.07978 3 1428.7117 1428.7143 R D 487 499 PSM YICENQDSISSK 1081 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 3-UNIMOD:4 ms_run[1]:scan=1.1.7320.8 87.798 3 1442.6365 1442.6347 K L 287 299 PSM SGGASHSELIHNLR 1082 sp|P22061|PIMT_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1000663, ProteinPilot, ] 24 ms_run[1]:scan=1.1.7570.7 94.45637 3 1476.7293706434903 1476.74333832336 K K 5 19 PSM GGEIQPVSVK 1083 sp|P61604|CH10_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7459.8 91.43222 2 1012.5528 1012.5553 K V 57 67 PSM TAVCDIPPR 1084 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 4-UNIMOD:4 ms_run[1]:scan=1.1.7370.7 89.13153 2 1027.5116 1027.5121 K G 351 360 PSM TAVCDIPPR 1085 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 4-UNIMOD:4 ms_run[1]:scan=1.1.7567.8 94.37572 2 1027.5184 1027.5121 K G 351 360 PSM SDALNSAIDK 1086 sp|P35221-2|CTNA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7638.9 96.30027 2 1032.5006 1032.5087 R M 361 371 PSM YLAEVASGEK 1087 sp|Q04917|1433F_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7539.7 93.60775 2 1065.5310 1065.5342 R K 133 143 PSM IMATPEQVGK 1088 sp|P12956-2|XRCC6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7496.8 92.44005 2 1072.5550 1072.5587 K M 411 421 PSM SSPYPTDVAR 1089 sp|Q9ULD0|OGDHL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7619.7 95.77748 2 1091.5206 1091.5247 R V 444 454 PSM EKPTTALLDK 1090 sp|Q12906-7|ILF3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7410.3 90.15405 3 1114.6228 1114.6234 K V 118 128 PSM RGPQLVCTGSDDGTVK 1091 sp|Q96DI7-2|SNR40_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 7-UNIMOD:4 ms_run[1]:scan=1.1.7617.9 95.72678 3 1688.8120 1688.8152 R L 162 178 PSM QLIVANAGDSR 1092 sp|O15355|PPM1G_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7711.7 98.2888 2 1142.6012 1142.6044 K C 340 351 PSM VLIAAHGNSLR 1093 sp|P18669|PGAM1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7626.5 95.96505 3 1149.6589 1149.6618 R G 181 192 PSM AGGPTTPLSPTR 1094 sp|P20700|LMNB1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7482.10 92.06036 2 1153.6074 1153.6091 R L 15 27 PSM NTTGVTEEALK 1095 sp|Q13813|SPTN1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7406.10 90.06133 2 1161.5852 1161.5877 R E 2316 2327 PSM LGSGPDGAEEIK 1096 sp|Q15418-4|KS6A1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7314.8 87.63393 2 1171.5696 1171.5721 R R 289 301 PSM QAQILASEAEK 1097 sp|Q9UJZ1-2|STML2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7455.11 91.33128 2 1186.6172 1186.6193 K A 178 189 PSM TNEAQAIETAR 1098 sp|Q5JXB2|UE2NL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7465.4 91.58767 3 1202.5891 1202.5891 K A 132 143 PSM EGALCEENMR 1099 sp|P13639|EF2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 5-UNIMOD:4 ms_run[1]:scan=1.1.7426.10 90.57943 2 1207.4952 1207.4961 K G 689 699 PSM SGLQTDYATEK 1100 sp|P46013|KI67_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7513.11 92.90717 2 1211.5650 1211.5670 K E 264 275 PSM THEDIEAQIR 1101 sp|O75533|SF3B1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7572.9 94.5145 2 1210.5928 1210.5942 K E 7 17 PSM VEIIANDQGNR 1102 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7407.9 90.08559 2 1227.6208 1227.6207 R I 26 37 PSM EIGQSVDEVEK 1103 sp|Q01082-3|SPTB2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7686.11 97.61553 2 1231.5906 1231.5932 R L 2031 2042 PSM AGYSQGATQYTQAQQTR 1104 sp|Q96KR1|ZFR_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7698.11 97.94125 3 1857.8575 1857.8606 K Q 192 209 PSM ISSDLDGHPVPK 1105 sp|P29401-2|TKT_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7595.11 95.14487 2 1263.6430 1263.6459 K Q 103 115 PSM INISEGNCPER 1106 sp|Q15365|PCBP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 8-UNIMOD:4 ms_run[1]:scan=1.1.7554.10 94.0225 2 1287.5852 1287.5877 R I 47 58 PSM NQNSWGTGEDVK 1107 sp|P20700|LMNB1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7638.11 96.3036 2 1333.5884 1333.5899 K V 517 529 PSM RLAPEYEAAATR 1108 sp|P30101|PDIA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7585.7 94.86698 3 1346.6932 1346.6942 K L 62 74 PSM EATNPPVIQEEK 1109 sp|P30101|PDIA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7449.11 91.17445 2 1353.6760 1353.6776 R P 483 495 PSM NIEELQQQNQR 1110 sp|P12270|TPR_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7525.11 93.23363 2 1398.6866 1398.6851 R L 542 553 PSM DQTPDENDQVVVK 1111 sp|O00425|IF2B3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7459.11 91.43722 2 1485.6924 1485.6947 R I 526 539 PSM VIECSYTSADGQR 1112 sp|Q9UBM7|DHCR7_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 4-UNIMOD:4 ms_run[1]:scan=1.1.7456.11 91.3576 2 1484.6576 1484.6566 K H 377 390 PSM DQTPDENDQVVVK 1113 sp|O00425|IF2B3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7478.11 91.95268 2 1485.6924 1485.6947 R I 526 539 PSM LSSEMNTSTVNSAR 1114 sp|P20700|LMNB1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7510.11 92.82543 2 1495.6916 1495.6936 R E 277 291 PSM LQGQLEQGDDTAAER 1115 sp|Q8NE71-2|ABCF1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7322.11 87.85757 2 1629.7622 1629.7594 R L 359 374 PSM LHYCVSCAIHSK 1116 sp|Q5JNZ5|RS26L_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 4-UNIMOD:4,7-UNIMOD:4 ms_run[1]:scan=1.1.8029.2 106.9367 4 1473.6829 1473.6857 K V 71 83 PSM AGGAAVVITEPEHTK 1117 sp|Q9P258|RCC2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7739.2 99.04594 4 1478.7729 1478.7729 K E 78 93 PSM ERHPGSFDVVHVK 1118 sp|P62701|RS4X_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7980.4 105.6017 4 1505.7717 1505.7739 R D 199 212 PSM TNRPPLSLSR 1119 sp|Q07020-2|RL18_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7801.2 100.6998 3 1139.6374 1139.6411 R M 27 37 PSM FHHTFSTEIAK 1120 sp|P13667|PDIA4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7886.5 103.0284 3 1316.6437 1316.6513 K F 336 347 PSM FGGALDAAAK 1121 sp|P53396|ACLY_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7934.7 104.3478 2 919.4728 919.4763 R M 935 945 PSM SLSSSLDDTEVKK 1122 sp|O95292|VAPB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8060.6 107.7722 3 1407.7051 1407.7093 K V 156 169 PSM NIVEAAAVR 1123 sp|Q5JNZ5|RS26L_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8032.6 107.0246 2 941.5290 941.5294 R D 43 52 PSM IAVAHNGELVNAAR 1124 sp|Q06203|PUR1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8058.6 107.7207 3 1433.7709 1433.7739 K L 117 131 PSM SDPYHATSGALSPAK 1125 sp|P17302|CXA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7841.6 101.7951 3 1500.7180 1500.7209 K D 244 259 PSM VDEVPDGAVKPPTNK 1126 sp|O75475|PSIP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7865.9 102.4573 3 1564.8064 1564.8097 R L 25 40 PSM ATTDPNECLICHR 1127 sp|Q9UJQ4|SALL4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 8-UNIMOD:4,11-UNIMOD:4 ms_run[1]:scan=1.1.7988.7 105.8245 3 1585.6984 1585.6977 K V 561 574 PSM LGAAAADAVTGR 1128 sp|Q9H4A3-2|WNK1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7799.8 100.6553 2 1071.5658 1071.5673 K T 39 51 PSM ICDECNYGSYQGR 1129 sp|Q7RTV0|PHF5A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 2-UNIMOD:4,5-UNIMOD:4 ms_run[1]:scan=1.1.8062.10 107.8306 3 1620.6298 1620.6297 R C 45 58 PSM YLAEVATGEK 1130 sp|P61981|1433G_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7898.10 103.3661 2 1079.5482 1079.5499 R R 133 143 PSM VQAAVGTSAAPVPSDNH 1131 sp|P02649|APOE_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7757.9 99.54908 3 1619.7823 1619.7904 K - 301 318 PSM LKGDDLQAIK 1132 sp|P07910-2|HNRPC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7717.8 98.45448 2 1099.6214 1099.6237 K Q 175 185 PSM VLDNAIETEK 1133 sp|Q01082-3|SPTB2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7830.7 101.4967 2 1130.5798 1130.5819 K M 280 290 PSM TNRPPLSLSR 1134 sp|Q07020-2|RL18_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7782.2 100.1886 3 1139.6374 1139.6411 R M 27 37 PSM VLTVINQTQK 1135 sp|P42766|RL35_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8060.10 107.7789 2 1142.6622 1142.6659 R E 57 67 PSM VLTVINQTQK 1136 sp|P42766|RL35_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8081.10 108.3181 2 1142.6622 1142.6659 R E 57 67 PSM VLTVINQTQK 1137 sp|P42766|RL35_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8057.10 107.7014 2 1142.6622 1142.6659 R E 57 67 PSM MIAAVDTDSPR 1138 sp|Q07812-2|BAX_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8023.11 106.7871 2 1174.5636 1174.5652 R E 79 90 PSM IQETQAELPR 1139 sp|Q14566|MCM6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7911.10 103.7226 2 1183.6172 1183.6197 R G 208 218 PSM SGQGAFGNMCR 1140 sp|P36578|RL4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 10-UNIMOD:4 ms_run[1]:scan=1.1.7968.10 105.2846 2 1183.4864 1183.4863 R G 87 98 PSM GAVAEDGDELRTEPEAK 1141 sp|P27695|APEX1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7765.10 99.75853 3 1785.8350 1785.8381 K K 8 25 PSM VESLDVDSEAK 1142 sp|P49321|NASP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7824.11 101.3408 2 1190.5640 1190.5666 K K 34 45 PSM VVAEVYDQER 1143 sp|Q9UHX1-2|PUF60_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7777.10 100.0715 2 1206.5854 1206.5881 K F 525 535 PSM LGGGLGVAGGNSTR 1144 sp|Q9NPJ6|MED4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7730.9 98.81152 2 1214.6406 1214.6368 R E 14 28 PSM HIDLVEGDEGR 1145 sp|P19367-4|HXK1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7956.10 104.9554 2 1238.5880 1238.5891 R M 232 243 PSM NFSDNQLQEGK 1146 sp|P37802-2|TAGL2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7786.10 100.3069 2 1278.5814 1278.5840 R N 182 193 PSM MDSTANEVEAVK 1147 sp|P07237|PDIA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7730.10 98.81319 2 1292.5904 1292.5918 K V 425 437 PSM VVIQSNDDIASR 1148 sp|Q93008-1|USP9X_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7937.11 104.4365 2 1315.6714 1315.6732 R A 777 789 PSM HQEGEIFDTEK 1149 sp|Q02878|RL6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7935.6 104.3736 3 1331.5984 1331.5993 R E 227 238 PSM EAGDVCYADVQK 1150 sp|Q13242|SRSF9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 6-UNIMOD:4 ms_run[1]:scan=1.1.7841.9 101.8001 2 1353.5862 1353.5871 R D 133 145 PSM TKQDEVNAAWQR 1151 sp|Q13813|SPTN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7782.7 100.197 3 1444.7023 1444.7059 K L 228 240 PSM EFHLNESGDPSSK 1152 sp|Q01105-2|SET_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8019.11 106.6769 2 1445.6404 1445.6423 K S 142 155 PSM GDATVSYEDPPTAK 1153 sp|Q01844-2|EWS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7864.11 102.4331 2 1449.6594 1449.6624 K A 338 352 PSM LHYCVSCAIHSK 1154 sp|Q5JNZ5|RS26L_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 4-UNIMOD:4,7-UNIMOD:4 ms_run[1]:scan=1.1.8041.8 107.2711 3 1473.6703 1473.6857 K V 71 83 PSM YNLDASEEEDSNK 1155 sp|O95218-2|ZRAB2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7823.10 101.3119 2 1512.6202 1512.6216 K K 183 196 PSM VQAAVGTSAAPVPSDNH 1156 sp|P02649|APOE_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7762.11 99.68201 2 1619.7888 1619.7904 K - 301 318 PSM ELDVEEAHAASTEEK 1157 sp|Q96C86|DCPS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7841.11 101.8034 2 1656.7436 1656.7478 R E 14 29 PSM QLQQAQAAGAEQEVEK 1158 sp|P39748-2|FEN1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7859.10 102.2943 2 1726.8480 1726.8486 K F 46 62 PSM SQSSIVPEEEQAANKGEEK 1159 sp|Q969G3-2|SMCE1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7821.11 101.2592 3 2058.9655 2058.9705 R K 314 333 PSM QESENSCNKEEEPVFTR 1160 sp|Q9Y520-4|PRC2C_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 7-UNIMOD:4 ms_run[1]:scan=1.1.7876.11 102.7638 3 2081.8900 2081.8960 K Q 614 631 PSM SGNALFHASTLHR 1161 sp|Q14152-2|EIF3A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8476.2 119.0063 4 1409.7153 1409.7164 K L 252 265 PSM DKLDETGVALK 1162 sp|Q02880-2|TOP2B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8248.3 112.8247 3 1187.6380 1187.6398 K V 293 304 PSM PSDLHLQTGYK 1163 sp|P24928|RPB1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8169.5 110.6769 3 1257.6301 1257.6353 K V 435 446 PSM ITDSAGHILYSK 1164 sp|P49755|TMEDA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8240.4 112.6067 3 1303.6726 1303.6772 K E 76 88 PSM AAECNIVVTQPR 1165 sp|Q08211|DHX9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 4-UNIMOD:4 ms_run[1]:scan=1.1.8222.7 112.1198 3 1356.6808 1356.6820 R R 435 447 PSM ERIEIEQNYAK 1166 sp|Q5T0N5-2|FBP1L_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8373.2 116.2113 3 1391.7004 1391.7044 K Q 34 45 PSM QDPSVLHTEEMR 1167 sp|Q8NFI4|F10A5_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8317.6 114.6963 3 1440.6664 1440.6667 K F 18 30 PSM SGVSLAALKK 1168 sp|P10412|H14_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8432.3 117.8053 3 972.5953 972.5968 R A 55 65 PSM NSHCAQTVSSVFK 1169 sp|Q9H583|HEAT1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 4-UNIMOD:4 ms_run[1]:scan=1.1.8222.8 112.1214 3 1463.6815 1463.6827 K G 1140 1153 PSM ILTGHTQSVTCLR 1170 sp|Q9NVX2|NLE1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 11-UNIMOD:4 ms_run[1]:scan=1.1.8348.4 115.5318 3 1484.7721 1484.7770 R W 241 254 PSM TGIDLGTTGR 1171 sp|Q14498-2|RBM39_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8367.6 116.0535 2 989.5118 989.5142 R L 347 357 PSM DDDIEEGDLPEHK 1172 sp|Q14696|MESD_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8351.6 115.6169 3 1510.6387 1510.6423 K R 73 86 PSM LGAHQLDSYSEDAK 1173 sp|Q16651|PRSS8_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8260.7 113.1603 3 1532.7097 1532.7107 K V 100 114 PSM AREQAEAEVASLNR 1174 sp|P06753-2|TPM3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8207.8 111.7146 3 1542.7702 1542.7750 R R 41 55 PSM YEQGTGCWQGPNR 1175 sp|P14314-2|GLU2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 7-UNIMOD:4 ms_run[1]:scan=1.1.8328.7 114.9956 3 1551.6526 1551.6525 K S 462 475 PSM ALAAAGYDVEK 1176 sp|P10412|H14_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8405.3 117.0784 3 1106.5594 1106.5608 K N 65 76 PSM SSDEAVILCK 1177 sp|Q9UNM6-2|PSD13_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 9-UNIMOD:4 ms_run[1]:scan=1.1.8419.10 117.4661 2 1120.5400 1120.5434 K T 108 118 PSM ELVSCSNCTDYQAR 1178 sp|P49591|SYSC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 5-UNIMOD:4,8-UNIMOD:4 ms_run[1]:scan=1.1.8136.9 109.7851 3 1701.7078 1701.7087 R R 391 405 PSM GSFSDTGLGDGK 1179 sp|Q9Y2W1|TR150_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8172.10 110.7671 2 1139.5066 1139.5095 K M 376 388 PSM LFPVCHDSDESDTAK 1180 sp|Q9Y6K1|DNM3A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 5-UNIMOD:4 ms_run[1]:scan=1.1.8164.10 110.5487 3 1719.7426 1719.7410 K A 383 398 PSM IGSTIDDTISK 1181 sp|Q14677-2|EPN4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8344.9 115.4315 2 1148.5904 1148.5925 K F 190 201 PSM GGGFGGNDNFGR 1182 sp|P09651-2|ROA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8495.8 119.5337 2 1153.4882 1153.4901 R G 207 219 PSM IQEVADELQK 1183 sp|P18085|ARF4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8446.11 118.1994 2 1171.6052 1171.6084 R M 100 110 PSM LSSNAVSQITR 1184 sp|Q9BQ39|DDX50_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8407.8 117.1398 2 1174.6300 1174.6306 K M 612 623 PSM NAMGSLASQATK 1185 sp|P55036|PSMD4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8343.9 115.4043 2 1177.5748 1177.5761 R D 354 366 PSM DNSTMGYMAAK 1186 sp|P07900-2|HS90A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8234.8 112.4489 2 1187.4918 1187.4951 R K 743 754 PSM FAAATGATPIAGR 1187 sp|P08865|RSSA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8354.10 115.7052 2 1202.6394 1202.6408 K F 90 103 PSM AADLNGDLTATR 1188 sp|Q15293-2|RCN1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8476.9 119.018 2 1216.6008 1216.6048 K E 126 138 PSM KPLLESGTLGTK 1189 sp|P22314|UBA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8445.10 118.1704 2 1242.7146 1242.7183 R G 593 605 PSM ASTNLQDQLEK 1190 sp|Q9NUL3-2|STAU2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8329.8 115.0243 2 1245.6178 1245.6201 K T 345 356 PSM EQVANSAFVER 1191 sp|P08238|HS90B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8242.11 112.6731 2 1248.6090 1248.6098 K V 492 503 PSM VDVTEQPGLSGR 1192 sp|Q9H3N1|TMX1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8230.11 112.3446 2 1256.6332 1256.6361 K F 83 95 PSM AVAGNISDPGLQK 1193 sp|P18206|VINC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8149.10 110.141 2 1268.6702 1268.6725 K S 803 816 PSM GGELVYTDSEAR 1194 sp|Q15149|PLEC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8307.9 114.4314 2 1295.5996 1295.5993 K D 3028 3040 PSM PGVAAPPEVAPAPK 1195 sp|Q9Y520-4|PRC2C_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8445.11 118.172 2 1299.7190 1299.7187 K S 106 120 PSM ELRDEEQTAESIK 1196 sp|Q14566|MCM6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8212.10 111.8532 3 1546.7437 1546.7474 K N 314 327 PSM AAAAAWEEPSSGNGTAR 1197 sp|Q9P258|RCC2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8267.11 113.3574 2 1644.7518 1644.7492 K A 6 23 PSM IHGTEEGQQILK 1198 sp|Q14980|NUMA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7520.5 93.08757 3 1351.7071 1351.7096 R Q 43 55 PSM IEDVGSDEEDDSGKDK 1199 sp|P08238|HS90B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6272.11 59.40955 3 1736.7229 1736.7224 K K 250 266 PSM RPAEDMEEEQAFK 1200 sp|P61978|HNRPK_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8281.9 113.7332 3 1578.6985 1578.6984 K R 22 35 PSM QQREDITQSAQHALR 1201 sp|Q12906-7|ILF3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8053.4 107.5882 4 1779.8933 1779.8976 R L 309 324 PSM AEGDVAALNR 1202 sp|P67936|TPM4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7176.7 83.8741 2 1014.5104 1014.5094 K R 45 55 PSM AAAAAWEEPSSGNGTAR 1203 sp|Q9P258|RCC2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8251.10 112.9187 3 1644.7462 1644.7492 K A 6 23 PSM QLTAHLQDVNR 1204 sp|Q14203-2|DCTN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7875.2 102.7215 3 1293.6748 1293.6789 R E 388 399 PSM QADVNLVNAK 1205 sp|O43175|SERA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7568.9 94.40473 2 1070.5686 1070.5720 K L 385 395 PSM KPALQSSVVATSK 1206 sp|Q9H307|PININ_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6711.8 71.3426 3 1314.7513 1314.7507 K E 109 122 PSM GTQGATAGASSELDASK 1207 sp|O76094|SRP72_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.6959.8 78.0451 3 1549.7224 1549.7220 K T 601 618 PSM AGAGMITQHSSNASPINR 1208 sp|Q9NWH9|SLTM_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7911.11 103.7242 3 1810.8706 1810.8744 R I 989 1007 PSM HELQANCYEEVK 1209 sp|P23528|COF1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 7-UNIMOD:4 ms_run[1]:scan=1.1.7728.7 98.75333 3 1518.6775 1518.6773 K D 133 145 PSM DGGFCEVCK 1210 sp|P07602-2|SAP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 5-UNIMOD:4,8-UNIMOD:4 ms_run[1]:scan=1.1.7654.6 96.73135 2 1070.4154 1070.4161 K K 407 416 PSM VVQVSAGDSHTAALTDDGR 1211 sp|P18754-2|RCC1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.8463.9 118.6626 3 1897.9084 1897.9130 K V 152 171 PSM TNEAQAIETAR 1212 sp|Q5JXB2|UE2NL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7480.4 91.99574 3 1202.5891 1202.5891 K A 132 143 PSM TFQGHTNEVNAIK 1213 sp|Q9BZK7|TBL1R_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 ms_run[1]:scan=1.1.7356.7 88.75895 3 1457.7241 1457.7263 K W 344 357 PSM ERVCNLIDSGTK 1214 sp|Q02252-2|MMSA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 4-UNIMOD:4 ms_run[1]:scan=1.1.8404.7 117.0585 3 1390.6879 1390.6875 K E 352 364 PSM KLVIVGDGACGK 1215 sp|P08134|RHOC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 24 10-UNIMOD:4 ms_run[1]:scan=1.1.7757.3 99.53909 3 1215.6619 1215.6646 K T 7 19 PSM CCAAADPHECYAK 1216 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 24 1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.7838.6 101.7133 3 1534.5596 1534.5634 K V 384 397 PSM NPVMELNEK 1217 sp|Q12906|ILF3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.8446.8 118.1944 2 1073.522647 1072.522295 K R 527 536 PSM MESYHKPDQQK 1218 sp|P29401|TKT_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 24 1-UNIMOD:1 ms_run[1]:scan=1.1.6640.10 69.40287 2 1431.6439 1431.6447 - L 1 12 PSM HTGPNSPDTANDGFVR 1219 sp|P31943|HNRH1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.7775.10 100.0197 3 1684.742171 1683.760111 K L 99 115 PSM TAVCDIPPR 1220 sp|Q13885|TBB2A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 24 4-UNIMOD:4 ms_run[1]:scan=1.1.7900.10 103.4211 2 1028.508447 1027.512065 K G 351 360 PSM QSNASSDVEVEEK 1221 sp|O75475|PSIP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 24 1-UNIMOD:28 ms_run[1]:scan=1.1.7422.9 90.47532 2 1403.6051 1403.6047 K E 101 114 PSM SETAPAAPAAAPPAEK 1222 sp|P16403|H12_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 24 1-UNIMOD:1 ms_run[1]:scan=1.1.7973.9 105.4193 3 1519.7512 1519.7513 M A 2 18 PSM TTEVGSVSEVKK 1223 sp|O43491-4|E41L2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 24 1-UNIMOD:1 ms_run[1]:scan=1.1.7905.10 103.5583 2 1304.6815 1304.6818 M D 2 14 PSM SETAPAETATPAPVEK 1224 sp|P16401|H15_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 24 1-UNIMOD:1 ms_run[1]:scan=1.1.8291.10 114.0039 2 1639.7956 1639.7936 M S 2 18 PSM AAHGGSAASSALK 1225 sp|O94888|UBXN7_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 24 1-UNIMOD:1 ms_run[1]:scan=1.1.6444.11 64.05785 2 1168.5819 1168.5831 M G 2 15 PSM AAGGDHGSPDSYR 1226 sp|P30566|PUR8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 24 1-UNIMOD:1 ms_run[1]:scan=1.1.6656.10 69.83875 2 1330.5531 1330.5533 M S 2 15 PSM ATETVELHK 1227 sp|P82979|SARNP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 24 1-UNIMOD:1 ms_run[1]:scan=1.1.7828.8 101.4441 2 1068.5427 1068.5446 M L 2 11 PSM SGSSSVAAMK 1228 sp|P63218|GBG5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 24 1-UNIMOD:1 ms_run[1]:scan=1.1.7006.7 79.32073 2 965.4492 965.4483 M K 2 12 PSM RQLEEAEEEAQR 1229 sp|P35579|MYH9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.6828.8 74.53715 3 1485.704471 1486.701199 K A 1877 1889 PSM EATTDFTVDSR 1230 sp|O75369|FLNB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.8443.11 118.1174 2 1240.554247 1240.557161 R P 1246 1257 PSM KYHNVGLSK 1231 sp|Q14103-3|HNRPD_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6062.3 53.64618 3 1044.5725 1044.5716 K C 243 252 PSM EEASGSSVTAEEAKK 1232 sp|P13010|XRCC5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6008.7 52.16113 3 1521.7147 1521.7158 K F 689 704 PSM PVHHGVNQLK 1233 sp|P61313|RL15_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.5885.5 48.79487 3 1127.6248 1127.6200 K F 84 94 PSM PVHHGVNQLK 1234 sp|P61313|RL15_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.5904.3 49.31093 3 1127.6248 1127.6200 K F 84 94 PSM EGVHGGLINKK 1235 sp|P07737|PROF1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6111.11 54.96397 2 1150.6462 1150.6458 K C 117 128 PSM HADIVTTTTHK 1236 sp|P34897-2|GLYM_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6021.7 52.5222 3 1222.6315 1222.6306 K T 260 271 PSM VSQGVEDGPDTK 1237 sp|Q9UBE0-2|SAE1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6070.9 53.87397 2 1230.5642 1230.5728 K R 184 196 PSM TVTAMDVVYALK 1238 sp|P62805|H4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.1638.10 11.01025 2 1309.6904 1309.6952 K R 81 93 PSM NDKSEEEQSSSSVK 1239 sp|P07910-2|HNRPC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.5681.2 44.3229 3 1552.6861 1552.6852 K K 217 231 PSM LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK 1240 sp|P06748-2|NPM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.1639.11 11.03942 4 3722.1869 3722.1951 K A 158 190 PSM YHTINGHNAEVR 1241 sp|P22626-2|ROA2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6323.4 60.80405 4 1409.6817 1409.6800 K K 162 174 PSM YHTINGHNAEVR 1242 sp|P22626-2|ROA2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6304.5 60.28202 4 1409.6817 1409.6800 K K 162 174 PSM EDSQRPGAHLTVK 1243 sp|P09651-2|ROA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6362.3 61.85935 4 1436.7377 1436.7372 R K 93 106 PSM ILHNDPEVEK 1244 sp|Q9UKE5-2|TNIK_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6313.6 60.53105 3 1192.5892 1192.6088 K K 1093 1103 PSM QKPITPETAEK 1245 sp|P60953|CDC42_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6124.7 55.31658 3 1240.6678 1240.6663 K L 134 145 PSM NNRPSEGPLQTR 1246 sp|Q00610-2|CLH1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6438.7 63.88675 3 1367.6884 1367.6906 K L 572 584 PSM YHTINGHNAEVR 1247 sp|P22626-2|ROA2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6323.9 60.81238 3 1409.6803 1409.6800 K K 162 174 PSM YHTINGHNAEVR 1248 sp|P22626-2|ROA2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6304.9 60.28868 3 1409.6806 1409.6800 K K 162 174 PSM ATAPQTQHVSPMR 1249 sp|P29692-3|EF1D_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6485.7 65.15193 3 1422.7015 1422.7038 R Q 100 113 PSM VEAKPEVQSQPPR 1250 sp|Q9UN86-2|G3BP2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6278.5 59.56563 3 1463.7718 1463.7732 R V 245 258 PSM ADAEGESDLENSRK 1251 sp|Q9Y490|TLN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6328.7 60.94036 3 1519.6774 1519.6750 K L 842 856 PSM SQKEEDEQEDLTK 1252 sp|Q92922|SMRC1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6230.11 58.24743 3 1577.7073 1577.7056 R D 357 370 PSM YHTINGHNCEVK 1253 sp|P51991|ROA3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 9-UNIMOD:4 ms_run[1]:scan=1.1.6190.3 57.12435 4 1470.6689 1470.6674 K K 188 200 PSM ALTQTGGPHVK 1254 sp|P21333-2|FLNA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6184.4 56.95985 3 1107.6064 1107.6037 R A 1284 1295 PSM LGIHEDSTNR 1255 sp|P08238|HS90B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6325.7 60.86113 3 1140.5554 1140.5523 K R 439 449 PSM LGIHEDSTNR 1256 sp|P08238|HS90B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6327.2 60.90543 3 1140.5554 1140.5523 K R 439 449 PSM HEEFEEGCK 1257 sp|Q9HC38-2|GLOD4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 8-UNIMOD:4 ms_run[1]:scan=1.1.6223.11 58.05353 2 1163.4622 1163.4553 R A 34 43 PSM HPAKPDPSGECNPDLR 1258 sp|Q16576-2|RBBP7_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 11-UNIMOD:4 ms_run[1]:scan=1.1.6504.10 65.67706 3 1788.8185 1788.8213 K L 200 216 PSM DSYVGDEAQSK 1259 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6453.9 64.30141 2 1197.5162 1197.5150 K R 51 62 PSM ETCFAEEGKK 1260 sp|P02768|ALBU_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 3-UNIMOD:4 ms_run[1]:scan=1.1.6223.4 58.04187 3 1197.5359 1197.5336 K L 589 599 PSM QQEQADSLER 1261 sp|Q14980|NUMA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6332.11 61.05392 2 1202.5504 1202.5527 K S 1139 1149 PSM IVQAEGEAEAAK 1262 sp|Q99623|PHB2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6434.11 63.78442 2 1214.6146 1214.6142 K M 225 237 PSM GHLENNPALEK 1263 sp|P05388-2|RLA0_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6490.11 65.29565 2 1220.6134 1220.6149 R L 67 78 PSM GGNASGEPGLDQR 1264 sp|Q7LBC6|KDM3B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6476.10 64.91132 2 1256.5726 1256.5745 K A 326 339 PSM IDRTDAISEEK 1265 sp|Q9NR31-2|SAR1A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6507.10 65.75965 2 1275.6328 1275.6306 K L 93 104 PSM QRPQATAEQIR 1266 sp|Q14157-1|UBP2L_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6250.10 58.80055 2 1296.6920 1296.6898 K L 27 38 PSM TSAGTTDPEEATR 1267 sp|Q14244-7|MAP7_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6123.11 55.29565 2 1334.5950 1334.5950 K L 491 504 PSM QSSGASSSSFSSSR 1268 sp|O00571-2|DDX3X_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6156.11 56.19778 2 1360.5880 1360.5855 R A 588 602 PSM KVEEEEDESALK 1269 sp|Q14566|MCM6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6514.11 65.95415 2 1404.6616 1404.6620 R R 733 745 PSM TCNCETEDYGEK 1270 sp|Q00839|HNRPU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 2-UNIMOD:4,4-UNIMOD:4 ms_run[1]:scan=1.1.6316.11 60.62225 2 1504.5482 1504.5446 K F 388 400 PSM TCNCETEDYGEK 1271 sp|Q00839|HNRPU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 2-UNIMOD:4,4-UNIMOD:4 ms_run[1]:scan=1.1.6297.11 60.1009 2 1504.5482 1504.5446 K F 388 400 PSM AQAVSEEEEEEEGK 1272 sp|Q9GZR7|DDX24_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6450.11 64.22238 2 1562.6592 1562.6583 K S 78 92 PSM ENQQATSGPNQPSVR 1273 sp|P16989-2|YBOX3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6204.11 57.52655 2 1611.7608 1611.7601 K R 243 258 PSM ERNTDQASMPDNTAAQK 1274 sp|P35579|MYH9_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6243.10 58.6073 3 1875.8410 1875.8381 K V 357 374 PSM AGFAGDDAPR 1275 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6908.2 76.67725 3 975.4396 975.4410 K A 19 29 PSM ANGTTVHVGIHPSK 1276 sp|P61254|RL26_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6585.4 67.89323 4 1416.7477 1416.7474 K V 90 104 PSM ALHHGIDLEK 1277 sp|P14868|SYDC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6831.3 74.60692 3 1131.6031 1131.6036 R I 442 452 PSM GAGTDDHTLIR 1278 sp|P08758|ANXA5_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6789.2 73.4711 3 1154.5669 1154.5680 K V 261 272 PSM GAGTDDHTLIR 1279 sp|P08758|ANXA5_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6787.6 73.42278 3 1154.5669 1154.5680 K V 261 272 PSM AFHNEAQVNPER 1280 sp|P17987|TCPA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6616.8 68.74384 3 1410.6643 1410.6640 R K 469 481 PSM AAAAAAALQAK 1281 sp|P36578|RL4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6640.6 69.3962 2 955.5450 955.5450 K S 354 365 PSM AAAAAAALQAK 1282 sp|P36578|RL4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6638.8 69.34492 2 955.5450 955.5450 K S 354 365 PSM VMSQNFTNCHTK 1283 sp|Q13283|G3BP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 9-UNIMOD:4 ms_run[1]:scan=1.1.6830.8 74.58915 3 1465.6450 1465.6442 K I 65 77 PSM LLADQAEAR 1284 sp|P84098|RL19_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6778.9 73.18093 2 985.5176 985.5192 K R 154 163 PSM YVLHCQGTEEEK 1285 sp|P62495-2|ERF1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 5-UNIMOD:4 ms_run[1]:scan=1.1.6752.9 72.47217 3 1491.6679 1491.6664 R I 298 310 PSM ADDKETCFAEEGK 1286 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 7-UNIMOD:4 ms_run[1]:scan=1.1.6799.9 73.7575 3 1498.6255 1498.6246 K K 585 598 PSM TPGPGAQSALR 1287 sp|P62263|RS14_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6768.9 72.90701 2 1053.5556 1053.5567 K A 107 118 PSM VGAAEEELQK 1288 sp|Q9P2E9|RRBP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6752.10 72.47383 2 1072.5396 1072.5400 K S 1160 1170 PSM IANPVEGSSGR 1289 sp|Q15365|PCBP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6842.10 74.9118 2 1085.5452 1085.5465 K Q 315 326 PSM NPQNSTVLAR 1290 sp|Q13428-3|TCOF_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6576.9 67.6539 2 1098.5768 1098.5782 R G 833 843 PSM NKYEDEINK 1291 sp|P05787-2|K2C8_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6655.9 69.80983 2 1151.5472 1151.5458 R R 205 214 PSM LTQDQDVDVK 1292 sp|P30153|2AAA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6590.9 68.03972 2 1159.5700 1159.5721 K Y 567 577 PSM EGVKFDESEK 1293 sp|P14625|ENPL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6861.10 75.43066 2 1166.5430 1166.5455 K T 594 604 PSM SADEQSIYEK 1294 sp|Q9H4L7-2|SMRCD_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6853.10 75.21163 2 1168.5274 1168.5248 K E 696 706 PSM PAHSQNQSNFSSYSSK 1295 sp|Q07157-2|ZO1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6642.10 69.4571 3 1767.7816 1767.7812 K G 1306 1322 PSM HQGVMVGMGQK 1296 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 5-UNIMOD:35 ms_run[1]:scan=1.1.6911.11 76.76988 2 1186.5580 1186.5587 R D 40 51 PSM QVENAGAIGPSR 1297 sp|Q9UHD8|SEPT9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6750.9 72.41721 2 1197.6084 1197.6102 K F 118 130 PSM AVSEEQQPALK 1298 sp|Q8NE71-2|ABCF1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6685.11 70.63509 2 1198.6180 1198.6193 K G 164 175 PSM EDIYSGGGGGGSR 1299 sp|Q13151|ROA0_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6564.11 67.328 2 1210.5208 1210.5215 K S 177 190 PSM EDIYSGGGGGGSR 1300 sp|Q13151|ROA0_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6545.10 66.80423 2 1210.5208 1210.5215 K S 177 190 PSM AAMDNSEIAGEK 1301 sp|Q16891-2|MIC60_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6907.10 76.66473 2 1234.5452 1234.5499 K K 247 259 PSM HLIPAANTGESK 1302 sp|P62258|1433E_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6628.10 69.0743 2 1236.6480 1236.6462 K V 107 119 PSM SEGDGTQDIVDK 1303 sp|Q5UIP0|RIF1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6817.11 74.25283 2 1262.5592 1262.5627 K S 1513 1525 PSM GGGEQETQELASK 1304 sp|Q96QR8|PURB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6581.11 67.79482 2 1332.6042 1332.6157 R R 25 38 PSM GAQTQTEEEMTR 1305 sp|Q12841|FSTL1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6599.11 68.29072 2 1379.5996 1379.5987 K Y 274 286 PSM STTSVSEEDVSSR 1306 sp|Q96IZ0|PAWR_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6669.11 70.19624 2 1382.6172 1382.6161 K Y 228 241 PSM EVYQQQQYGSGGR 1307 sp|Q99729-2|ROAA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6877.7 75.86495 3 1498.6786 1498.6801 K G 233 246 PSM RLEIEHSVPK 1308 sp|Q9NZI8|IF2B1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7297.2 87.1595 4 1206.6705 1206.6720 K K 67 77 PSM ALTHIDHSLSR 1309 sp|P56192|SYMC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7036.2 80.1046 4 1248.6589 1248.6575 R Q 120 131 PSM LDPHNHVLYSNR 1310 sp|P31948|STIP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7276.2 86.58275 4 1463.7265 1463.7269 K S 33 45 PSM HQGVMVGMGQK 1311 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 5-UNIMOD:35,8-UNIMOD:35 ms_run[1]:scan=1.1.6946.3 77.68715 3 1202.5534 1202.5536 R D 40 51 PSM QEPERNECFLQHK 1312 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 8-UNIMOD:4 ms_run[1]:scan=1.1.7280.6 86.69987 4 1713.7893 1713.7893 K D 118 131 PSM QTYSTEPNNLK 1313 sp|P46779|RL28_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7035.5 80.08242 3 1293.6214 1293.6201 K A 23 34 PSM LMELHGEGSSSGK 1314 sp|P61247|RS3A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6962.6 78.12217 3 1330.6171 1330.6187 K A 228 241 PSM VQIAANEETQER 1315 sp|P49321|NASP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6982.9 78.67281 3 1386.6763 1386.6739 K E 456 468 PSM EVAGHTEQLQMSR 1316 sp|P08727|K1C19_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7297.7 87.16783 3 1484.7019 1484.7042 R S 281 294 PSM TVAVITSDGR 1317 sp|O95777|LSM8_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7223.7 85.1391 2 1017.5456 1017.5455 R M 12 22 PSM TAVCDIPPR 1318 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 4-UNIMOD:4 ms_run[1]:scan=1.1.7273.10 86.51307 2 1027.5124 1027.5121 K G 351 360 PSM TAVCDIPPR 1319 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 4-UNIMOD:4 ms_run[1]:scan=1.1.7254.8 85.98775 2 1027.5130 1027.5121 K G 351 360 PSM TVPVEAVTSK 1320 sp|Q14247|SRC8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7242.8 85.65918 2 1029.5696 1029.5706 K T 337 347 PSM QLETLGQEK 1321 sp|P05787-2|K2C8_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7177.7 83.90005 2 1044.5452 1044.5451 R L 178 187 PSM DPSQQELPR 1322 sp|P49327|FAS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7067.8 80.95268 2 1068.5208 1068.5200 R L 1172 1181 PSM VDNSSLTGESEPQTR 1323 sp|P05023-4|AT1A1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7187.7 84.16375 3 1618.7428 1618.7435 K S 213 228 PSM EKEDAQEVELQEGK 1324 sp|Q02952-2|AKA12_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7139.6 82.89083 3 1630.7686 1630.7686 K V 1639 1653 PSM EKLEQNPEESQDIK 1325 sp|Q01860|PO5F1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6976.10 78.51019 3 1685.8078 1685.8108 K A 127 141 PSM SGELAQEYDK 1326 sp|Q14683|SMC1A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7207.10 84.7125 2 1138.5116 1138.5142 R R 161 171 PSM AEDGENYDIK 1327 sp|O75347|TBCA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7119.10 82.3602 2 1152.4940 1152.4935 R K 42 52 PSM DSYESYGNSR 1328 sp|P38159-2|RBMX_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6933.11 77.34946 2 1176.4662 1176.4683 R S 270 280 PSM SGGNEVSIEER 1329 sp|Q15061|WDR43_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6991.11 78.92253 2 1175.5416 1175.5418 K L 431 442 PSM VNNVYDVDNK 1330 sp|O60524-3|NEMF_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7300.9 87.25317 2 1178.5588 1178.5568 R T 26 36 PSM EDKYEEEIK 1331 sp|P06753-2|TPM3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7008.11 79.38022 2 1181.5470 1181.5452 K L 182 191 PSM EDGVITASEDR 1332 sp|Q8IWB7|WDFY1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7092.8 81.62548 2 1190.5484 1190.5415 K T 36 47 PSM GASSPYGAPGTPR 1333 sp|Q5UIP0|RIF1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7135.10 82.78868 2 1216.5846 1216.5836 K M 399 412 PSM NCTIVSPDAGGAK 1334 sp|P60891|PRPS1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 2-UNIMOD:4 ms_run[1]:scan=1.1.7112.10 82.17287 2 1288.6104 1288.6082 R R 164 177 PSM IIEDQQESLNK 1335 sp|P05455|LA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7134.11 82.76331 2 1315.6620 1315.6619 K W 318 329 PSM QLYETTDTTTR 1336 sp|Q9UIA9|XPO7_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7183.11 84.06345 2 1327.6266 1327.6256 K L 17 28 PSM CASQAGMTAYGTR 1337 sp|Q15417|CNN3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 1-UNIMOD:4 ms_run[1]:scan=1.1.7193.11 84.33321 2 1372.5872 1372.5864 K R 173 186 PSM RAGELTEDEVER 1338 sp|P62269|RS18_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7109.7 82.08649 3 1402.6699 1402.6688 K V 55 67 PSM EASDPQPEEADGGLK 1339 sp|P52907|CAZA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7255.11 86.02025 2 1541.6856 1541.6845 K S 104 119 PSM AAPGAEFAPNK 1340 sp|Q15233-2|NONO_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7569.5 94.4256 3 1071.5338 1071.5349 R R 368 379 PSM SGGASHSELIHNLR 1341 sp|P22061-2|PIMT_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7566.3 94.33978 4 1476.7401 1476.7433 K K 5 19 PSM QHLEITGGQVR 1342 sp|P47897-2|SYQ_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7593.3 95.07768 3 1236.6526 1236.6575 K T 244 255 PSM GYDDRDYYSR 1343 sp|P62995-3|TRA2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7617.6 95.72179 3 1308.5338 1308.5371 R S 129 139 PSM NSNPALNDNLEK 1344 sp|O00299|CLIC1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7712.5 98.31271 3 1327.6354 1327.6368 K G 120 132 PSM ETAENYLGHTAK 1345 sp|P38646|GRP75_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7614.6 95.64142 3 1332.6271 1332.6310 K N 176 188 PSM CAADLGLNK 1346 sp|P49773|HINT1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 1-UNIMOD:4 ms_run[1]:scan=1.1.7522.6 93.14359 2 960.4686 960.4698 K G 84 93 PSM AEDAVEAIR 1347 sp|Q9BWF3|RBM4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7639.9 96.3276 2 972.4854 972.4876 R G 121 130 PSM HLPSTEPDPHVVR 1348 sp|Q9BUJ2-2|HNRL1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7522.8 93.14692 3 1482.7528 1482.7579 K I 271 284 PSM GGGALSAVAATK 1349 sp|P61011|SRP54_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7631.9 96.10895 2 1001.5486 1001.5506 K S 256 268 PSM GEFKDEEETVTTK 1350 sp|Q14677-2|EPN4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7618.7 95.75042 3 1511.6986 1511.6991 K H 230 243 PSM TAVCDIPPR 1351 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 4-UNIMOD:4 ms_run[1]:scan=1.1.7662.8 96.95338 2 1027.5104 1027.5121 K G 351 360 PSM TAVCDIPPR 1352 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 4-UNIMOD:4 ms_run[1]:scan=1.1.7469.8 91.70295 2 1027.5138 1027.5121 K G 351 360 PSM TAVCDIPPR 1353 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 4-UNIMOD:4 ms_run[1]:scan=1.1.7624.7 95.91365 2 1027.5076 1027.5121 K G 351 360 PSM TAVCDIPPR 1354 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 4-UNIMOD:4 ms_run[1]:scan=1.1.7643.8 96.43515 2 1027.5104 1027.5121 K G 351 360 PSM TAVCDIPPR 1355 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 4-UNIMOD:4 ms_run[1]:scan=1.1.7700.9 97.99216 2 1027.5118 1027.5121 K G 351 360 PSM TAVCDIPPR 1356 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 4-UNIMOD:4 ms_run[1]:scan=1.1.7586.7 94.89423 2 1027.5122 1027.5121 K G 351 360 PSM TAVCDIPPR 1357 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 4-UNIMOD:4 ms_run[1]:scan=1.1.7548.7 93.85347 2 1027.5184 1027.5121 K G 351 360 PSM IKSEHPGLSIGDTAK 1358 sp|P26583|HMGB2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7517.9 93.01258 3 1551.8233 1551.8257 K K 113 128 PSM GHAGSVDSIAVDGSGTK 1359 sp|Q9GZL7|WDR12_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7348.7 88.54665 3 1556.7400 1556.7431 R F 187 204 PSM IIAEGANGPTTPEADK 1360 sp|P00367|DHE3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7572.6 94.5095 3 1582.7803 1582.7838 K I 400 416 PSM ASLQETHFDSTQTK 1361 sp|O94888|UBXN7_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7621.9 95.83518 3 1591.7452 1591.7478 R Q 296 310 PSM HTGPNSPDTANDGFVR 1362 sp|P31943|HNRH1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7669.10 97.14883 3 1683.7735 1683.7601 K L 99 115 PSM AESAVIVANPR 1363 sp|Q9NQC3|RTN4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7567.10 94.37905 2 1125.6100 1125.6142 K E 310 321 PSM LGSLVENNER 1364 sp|B5ME19|EIFCL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7469.10 91.70628 2 1129.5842 1129.5727 K V 864 874 PSM VDATAETDLAK 1365 sp|P13667|PDIA4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7535.9 93.50205 2 1132.5588 1132.5612 K R 235 246 PSM AAEFNSNLNR 1366 sp|Q8WUB8-2|PHF10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7627.10 96.0007 2 1134.5330 1134.5417 K E 205 215 PSM IEEELGDEAR 1367 sp|P09104-2|ENOG_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7602.11 95.33102 2 1159.5350 1159.5357 R F 370 380 PSM EVKEEIDPDEEESAK 1368 sp|Q14692|BMS1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7447.10 91.1207 3 1745.7817 1745.7843 K K 808 823 PSM LACDVDQVTR 1369 sp|P78527|PRKDC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 3-UNIMOD:4 ms_run[1]:scan=1.1.7623.10 95.89143 2 1175.5592 1175.5605 R Q 972 982 PSM QVLQLQASHR 1370 sp|Q9P2E9|RRBP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7436.6 90.82983 3 1178.6506 1178.6520 K E 865 875 PSM TEDGGEFEEGASENNAK 1371 sp|O43719|HTSF1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7335.11 88.20883 3 1782.7102 1782.7180 K E 434 451 PSM QASTDAGTAGALTPQHVR 1372 sp|P46937-2|YAP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7625.10 95.94598 3 1779.8830 1779.8864 R A 107 125 PSM LVAGEMGQNEPDQGGQR 1373 sp|Q99714-2|HCD2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7686.10 97.61387 3 1784.8117 1784.8112 R G 131 148 PSM NCIAQTSAVVK 1374 sp|Q4VC31|CCD58_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 2-UNIMOD:4 ms_run[1]:scan=1.1.7468.9 91.67755 2 1189.6082 1189.6125 K N 73 84 PSM YVECSALTQK 1375 sp|P60953|CDC42_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 4-UNIMOD:4 ms_run[1]:scan=1.1.7679.9 97.42181 2 1197.5672 1197.5700 K G 154 164 PSM SNFSNSADDIK 1376 sp|P45973|CBX5_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7468.10 91.67921 2 1196.5284 1196.5309 K S 92 103 PSM ASGNYATVISHNPETKK 1377 sp|P62917|RL8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7702.9 98.04653 3 1815.9079 1815.9115 R T 129 146 PSM GASQAGMLAPGTR 1378 sp|Q15417|CNN3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7565.11 94.3258 2 1215.6018 1215.6030 K R 213 226 PSM LEGNTVGVEAAR 1379 sp|P46060|RAGP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7345.11 88.4738 2 1214.6244 1214.6255 R V 56 68 PSM VEIIANDQGNR 1380 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7426.6 90.57277 3 1227.6205 1227.6207 R I 26 37 PSM VEIIANDQGNR 1381 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7447.11 91.12237 2 1227.6208 1227.6207 R I 26 37 PSM QAANLQDCYR 1382 sp|P43246-2|MSH2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 8-UNIMOD:4 ms_run[1]:scan=1.1.7460.10 91.46245 2 1237.5494 1237.5509 R L 331 341 PSM TNQELQEINR 1383 sp|P07355-2|ANXA2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7672.9 97.22978 2 1243.6152 1243.6156 R V 154 164 PSM TSLSANNATLEK 1384 sp|O75330-3|HMMR_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7462.11 91.51817 2 1247.6354 1247.6357 K Q 128 140 PSM LNDGSQITYEK 1385 sp|O95831|AIFM1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7586.10 94.89923 2 1266.6092 1266.6092 K C 245 256 PSM TIIQNPTDQQK 1386 sp|Q9UQ80|PA2G4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7485.10 92.14246 2 1284.6648 1284.6674 K K 200 211 PSM NSEPAGLETPEAK 1387 sp|P07814|SYEP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7634.11 96.19417 2 1341.6396 1341.6412 R V 890 903 PSM SLQEQADAAEER 1388 sp|P09493-5|TPM1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7525.10 93.23196 2 1345.6084 1345.6109 R A 16 28 PSM GVEEEEEDGEMRE 1389 sp|P62306|RUXF_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 11-UNIMOD:35 ms_run[1]:scan=1.1.7644.11 96.46738 2 1552.5806 1552.5835 R - 74 87 PSM SVEAAAELSAK 1390 sp|P20962|PTMS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7745.3 99.2118 3 1074.5533 1074.5557 K D 5 16 PSM LENGELEHIRPK 1391 sp|Q15102|PA1B3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8115.2 109.2013 4 1433.7597 1433.7626 R I 84 96 PSM GHAVGDIPGVR 1392 sp|P62266|RS23_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7900.3 103.4094 3 1076.5714 1076.5727 K F 109 120 PSM RLIPDGCGVK 1393 sp|P27635|RL10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 7-UNIMOD:4 ms_run[1]:scan=1.1.7739.3 99.0476 3 1113.5929 1113.5965 K Y 189 199 PSM QEYDESGPSIVHR 1394 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8052.3 107.5596 4 1515.6921 1515.6954 K K 360 373 PSM TPLRPLDPTR 1395 sp|Q04637-9|IF4G1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7986.2 105.7617 3 1164.6595 1164.6615 K L 654 664 PSM VDNDENEHQLSLR 1396 sp|P06748-2|NPM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7795.4 100.5403 4 1567.7193 1567.7226 K T 33 46 PSM TVFAEHISDECKR 1397 sp|P39023|RL3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 11-UNIMOD:4 ms_run[1]:scan=1.1.8039.4 107.2102 4 1590.7441 1590.7460 K R 104 117 PSM AVHTVDFTADK 1398 sp|Q8TED0-3|UTP15_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7898.3 103.3544 3 1202.5912 1202.5932 K Y 105 116 PSM TYHSVGDSVLR 1399 sp|P11717|MPRI_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7947.3 104.6966 3 1232.6119 1232.6150 R S 92 103 PSM IDEPLEGSEDR 1400 sp|P61978|HNRPK_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7971.4 105.3566 3 1258.5655 1258.5677 K I 423 434 PSM HQEGEIFDTEK 1401 sp|Q02878|RL6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7938.5 104.454 3 1331.5984 1331.5993 R E 227 238 PSM SQLNSQSVEITK 1402 sp|O60763-2|USO1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8045.6 107.3766 3 1332.6871 1332.6885 K L 810 822 PSM VVTDTDETELAR 1403 sp|P05198|IF2A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7995.3 106.0079 3 1347.6493 1347.6518 K Q 277 289 PSM APLKPYPVSPSDK 1404 sp|P41252|SYIC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7833.4 101.5734 3 1397.7517 1397.7554 K V 1039 1052 PSM IYDLNKPEAEPK 1405 sp|Q9Y3F4-2|STRAP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8084.5 108.3871 3 1415.7262 1415.7296 R E 139 151 PSM ADGYVLEGK 1406 sp|P62241|RS8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7834.4 101.6007 2 950.4678 950.4709 R E 185 194 PSM ADGYVLEGK 1407 sp|P62241|RS8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7815.8 101.0912 2 950.4678 950.4709 R E 185 194 PSM ETYGEMADCCAK 1408 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 9-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.7967.9 105.2555 3 1433.5225 1433.5261 R Q 106 118 PSM GGGQIIPTAR 1409 sp|P13639|EF2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7748.7 99.3006 2 968.5380 968.5403 R R 717 727 PSM TNYNDRYDEIR 1410 sp|P62424|RL7A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8053.8 107.5949 3 1457.6512 1457.6535 R R 224 235 PSM QEYDESGPSIVHR 1411 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8031.4 106.9944 3 1515.6922 1515.6954 K K 360 373 PSM TAVCDIPPR 1412 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 4-UNIMOD:4 ms_run[1]:scan=1.1.7862.7 102.3715 2 1027.5084 1027.5121 K G 351 360 PSM TAVCDIPPR 1413 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 4-UNIMOD:4 ms_run[1]:scan=1.1.7957.9 104.9813 2 1027.5124 1027.5121 K G 351 360 PSM TAVCDIPPR 1414 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 4-UNIMOD:4 ms_run[1]:scan=1.1.7719.10 98.51252 2 1027.5118 1027.5121 K G 351 360 PSM TAVCDIPPR 1415 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 4-UNIMOD:4 ms_run[1]:scan=1.1.7995.5 106.0113 2 1027.5248 1027.5121 K G 351 360 PSM ILGPQGNTIK 1416 sp|Q07666|KHDR1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7758.7 99.57156 2 1039.6000 1039.6026 K R 176 186 PSM ILGPQGNTIK 1417 sp|Q07666|KHDR1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7739.8 99.05593 2 1039.6000 1039.6026 K R 176 186 PSM SVEAAAELSAK 1418 sp|P20962|PTMS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7797.9 100.6028 2 1074.5520 1074.5557 K D 5 16 PSM YADITVTSSK 1419 sp|Q9UPN3|MACF1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7755.8 99.49442 2 1083.5412 1083.5448 R A 5543 5553 PSM VNEVNQFAAK 1420 sp|Q13813|SPTN1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7728.9 98.75667 2 1118.5686 1118.5720 R L 205 215 PSM FVGQDVEGER 1421 sp|P17812|PYRG1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7731.10 98.84048 2 1134.5292 1134.5306 K M 499 509 PSM GGNRPNTGPLYTEADR 1422 sp|Q9HAU0-2|PKHA5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7928.10 104.1886 3 1716.8164 1716.8179 R V 388 404 PSM EAESSPFVER 1423 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8077.10 108.2158 2 1149.5280 1149.5302 K L 548 558 PSM RQAVTNPNNTFYATK 1424 sp|P38646|GRP75_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7902.9 103.4743 3 1723.8622 1723.8642 K R 107 122 PSM VPQIEVETHK 1425 sp|Q14204|DYHC1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7747.11 99.27987 2 1178.6274 1178.6295 K V 2552 2562 PSM EITALAPSTMK 1426 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 10-UNIMOD:35 ms_run[1]:scan=1.1.8105.9 108.9418 2 1176.6024 1176.6060 K I 316 327 PSM IQETQAELPR 1427 sp|Q14566|MCM6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7930.10 104.2432 2 1183.6172 1183.6197 R G 208 218 PSM AAAASVPNADGLK 1428 sp|A1X283|SPD2B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7949.11 104.7648 2 1183.6186 1183.6197 K D 839 852 PSM SEMTPEELQK 1429 sp|P62316|SMD2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7938.10 104.4624 2 1190.5466 1190.5489 K R 9 19 PSM RVDALNDEIR 1430 sp|Q9UQE7|SMC3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8047.10 107.4376 2 1199.6260 1199.6258 K Q 796 806 PSM SYELQESNVR 1431 sp|Q9NVA2-2|SEP11_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8073.11 108.1149 2 1223.5762 1223.5782 R L 94 104 PSM VTSEGAGLQLQK 1432 sp|P10253|LYAG_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8017.10 106.6202 2 1229.6600 1229.6616 R V 892 904 PSM LVEVNGENVEK 1433 sp|O14745|NHRF1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7781.9 100.174 2 1228.6276 1228.6299 R E 59 70 PSM GNEGTLESINEK 1434 sp|O60870-2|KIN17_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7828.9 101.4457 2 1289.6072 1289.6099 R T 352 364 PSM EAEQMGNELER 1435 sp|Q14980|NUMA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7823.9 101.3102 2 1304.5670 1304.5666 R L 973 984 PSM MDSTANEVEAVK 1436 sp|P07237|PDIA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 1-UNIMOD:35 ms_run[1]:scan=1.1.7718.10 98.4852 2 1308.5850 1308.5867 K V 425 437 PSM CATCSQPILDR 1437 sp|Q15654|TRIP6_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 1-UNIMOD:4,4-UNIMOD:4 ms_run[1]:scan=1.1.7742.11 99.14301 2 1319.5926 1319.5962 K I 339 350 PSM SQYEVMAEQNR 1438 sp|P08727|K1C19_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8064.10 107.8821 2 1353.6002 1353.5983 R K 254 265 PSM GSSYGVTSTESYK 1439 sp|P98175-5|RBM10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7811.11 100.9872 2 1364.6078 1364.6096 R E 968 981 PSM EVEEEPGIHSLK 1440 sp|Q9Y4L1|HYOU1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8032.11 107.0329 2 1365.6764 1365.6776 R H 452 464 PSM SEPIPESNDGPVK 1441 sp|P30101|PDIA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7762.9 99.67868 2 1367.6556 1367.6569 K V 367 380 PSM ADEASELACPTPK 1442 sp|P49327|FAS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 9-UNIMOD:4 ms_run[1]:scan=1.1.7951.11 104.8198 2 1387.6274 1387.6289 K E 2194 2207 PSM GTGEAEEEYVGPR 1443 sp|Q13895|BYST_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8102.10 108.8639 2 1392.6122 1392.6157 R L 41 54 PSM ETYGEMADCCAK 1444 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 9-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.7996.11 106.0484 2 1433.5254 1433.5261 R Q 106 118 PSM GLLQTEPQNNQAK 1445 sp|Q9Y3D6|FIS1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7733.11 98.89674 2 1439.7346 1439.7368 R E 96 109 PSM SSQSSSQQFSGIGR 1446 sp|Q92841-1|DDX17_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7923.8 104.0483 2 1454.6716 1454.6750 R S 592 606 PSM QEYDESGPSIVHR 1447 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8067.5 107.951 3 1515.6919 1515.6954 K K 360 373 PSM VDNDENEHQLSLR 1448 sp|P06748-2|NPM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7775.4 100.0097 4 1567.7193 1567.7226 K T 33 46 PSM ASSEGGTAAGAGLDSLHK 1449 sp|O15143|ARC1B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8054.5 107.6155 3 1627.7758 1627.7802 K N 309 327 PSM FNAHGDANTIVCNSK 1450 sp|P09382|LEG1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 12-UNIMOD:4 ms_run[1]:scan=1.1.7736.9 98.9754 3 1646.7448 1646.7471 R D 50 65 PSM VSEEAESQQQWDTSK 1451 sp|Q01082-3|SPTB2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7904.11 103.5324 2 1750.7662 1750.7646 K G 2096 2111 PSM KLDEAVAEAHLGK 1452 sp|P23526-2|SAHH_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8442.2 118.0751 4 1379.7381 1379.7408 K L 361 374 PSM ALAAGGYDVEK 1453 sp|P16401|H15_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8181.2 110.9994 3 1092.5416 1092.5451 K N 68 79 PSM HPGSFDVVHVK 1454 sp|P62701|RS4X_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8225.4 112.1965 3 1220.6260 1220.6302 R D 201 212 PSM AHVVPCFDASK 1455 sp|P21333-2|FLNA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 6-UNIMOD:4 ms_run[1]:scan=1.1.8361.2 115.8828 3 1229.5861 1229.5863 K V 1152 1163 PSM TPVEPEVAIHR 1456 sp|P60866-2|RS20_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8291.3 113.9922 3 1246.6651 1246.6670 K I 9 20 PSM VDVTEQPGLSGR 1457 sp|Q9H3N1|TMX1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8211.2 111.8128 3 1256.6314 1256.6361 K F 83 95 PSM KTGCNVLLIQK 1458 sp|P50991|TCPD_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 4-UNIMOD:4 ms_run[1]:scan=1.1.8465.5 118.7108 3 1272.7165 1272.7224 K S 292 303 PSM VLETAEDIQER 1459 sp|Q13813|SPTN1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8421.5 117.5118 3 1301.6440 1301.6463 K R 8 19 PSM GLSEDTTEETLK 1460 sp|P19338|NUCL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8327.5 114.9653 3 1321.6225 1321.6249 K E 578 590 PSM RALEQQVEEMK 1461 sp|P35579|MYH9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8429.5 117.7273 3 1359.6766 1359.6816 K T 1528 1539 PSM VGAAEIISR 1462 sp|O75533|SF3B1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8268.6 113.3763 2 914.5162 914.5185 K I 844 853 PSM LNFSHGTHEYHAETIK 1463 sp|P14618-2|KPYM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8357.4 115.777 4 1882.8905 1882.8962 R N 74 90 PSM NIVHNYSEAEIK 1464 sp|Q9H201|EPN3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8487.6 119.3127 3 1415.7007 1415.7045 K V 12 24 PSM EGHLSPDIVAEQK 1465 sp|P15559-2|NQO1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8457.4 118.4891 3 1421.7112 1421.7150 K K 78 91 PSM ATAVVDGAFK 1466 sp|P32119|PRDX2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8347.7 115.5096 2 977.5170 977.5182 K E 17 27 PSM LESGMQNMSIHTK 1467 sp|P05787-2|K2C8_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8440.7 118.0289 3 1474.6894 1474.6908 R T 430 443 PSM IQFKPDDGTTPER 1468 sp|Q96AE4-2|FUBP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8131.7 109.6456 3 1502.7319 1502.7365 R I 308 321 PSM RLDECEEAFQGTK 1469 sp|P61289-3|PSME3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 5-UNIMOD:4 ms_run[1]:scan=1.1.8334.7 115.1581 3 1581.7081 1581.7093 R V 99 112 PSM VTLYECHSQGEIR 1470 sp|O75530-2|EED_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 6-UNIMOD:4 ms_run[1]:scan=1.1.8496.7 119.5594 3 1590.7393 1590.7460 R L 121 134 PSM MREIVHIQAGQCGNQIGAK 1471 sp|Q9BVA1|TBB2B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 1-UNIMOD:35,12-UNIMOD:4 ms_run[1]:scan=1.1.8460.8 118.5783 4 2125.0457 2125.0521 - F 1 20 PSM TLSDYNIQK 1472 sp|P62979|RS27A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8270.7 113.4323 2 1080.5418 1080.5451 R E 55 64 PSM EQIVPKPEEEVAQK 1473 sp|P18621-3|RL17_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8133.9 109.7035 3 1622.8507 1622.8515 K K 154 168 PSM ALAAGGYDVEK 1474 sp|P16401|H15_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8191.9 111.2839 2 1092.5426 1092.5451 K N 68 79 PSM DLEEAEEYK 1475 sp|O75347|TBCA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8450.8 118.304 2 1124.4840 1124.4873 K E 87 96 PSM LSANQQNILK 1476 sp|P57088|TMM33_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8233.9 112.4233 2 1127.6280 1127.6298 K F 149 159 PSM DSLSPGQERPYSTVR 1477 sp|Q8IZL8|PELP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8214.9 111.9056 3 1690.8253 1690.8275 R T 414 429 PSM VTADVINAAEK 1478 sp|O43175|SERA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8292.2 114.0174 3 1129.5970 1129.5979 K L 59 70 PSM VTADVINAAEK 1479 sp|O43175|SERA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8291.7 113.9989 2 1129.5956 1129.5979 K L 59 70 PSM VTADVINAAEK 1480 sp|O43175|SERA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8272.9 113.4898 2 1129.5960 1129.5979 K L 59 70 PSM NLQTVNVDEN 1481 sp|P62899|RL31_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8357.7 115.782 2 1144.5340 1144.5360 K - 116 126 PSM VDATADYICK 1482 sp|P53396|ACLY_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 9-UNIMOD:4 ms_run[1]:scan=1.1.8406.7 117.1116 2 1154.5270 1154.5278 K V 221 231 PSM VDSPTVTTTLK 1483 sp|Q07866-10|KLC1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8342.9 115.3771 2 1160.6272 1160.6289 K N 458 469 PSM EITALAPSTMK 1484 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 10-UNIMOD:35 ms_run[1]:scan=1.1.8124.7 109.4546 2 1176.6024 1176.6060 K I 316 327 PSM ATTADGSSILDR 1485 sp|Q9BT78|CSN4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8347.10 115.5146 2 1205.5874 1205.5888 K A 291 303 PSM VIATFTCSGEK 1486 sp|P49189|AL9A1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 7-UNIMOD:4 ms_run[1]:scan=1.1.8441.9 118.0595 2 1211.5818 1211.5856 R E 39 50 PSM IEAGYIQTGDR 1487 sp|Q9Y450-4|HBS1L_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8359.10 115.8416 2 1221.5940 1221.5990 K L 467 478 PSM GVVEVTHDLQK 1488 sp|P50454|SERPH_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8267.10 113.3558 2 1223.6498 1223.6510 K H 309 320 PSM LNQDQLDAVSK 1489 sp|Q14444-2|CAPR1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8218.8 112.0128 2 1229.6240 1229.6252 R Y 88 99 PSM EQTEGEYSSLEHESAR 1490 sp|O43837-2|IDH3B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8244.9 112.7249 3 1850.7886 1850.7918 R G 165 181 PSM TTLSASGTGFGDK 1491 sp|P49790-2|NU153_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8382.10 116.472 2 1240.5930 1240.5936 K F 664 677 PSM SLDVNQDSELK 1492 sp|Q99584|S10AD_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8381.9 116.4428 2 1246.5986 1246.6041 K F 62 73 PSM AENYDIPSADR 1493 sp|P22314|UBA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8472.10 118.9104 2 1249.5578 1249.5575 R H 870 881 PSM EQVANSAFVER 1494 sp|P08238|HS90B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8204.9 111.6352 2 1248.6090 1248.6098 K V 492 503 PSM VVTQNICQYR 1495 sp|Q8N163|CCAR2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 7-UNIMOD:4 ms_run[1]:scan=1.1.8404.11 117.0652 2 1279.6340 1279.6343 R S 748 758 PSM AEFAAPSTDAPDK 1496 sp|Q96B26|EXOS8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8193.11 111.3417 2 1318.6048 1318.6041 K G 64 77 PSM GLSEDTTEETLK 1497 sp|P19338|NUCL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8349.8 115.5658 2 1321.6250 1321.6249 K E 578 590 PSM SVQTTLQTDEVK 1498 sp|O94905|ERLN2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8496.10 119.5644 2 1347.6862 1347.6882 R N 61 73 PSM AAECNIVVTQPR 1499 sp|Q08211|DHX9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 4-UNIMOD:4 ms_run[1]:scan=1.1.8241.11 112.6457 2 1356.6822 1356.6820 R R 435 447 PSM LAAVTYNGVDNNK 1500 sp|Q16181-2|SEPT7_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8309.9 114.4852 2 1377.6860 1377.6888 K N 313 326 PSM SSHETLNIVEEK 1501 sp|O43491-4|E41L2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8191.5 111.2772 3 1384.6783 1384.6834 K K 612 624 PSM MGITEYNNQCR 1502 sp|P41252|SYIC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 10-UNIMOD:4 ms_run[1]:scan=1.1.8248.10 112.8364 2 1384.5848 1384.5863 K A 111 122 PSM TNHIYVSSDDIK 1503 sp|Q6P2Q9|PRP8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8132.6 109.6712 3 1390.6693 1390.6729 R E 2087 2099 PSM RGVSCQFGPDVTK 1504 sp|P53041|PPP5_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 5-UNIMOD:4 ms_run[1]:scan=1.1.8171.8 110.7365 3 1449.6931 1449.7035 K A 400 413 PSM PAYHSSLMDPDTK 1505 sp|O15145|ARPC3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8231.9 112.3685 3 1460.6599 1460.6606 M L 2 15 PSM TGTLTTNQMSVCR 1506 sp|P16615-4|AT2A2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 12-UNIMOD:4 ms_run[1]:scan=1.1.8358.11 115.8159 2 1467.6900 1467.6810 K M 326 339 PSM YQSFNNQSDLEK 1507 sp|P49642|PRI1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8312.11 114.5695 2 1471.6570 1471.6579 R E 57 69 PSM APVPGTPDSLSSGSSR 1508 sp|Q9UJZ1-2|STML2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8299.10 114.2183 2 1513.7364 1513.7373 K D 277 293 PSM AAAAAWEEPSSGNGTAR 1509 sp|Q9P258|RCC2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8248.11 112.8381 2 1644.7518 1644.7492 K A 6 23 PSM TTSSANNPNLMYQDECDRR 1510 sp|Q92841-1|DDX17_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 16-UNIMOD:4 ms_run[1]:scan=1.1.8478.11 119.0761 3 2270.9629 2270.9644 R L 490 509 PSM AADALEEQQR 1511 sp|Q14980|NUMA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6411.8 63.16833 2 1129.5356 1129.5363 R C 725 735 PSM EAMEDGEIDGNK 1512 sp|P19338|NUCL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7045.5 80.35365 3 1306.5337 1306.5347 K V 628 640 PSM SRAEAESMYQIK 1513 sp|P05787-2|K2C8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8117.7 109.2638 3 1411.6756 1411.6765 R Y 302 314 PSM YELISETGGSHDK 1514 sp|Q12906-7|ILF3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8138.5 109.833 3 1434.6616 1434.6627 K R 545 558 PSM VQELGHGCAALVTK 1515 sp|Q9Y490|TLN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 8-UNIMOD:4 ms_run[1]:scan=1.1.8243.8 112.6957 3 1481.7604 1481.7661 R A 1920 1934 PSM HVPGGGNVQIQNK 1516 sp|P27816-6|MAP4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6428.5 63.61609 3 1346.7067 1346.7055 K K 1016 1029 PSM AEGDVAALNR 1517 sp|P67936|TPM4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7160.8 83.46201 2 1014.5104 1014.5094 K R 45 55 PSM RQVDEAEEEIER 1518 sp|Q9P2M7|CING_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7818.7 101.1711 3 1501.7083 1501.7008 K L 1106 1118 PSM YHDEADQSALQR 1519 sp|Q12789-3|TF3C1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6612.6 68.63523 3 1431.6391 1431.6378 R M 1246 1258 PSM HAASTVQILGAEK 1520 sp|Q9Y2X3|NOP58_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8126.6 109.5076 3 1323.7129 1323.7146 K A 311 324 PSM AAAAAWEEPSSGNGTAR 1521 sp|Q9P258|RCC2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8270.8 113.434 3 1644.7462 1644.7492 K A 6 23 PSM QVLVAPGNAGTACSEK 1522 sp|P22102|PUR2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 13-UNIMOD:4 ms_run[1]:scan=1.1.8012.8 106.4801 3 1600.7881 1600.7879 K I 29 45 PSM LREDENAEPVGTTYQK 1523 sp|Q16643-3|DREB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7369.11 89.11143 3 1848.8863 1848.8853 R T 150 166 PSM KVTLGDTLTR 1524 sp|Q9UKV3|ACINU_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8151.3 110.1838 3 1102.6291 1102.6346 K R 970 980 PSM GHQFSCVCLHGDR 1525 sp|Q92499-3|DDX1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 6-UNIMOD:4,8-UNIMOD:4 ms_run[1]:scan=1.1.7873.3 102.6678 4 1571.6709 1571.6722 K K 409 422 PSM VLSGTIHAGQPVK 1526 sp|Q15029-2|U5S1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7355.8 88.73399 3 1305.7396 1305.7405 R V 461 474 PSM PATLTTTSATSK 1527 sp|O43670-2|ZN207_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6350.11 61.54295 2 1177.6178 1177.6190 K L 336 348 PSM SGQGAFGNMCR 1528 sp|P36578|RL4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 10-UNIMOD:4 ms_run[1]:scan=1.1.7949.11 104.7648 2 1183.4864 1183.4863 R G 87 98 PSM NCTIVSPDAGGAK 1529 sp|P60891|PRPS1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 2-UNIMOD:4 ms_run[1]:scan=1.1.7126.7 82.54227 3 1288.6069 1288.6082 R R 164 177 PSM YQEGGVESAFHK 1530 sp|P40121-2|CAPG_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8257.4 113.0735 3 1350.6238 1350.6204 K T 116 128 PSM HELQANCYEEVK 1531 sp|P23528|COF1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 7-UNIMOD:4 ms_run[1]:scan=1.1.7685.2 97.5734 4 1518.6721 1518.6773 K D 133 145 PSM LLSESAQPLK 1532 sp|Q9H3N1|TMX1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8330.7 115.0497 2 1084.6106 1084.6128 K K 224 234 PSM QQALTVSTDPEHR 1533 sp|P35606|COPB2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7546.7 93.79884 3 1480.7236 1480.7270 K F 632 645 PSM KEDALLYQSK 1534 sp|P50402|EMD_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7509.4 92.78655 3 1193.6254 1193.6292 K G 79 89 PSM TGVHHYSGNNIELGTACGK 1535 sp|P62888|RL30_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 17-UNIMOD:4 ms_run[1]:scan=1.1.7932.7 104.293 4 2013.9273 2013.9327 K Y 69 88 PSM VLTVINQTQK 1536 sp|P42766|RL35_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8054.7 107.6189 2 1142.6622 1142.6659 R E 57 67 PSM RMGESDDSILR 1537 sp|P63220|RS21_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7990.6 105.8772 3 1277.6011 1277.6034 R L 61 72 PSM KAELLDNEK 1538 sp|Q9HB71|CYBP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.6410.10 63.14428 2 1058.5576 1058.5607 K P 51 60 PSM DHAVVVGVYRPPPK 1539 sp|P22087|FBRL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8214.7 111.9023 3 1532.8435 1532.8464 R V 305 319 PSM PSAGSGILSR 1540 sp|Q8IZ40|RCOR2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.7564.7 94.29176 2 943.5086 943.5087 K S 8 18 PSM LFGQESGPSAEK 1541 sp|Q9BWH2|FUND2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 23 ms_run[1]:scan=1.1.8025.8 106.8371 2 1248.5958 1248.5986 K Y 69 81 PSM QEYDESGPSIVHRK 1542 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 23 1-UNIMOD:28 ms_run[1]:scan=1.1.8330.7 115.0497 3 1626.7589 1626.7633 K C 360 374 PSM DPSQQELPR 1543 sp|P49327|FAS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.7048.8 80.44037 2 1069.526047 1068.519987 R L 1172 1181 PSM YHTVNGHNCEVR 1544 sp|P09651|ROA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 23 9-UNIMOD:4 ms_run[1]:scan=1.1.6088.5 54.34142 4 1485.666494 1484.657895 K K 167 179 PSM TVLDQQQTPSR 1545 sp|P42704|LPPRC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.6827.11 74.5162 2 1272.644047 1271.646979 K L 1129 1140 PSM FATHAAALSVR 1546 sp|P23246|SFPQ_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.8055.10 107.6497 2 1143.619047 1142.619642 R N 366 377 PSM NNASTDYDLSDK 1547 sp|P39023|RL3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.8168.10 110.658 2 1342.550447 1341.568454 K S 301 313 PSM GDREQLLQR 1548 sp|Q04917|1433F_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 23 1-UNIMOD:1 ms_run[1]:scan=1.1.8162.4 110.4842 3 1155.5935 1155.5991 M A 2 11 PSM TAVCDIPPR 1549 sp|Q13885|TBB2A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 23 4-UNIMOD:4 ms_run[1]:scan=1.1.7759.7 99.59758 2 1028.508047 1027.512065 K G 351 360 PSM TAVCDIPPR 1550 sp|Q13885|TBB2A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 23 4-UNIMOD:4 ms_run[1]:scan=1.1.7605.6 95.40203 2 1028.511847 1027.512065 K G 351 360 PSM TAVCDIPPR 1551 sp|Q13885|TBB2A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 23 4-UNIMOD:4 ms_run[1]:scan=1.1.7390.6 89.64615 2 1028.512847 1027.512065 K G 351 360 PSM TAVCDIPPR 1552 sp|Q13885|TBB2A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 23 4-UNIMOD:4 ms_run[1]:scan=1.1.7164.8 83.56578 2 1028.513247 1027.512065 K G 351 360 PSM TAVCDIPPR 1553 sp|Q13885|TBB2A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 23 4-UNIMOD:4 ms_run[1]:scan=1.1.7351.6 88.62458 2 1028.511247 1027.512065 K G 351 360 PSM VDREQLVQK 1554 sp|P61981|1433G_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 23 1-UNIMOD:1 ms_run[1]:scan=1.1.8033.11 107.0598 2 1155.6224 1155.6243 M A 2 11 PSM CYNCGGLDHHAK 1555 sp|Q9H9Z2|LN28A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 23 1-UNIMOD:385,1-UNIMOD:4,4-UNIMOD:4 ms_run[1]:scan=1.1.7678.6 97.38953 3 1413.5543 1413.5549 R E 139 151 PSM SVDPDSPAEASGLR 1556 sp|O14745|NHRF1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.8490.11 119.4025 2 1400.658047 1399.657937 R A 181 195 PSM PHSVSLNDTETR 1557 sp|Q9P0L0|VAPA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 23 ms_run[1]:scan=1.1.6737.8 72.05728 3 1354.6732 1354.6472 K K 162 174 PSM AAGGDHGSPDSYR 1558 sp|P30566|PUR8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 23 1-UNIMOD:1 ms_run[1]:scan=1.1.6636.11 69.29515 2 1330.5535 1330.5533 M S 2 15 PSM GDVTAEEAAGASPAK 1559 sp|P49006|MRP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.6936.11 77.43038 2 1373.641847 1372.647038 R A 11 26 PSM ADGAAAGAGGSPSLR 1560 sp|Q8IWC1|MA7D3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 23 1-UNIMOD:1 ms_run[1]:scan=1.1.8183.11 111.069 2 1298.6082 1298.6212 M E 3 18 PSM NQAIEELEK 1561 sp|Q9P289|STK26_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.8484.9 119.2361 2 1073.537647 1072.540054 R S 375 384 PSM AENPSLENHR 1562 sp|O00505|IMA4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 23 1-UNIMOD:1 ms_run[1]:scan=1.1.6754.9 72.5268 2 1207.5752 1207.5572 M I 2 12 PSM HGFEAASIKEER 1563 sp|P35580|MYH10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.7217.6 84.97549 3 1371.669071 1372.673528 R G 43 55 PSM TAVCDIPPR 1564 sp|Q13885|TBB2A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 23 4-UNIMOD:4 ms_run[1]:scan=1.1.7681.9 97.47643 2 1026.494847 1027.512065 K G 351 360 PSM AGVAPLQVK 1565 sp|P21333|FLNA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.7930.3 104.2316 2 882.532447 881.533452 K V 1478 1487 PSM LSEHATAPTR 1566 sp|P33316|DUT_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.5975.3 51.2604 3 1081.5556 1081.5516 R G 119 129 PSM QVHPDTGISSK 1567 sp|Q99880|H2B1L_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6108.4 54.86982 3 1167.5926 1167.5884 K A 48 59 PSM HQDVPSQDDSKPTQR 1568 sp|Q9NRN7|ADPPT_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.5894.4 49.04082 4 1736.8137 1736.8078 R Q 253 268 PSM TAEAGGVTGK 1569 sp|P09874|PARP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.5780.3 46.15522 2 889.4540 889.4505 K G 88 98 PSM GADQKPTSADCAVR 1570 sp|Q8IX01-3|SUGP2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 11-UNIMOD:4 ms_run[1]:scan=1.1.6015.11 52.36237 3 1474.6846 1474.6834 R A 646 660 PSM RQSPLPPQK 1571 sp|Q01105|SET_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6022.4 52.54483 3 1049.5990 1049.5982 K K 5 14 PSM QEMQEVQSSR 1572 sp|P22626-2|ROA2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 3-UNIMOD:35 ms_run[1]:scan=1.1.5746.2 45.46592 2 1236.5406 1236.5405 R S 179 189 PSM RISGLIYEETR 1573 sp|P62805|H4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.1672.2 11.8261 3 1335.7126 1335.7146 K G 46 57 PSM RISGLIYEETR 1574 sp|P62805|H4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.1651.2 11.30453 3 1335.7126 1335.7146 K G 46 57 PSM RQLEDGDQPESK 1575 sp|Q92945|FUBP2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.5937.9 50.2239 3 1400.6548 1400.6532 K K 110 122 PSM KTEAPAAPAAQETK 1576 sp|P80723|BASP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.5997.11 51.86362 2 1411.7322 1411.7307 K S 150 164 PSM RAAEDDEDDDVDTK 1577 sp|P06454-2|PTMA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.5931.8 50.0633 2 1592.6456 1592.6438 K K 89 103 PSM HLQLAIRNDEELNK 1578 sp|P16104|H2AX_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.2164.2 15.5186 4 1691.8949 1691.8954 R L 83 97 PSM GCIVDANLSVLNLVIVK 1579 sp|P62753|RS6_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 2-UNIMOD:4 ms_run[1]:scan=1.1.1660.6 11.5404 3 1826.0296 1826.0336 R K 99 116 PSM RHFNAPSHIR 1580 sp|P61254|RL26_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6505.2 65.69115 4 1233.6493 1233.6479 K R 17 27 PSM RHLTGEFEK 1581 sp|P62826|RAN_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6375.4 62.20877 3 1115.5732 1115.5723 K K 29 38 PSM TDGCHAYLSK 1582 sp|Q01518-2|CAP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 4-UNIMOD:4 ms_run[1]:scan=1.1.6342.4 61.31248 3 1150.5103 1150.5077 K N 412 422 PSM AFHNEAQVNPERK 1583 sp|P17987|TCPA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6299.3 60.14267 4 1538.7573 1538.7590 R N 469 482 PSM TTVHAITATQK 1584 sp|P04406|G3P_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1000663, ProteinPilot, ] 22 ms_run[1]:scan=1.1.6232.4 58.29135 3 1169.63947064349 1169.64043639461 M T 176 187 PSM KESDLNGAQIK 1585 sp|P20700|LMNB1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6370.6 62.08115 3 1201.6297 1201.6302 K L 124 135 PSM VAVTEGCQPSR 1586 sp|O75369-2|FLNB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 7-UNIMOD:4 ms_run[1]:scan=1.1.6295.2 60.03074 3 1202.5741 1202.5714 K V 1320 1331 PSM VAEAHENIIHGSGATGK 1587 sp|Q08257|QOR_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6492.6 65.34203 4 1689.8425 1689.8434 K M 308 325 PSM QRPQATAEQIR 1588 sp|Q14157-1|UBP2L_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6241.6 58.54502 3 1296.6892 1296.6898 K L 27 38 PSM LVDQSGPPHEPK 1589 sp|P55265-4|DSRAD_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6358.6 61.75423 3 1302.6568 1302.6568 K F 789 801 PSM VKVETYNDESR 1590 sp|P27694|RFA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6508.6 65.78056 3 1338.6388 1338.6415 R I 576 587 PSM PNMVTPGHACTQK 1591 sp|P04075-2|ALDOA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 10-UNIMOD:4 ms_run[1]:scan=1.1.6341.9 61.29365 3 1439.6629 1439.6650 K F 285 298 PSM EETVNDPEEAGHR 1592 sp|O00567|NOP56_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6233.10 58.3292 3 1481.6377 1481.6382 K S 541 554 PSM EETVNDPEEAGHR 1593 sp|O00567|NOP56_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6214.11 57.8047 3 1481.6377 1481.6382 K S 541 554 PSM TCNCETEDYGEK 1594 sp|Q00839|HNRPU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 2-UNIMOD:4,4-UNIMOD:4 ms_run[1]:scan=1.1.6299.9 60.15267 3 1504.5445 1504.5446 K F 388 400 PSM CFGTGAAGNR 1595 sp|P78527|PRKDC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 1-UNIMOD:4 ms_run[1]:scan=1.1.6379.10 62.3241 2 1009.4420 1009.4400 K T 1312 1322 PSM HECQANGPEDLNR 1596 sp|P60981-2|DEST_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 3-UNIMOD:4 ms_run[1]:scan=1.1.6352.7 61.5911 3 1538.6560 1538.6532 K A 116 129 PSM LGNDFHTNK 1597 sp|P08708|RS17_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6292.10 59.961 2 1044.4982 1044.4989 R R 24 33 PSM SDRPELTGAK 1598 sp|P13804|ETFA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6207.6 57.60172 3 1072.5529 1072.5513 K V 207 217 PSM LDELRDEGK 1599 sp|P02768|ALBU_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6429.3 63.6388 3 1073.5378 1073.5353 K A 206 215 PSM DTDSEEEIR 1600 sp|P0DP23|CALM1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6426.10 63.57248 2 1092.4574 1092.4571 K E 79 88 PSM VAHSDKPGSTSTASFR 1601 sp|Q9P0L0|VAPA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6279.9 59.59995 3 1646.8015 1646.8013 K D 206 222 PSM CGDSVYAAEK 1602 sp|Q16527|CSRP2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 1-UNIMOD:4 ms_run[1]:scan=1.1.6470.11 64.75507 2 1098.4630 1098.4652 R I 122 132 PSM GSNTIASAAADK 1603 sp|P55060-3|XPO2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6454.11 64.33217 2 1104.5384 1104.5411 R I 715 727 PSM QQTLEAEEAK 1604 sp|Q16643-3|DREB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6404.9 62.97903 2 1145.5564 1145.5564 K R 239 249 PSM ITAASQEHGLK 1605 sp|Q9BYC9|RM20_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6182.4 56.9047 3 1153.6099 1153.6091 R Y 72 83 PSM RNEIDAEPPAK 1606 sp|Q8TDN6|BRX1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6365.4 61.94402 3 1238.6233 1238.6255 K R 21 32 PSM ADKNEVAAEVAK 1607 sp|P56192|SYMC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6443.8 64.02541 3 1243.6396 1243.6408 K L 864 876 PSM SQGSGNEAEPLGK 1608 sp|Q9NUQ6-3|SPS2L_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6281.11 59.6586 2 1272.5924 1272.5946 K G 482 495 PSM KPYCNAHYPK 1609 sp|Q14847-2|LASP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 4-UNIMOD:4 ms_run[1]:scan=1.1.6163.5 56.38153 3 1276.6048 1276.6022 K Q 50 60 PSM QGCDCECLGGGR 1610 sp|Q9NRX4-2|PHP14_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 3-UNIMOD:4,5-UNIMOD:4,7-UNIMOD:4 ms_run[1]:scan=1.1.6478.11 64.96735 2 1367.5010 1367.5017 K I 67 79 PSM NPQNSSQSADGLR 1611 sp|P0DN76|U2AF5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6216.11 57.86012 2 1372.6334 1372.6331 R C 54 67 PSM TMQNTNDVETAR 1612 sp|P35222|CTNB1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6389.9 62.5846 2 1378.6176 1378.6147 R C 201 213 PSM LEVQATDREENK 1613 sp|P11387|TOP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6331.11 61.0271 2 1430.7006 1430.7001 K Q 701 713 PSM ETYGEMADCCAK 1614 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 6-UNIMOD:35,9-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.6438.11 63.89342 2 1449.5216 1449.5210 R Q 106 118 PSM AEDGATPSPSNETPK 1615 sp|P29966|MARCS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6270.11 59.35405 2 1499.6746 1499.6740 K K 138 153 PSM EAGEGGEAEAPAAEGGK 1616 sp|P29966|MARCS_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6124.11 55.32325 2 1528.6642 1528.6641 K D 177 194 PSM IHLAQSLHK 1617 sp|P55060-3|XPO2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6800.3 73.77499 3 1045.6030 1045.6032 K L 926 935 PSM TPVSITEHPK 1618 sp|Q14204|DYHC1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6620.2 68.84122 3 1107.5926 1107.5924 K I 1688 1698 PSM GAGTDDHTLIR 1619 sp|P08758|ANXA5_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6786.5 73.39357 3 1154.5669 1154.5680 K V 261 272 PSM PSHCTIYVAK 1620 sp|Q9P2J5-2|SYLC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 4-UNIMOD:4 ms_run[1]:scan=1.1.6638.5 69.33992 3 1174.5781 1174.5805 K N 879 889 PSM RLASTSDIEEK 1621 sp|O14974-2|MYPT1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6572.5 67.53732 3 1247.6344 1247.6357 R E 504 515 PSM GGPGGELPR 1622 sp|Q04637-9|IF4G1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6804.7 73.89124 2 838.4286 838.4297 R G 693 702 PSM RAESMLQQADK 1623 sp|P13797-2|PLST_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6770.4 72.95335 3 1275.6208 1275.6241 K L 323 334 PSM TVLDQQQTPSR 1624 sp|P42704|LPPRC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6820.5 74.32291 3 1271.6455 1271.6470 K L 1129 1140 PSM VEETTEHLVTK 1625 sp|P52732|KIF11_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6733.6 71.94363 3 1284.6538 1284.6561 K S 1035 1046 PSM RALANSLACQGK 1626 sp|P04075-2|ALDOA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 9-UNIMOD:4 ms_run[1]:scan=1.1.6735.4 71.99538 3 1287.6724 1287.6717 K Y 385 397 PSM RALANSLACQGK 1627 sp|P04075-2|ALDOA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 9-UNIMOD:4 ms_run[1]:scan=1.1.6709.7 71.28605 3 1287.6724 1287.6717 K Y 385 397 PSM RIAELSEDDQK 1628 sp|Q9BZE4|NOG1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6765.7 72.82155 3 1302.6376 1302.6415 K I 295 306 PSM KNHEEEISTLR 1629 sp|P08727|K1C19_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6737.8 72.05728 3 1354.6753 1354.6841 K G 216 227 PSM GPSSVEDIK 1630 sp|P06748-2|NPM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6807.7 73.97348 2 930.4654 930.4658 K A 211 220 PSM VTDALNATR 1631 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6679.7 70.46378 2 959.5030 959.5036 R A 421 430 PSM KPLTSSSAAPQRPISTQR 1632 sp|Q15691|MARE1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6604.10 68.42583 4 1924.0493 1924.0490 K T 151 169 PSM AGFAGDDAPR 1633 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6867.6 75.58868 2 975.4412 975.4410 K A 19 29 PSM MGGEEAEIR 1634 sp|Q08211|DHX9_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6842.8 74.90847 2 990.4424 990.4440 R F 930 939 PSM VNEIVETNRPDSK 1635 sp|Q15008-2|PSMD6_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6755.9 72.55423 3 1499.7550 1499.7580 K N 312 325 PSM VSGGPSLEQR 1636 sp|Q9Y262|EIF3L_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6730.10 71.86753 2 1028.5246 1028.5251 K F 144 154 PSM IAPPETPDSK 1637 sp|Q9NZI8|IF2B1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6911.9 76.76655 2 1053.5338 1053.5342 K V 441 451 PSM SNIHCNTIAPNAGSR 1638 sp|P51659-2|DHB4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 5-UNIMOD:4 ms_run[1]:scan=1.1.6577.8 67.6798 3 1610.7571 1610.7583 K M 210 225 PSM IADGYEQAAR 1639 sp|P48643|TCPE_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6849.11 75.10405 2 1092.5136 1092.5200 R V 133 143 PSM APVQPQQSPAAAPGGTDEKPSGK 1640 sp|Q13200|PSMD2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6620.9 68.85288 4 2217.1037 2217.1026 K E 9 32 PSM AYGELPEHAK 1641 sp|O14602|IF1AY_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6876.11 75.84413 2 1113.5448 1113.5454 K I 105 115 PSM LIANNTTVER 1642 sp|O96019-2|ACL6A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6845.10 74.99345 2 1129.6072 1129.6091 K R 338 348 PSM CATITPDEAR 1643 sp|P48735|IDHP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 1-UNIMOD:4 ms_run[1]:scan=1.1.6742.10 72.19853 2 1132.5194 1132.5183 K V 113 123 PSM QQSELQSQVR 1644 sp|Q14847-2|LASP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6586.11 67.9326 2 1201.6058 1201.6051 K Y 76 86 PSM ILGTAGTEEGQK 1645 sp|Q08257|QOR_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6630.11 69.13087 2 1202.6112 1202.6143 K I 176 188 PSM LSSDCEDQIR 1646 sp|Q92896|GSLG1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 5-UNIMOD:4 ms_run[1]:scan=1.1.6854.10 75.23901 2 1221.5276 1221.5296 R I 980 990 PSM YSTSGSSGLTTGK 1647 sp|Q16891-2|MIC60_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6593.11 68.12598 2 1244.5876 1244.5885 R I 33 46 PSM EMDEAATAEER 1648 sp|Q04637-9|IF4G1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6605.10 68.45316 2 1250.5094 1250.5085 K G 874 885 PSM KQGEDNSTAQDTEELEK 1649 sp|Q86UE4|LYRIC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6764.11 72.80098 3 1920.8539 1920.8548 K E 451 468 PSM RALANSLACQGK 1650 sp|P04075-2|ALDOA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 9-UNIMOD:4 ms_run[1]:scan=1.1.6707.11 71.23785 2 1287.6716 1287.6717 K Y 385 397 PSM AEFEDQDDEAR 1651 sp|Q14692|BMS1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6878.10 75.89727 2 1323.5216 1323.5215 R V 864 875 PSM NVLCSACSGQGGK 1652 sp|O60884|DNJA2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 4-UNIMOD:4,7-UNIMOD:4 ms_run[1]:scan=1.1.6732.10 71.92267 2 1336.5870 1336.5864 K S 140 153 PSM SRAEAALEEESR 1653 sp|Q969G3-2|SMCE1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6904.4 76.57719 3 1346.6413 1346.6426 K Q 147 159 PSM DTDGGPKEEESPV 1654 sp|P53985|MOT1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6909.11 76.71803 2 1358.5840 1358.5838 K - 488 501 PSM STTSVSEEDVSSR 1655 sp|Q96IZ0|PAWR_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6688.11 70.7171 2 1382.6172 1382.6161 K Y 228 241 PSM ELTNQQEASVER 1656 sp|Q14203-2|DCTN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6767.11 72.8829 2 1402.6688 1402.6688 R Q 399 411 PSM LSGCSQDCEDLK 1657 sp|Q07954|LRP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 4-UNIMOD:4,8-UNIMOD:4 ms_run[1]:scan=1.1.6766.11 72.85551 2 1410.5768 1410.5755 K I 2949 2961 PSM VEQATKPSFESGR 1658 sp|P38159-2|RBMX_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6750.11 72.42055 2 1434.7110 1434.7103 K R 68 81 PSM VMSQNFTNCHTK 1659 sp|Q13283|G3BP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 9-UNIMOD:4 ms_run[1]:scan=1.1.6834.11 74.6989 2 1465.6426 1465.6442 K I 65 77 PSM NTENNDVEISETK 1660 sp|Q5UIP0|RIF1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6861.11 75.43233 2 1491.6692 1491.6689 K K 1751 1764 PSM EVYQQQQYGSGGR 1661 sp|Q99729-2|ROAA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6858.11 75.35008 2 1498.6804 1498.6801 K G 233 246 PSM QEAGISEGQGTAGEEEEK 1662 sp|O43583|DENR_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6754.11 72.53014 2 1847.8020 1847.8021 K K 76 94 PSM AGFAGDDAPR 1663 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6928.2 77.2004 3 975.4396 975.4410 K A 19 29 PSM IHPVSTMVK 1664 sp|P07195|LDHB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6933.3 77.33614 3 1010.5570 1010.5583 R G 271 280 PSM TTAAHGLELR 1665 sp|P08243-2|ASNS_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7245.4 85.73457 3 1067.5711 1067.5723 R V 387 397 PSM YALTGDEVKK 1666 sp|P62701|RS4X_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7182.4 84.02548 3 1122.5941 1122.5921 K I 54 64 PSM RFPGYDSESK 1667 sp|P46777|RL5_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7300.3 87.24316 3 1184.5474 1184.5462 K E 179 189 PSM HQGVMVGMGQK 1668 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 5-UNIMOD:35,8-UNIMOD:35 ms_run[1]:scan=1.1.6926.2 77.14732 3 1202.5534 1202.5536 R D 40 51 PSM RYESHPVCADLQAK 1669 sp|Q9NX63|MIC19_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 8-UNIMOD:4 ms_run[1]:scan=1.1.7157.4 83.37718 4 1672.7957 1672.7991 K I 176 190 PSM YLAEVAAGDDKK 1670 sp|P63104|1433Z_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7096.3 81.72598 3 1278.6454 1278.6456 R G 128 140 PSM RVLIAAHGNSLR 1671 sp|P18669|PGAM1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7111.3 82.13412 3 1305.7603 1305.7629 K G 180 192 PSM RVLIAAHGNSLR 1672 sp|P18669|PGAM1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7131.4 82.671 3 1305.7603 1305.7629 K G 180 192 PSM RGDIIGVQGNPGK 1673 sp|Q15046-2|SYK_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7260.4 86.14552 3 1309.7095 1309.7103 R T 206 219 PSM AKLEEQAQQIR 1674 sp|P02649|APOE_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7029.7 79.92482 3 1312.7089 1312.7099 R L 259 270 PSM VLDSGAPIK 1675 sp|P06576|ATPB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7268.9 86.37365 2 898.5118 898.5124 K I 125 134 PSM KGESQTDIEITR 1676 sp|P49368|TCPG_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7271.4 86.44794 3 1375.6927 1375.6943 K E 249 261 PSM AVVGVVAGGGR 1677 sp|P62917|RL8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7180.9 83.9814 2 940.5450 940.5454 R I 164 175 PSM SDYDGIGSR 1678 sp|O00571-2|DDX3X_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7141.10 82.95205 2 968.4228 968.4199 R G 86 95 PSM AGFAGDDAPR 1679 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6946.6 77.69215 2 975.4412 975.4410 K A 19 29 PSM LQSIGTENTEENR 1680 sp|P04075-2|ALDOA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7117.10 82.30675 3 1489.7029 1489.7008 R R 98 111 PSM KYEEIDNAPEER 1681 sp|P49411|EFTU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7176.6 83.87244 3 1491.6838 1491.6841 K A 91 103 PSM AEAGPEGVAPAPEGEK 1682 sp|Q9Y4L1|HYOU1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7258.9 86.09911 3 1507.7155 1507.7154 K K 670 686 PSM MNEAFGDTK 1683 sp|Q13263-2|TIF1B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7091.7 81.5968 2 1011.4330 1011.4331 R F 714 723 PSM LLVSASQDGK 1684 sp|P62873-2|GBB1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7078.9 81.24623 2 1016.5494 1016.5502 R L 69 79 PSM LLVSASQDGK 1685 sp|P62873-2|GBB1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7059.11 80.74465 2 1016.5494 1016.5502 R L 69 79 PSM ANAQAAALYK 1686 sp|P40121-2|CAPG_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7081.9 81.32767 2 1019.5440 1019.5399 K V 229 239 PSM TAVCDIPPR 1687 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 4-UNIMOD:4 ms_run[1]:scan=1.1.7313.8 87.60667 2 1027.5100 1027.5121 K G 351 360 PSM TAVCDIPPR 1688 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 4-UNIMOD:4 ms_run[1]:scan=1.1.7184.7 84.08328 2 1027.5126 1027.5121 K G 351 360 PSM LFQECCPHSTDR 1689 sp|P61978|HNRPK_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 5-UNIMOD:4,6-UNIMOD:4 ms_run[1]:scan=1.1.7284.7 86.81178 3 1548.6439 1548.6450 K V 180 192 PSM NGSLICTASK 1690 sp|Q9ULV4-2|COR1C_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 6-UNIMOD:4 ms_run[1]:scan=1.1.7043.7 80.30237 2 1049.5150 1049.5175 R D 191 201 PSM EATNPPVIQEEKPK 1691 sp|P30101|PDIA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7191.7 84.27219 3 1578.8248 1578.8253 R K 483 497 PSM GGTLTQYEGK 1692 sp|Q16851|UGPA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7267.8 86.34457 2 1052.5116 1052.5138 K L 292 302 PSM QIPQATASMK 1693 sp|O43175|SERA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7172.9 83.7738 2 1073.5548 1073.5539 R D 120 130 PSM RFDGVQDPR 1694 sp|O00264-2|PGRC1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7061.2 80.78316 3 1088.5354 1088.5363 R I 80 89 PSM LVTANTIDQK 1695 sp|Q9NRZ9-2|HELLS_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7269.10 86.40289 2 1101.6026 1101.6030 R I 706 716 PSM VVQSLEQTAR 1696 sp|Q15631-2|TSN_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6988.8 78.83556 2 1129.6084 1129.6091 K E 27 37 PSM GAVAEDGDELR 1697 sp|P27695|APEX1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7097.10 81.76498 2 1130.5212 1130.5204 K T 8 19 PSM ALELDSNNEK 1698 sp|Q02790|FKBP4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7238.10 85.55317 2 1131.5414 1131.5407 K G 345 355 PSM VTLTSEEEAR 1699 sp|P00338-3|LDHA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7241.11 85.63682 2 1133.5548 1133.5564 K L 335 345 PSM VGSVLQEGCGK 1700 sp|P31040-2|SDHA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 9-UNIMOD:4 ms_run[1]:scan=1.1.7075.9 81.16638 2 1132.5552 1132.5547 R I 480 491 PSM IAVAAQNCYK 1701 sp|P60174|TPIS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 8-UNIMOD:4 ms_run[1]:scan=1.1.7206.8 84.68195 2 1136.5638 1136.5648 K V 97 107 PSM EQEITAVQAR 1702 sp|Q9P2E9|RRBP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7125.8 82.51708 2 1143.5890 1143.5884 R M 752 762 PSM IANPVEGSTDR 1703 sp|Q15366-2|PCBP2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7213.11 84.87632 2 1157.5680 1157.5677 K Q 324 335 PSM YLSEVASGDNK 1704 sp|P31946-2|1433B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7028.11 79.9051 2 1181.5542 1181.5564 R Q 128 139 PSM HQGVMVGMGQK 1705 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 8-UNIMOD:35 ms_run[1]:scan=1.1.6948.4 77.7428 3 1186.5595 1186.5587 R D 40 51 PSM VSGAQEMVSSAK 1706 sp|O60664-3|PLIN3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7255.10 86.01859 2 1192.5726 1192.5758 K D 129 141 PSM DREVAEGGLPR 1707 sp|Q9BUA3|SPNDC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7140.5 82.9165 3 1197.6223 1197.6102 K A 295 306 PSM SEETLDEGPPK 1708 sp|Q00688|FKBP3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7002.9 79.21837 2 1200.5522 1200.5510 K Y 100 111 PSM YSDEENLPEK 1709 sp|Q9BQI0-3|AIF1L_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7210.9 84.79205 2 1222.5338 1222.5353 K L 39 49 PSM LFSQGQDVSNK 1710 sp|P55196|AFAD_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7191.10 84.27718 2 1221.6034 1221.5990 R V 1797 1808 PSM SYSSGGEDGYVR 1711 sp|Q13347|EIF3I_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7236.11 85.50005 2 1275.5378 1275.5368 K I 299 311 PSM YLAEVAAGDDKK 1712 sp|P63104|1433Z_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7075.10 81.16805 2 1278.6456 1278.6456 R G 128 140 PSM MDSTEPPYSQK 1713 sp|Q5VTE0|EF1A3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6925.10 77.13412 2 1281.5544 1281.5547 K R 155 166 PSM EAMEDGEIDGNK 1714 sp|P19338|NUCL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7027.11 79.87875 2 1306.5342 1306.5347 K V 628 640 PSM DEFTNTCPSDK 1715 sp|Q9Y696|CLIC4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 7-UNIMOD:4 ms_run[1]:scan=1.1.7072.11 81.09032 2 1312.5254 1312.5242 R E 228 239 PSM EAQELSQNSAIK 1716 sp|Q9NR30|DDX21_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7052.9 80.55127 2 1316.6584 1316.6572 K Q 450 462 PSM ERSDALNSAIDK 1717 sp|P35221-2|CTNA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7239.10 85.58047 2 1317.6520 1317.6524 K M 359 371 PSM EVATNSELVQSGK 1718 sp|P02533|K1C14_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7148.11 83.14508 2 1360.6824 1360.6834 R S 316 329 PSM AAFTECCQAADK 1719 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 6-UNIMOD:4,7-UNIMOD:4 ms_run[1]:scan=1.1.7111.9 82.14412 2 1370.5608 1370.5595 K A 187 199 PSM YICENQDSISSK 1720 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 3-UNIMOD:4 ms_run[1]:scan=1.1.7274.10 86.54076 2 1442.6380 1442.6347 K L 287 299 PSM SETAPAAPAAAPPAEK 1721 sp|P16403|H12_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1000663, ProteinPilot, ] 22 ms_run[1]:scan=1.1.7161.11 83.49308 2 1477.7416470956603 1477.74127263469 M A 2 18 PSM EASDPQPEEADGGLK 1722 sp|P52907|CAZA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7274.11 86.54243 2 1541.6856 1541.6845 K S 104 119 PSM AAPGAEFAPNK 1723 sp|Q15233-2|NONO_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7588.4 94.94385 3 1071.5350 1071.5349 R R 368 379 PSM VVGCSCVVVK 1724 sp|P25398|RS12_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 4-UNIMOD:4,6-UNIMOD:4 ms_run[1]:scan=1.1.7450.3 91.18716 3 1105.5604 1105.5624 K D 103 113 PSM QAGEVTFADAHRPK 1725 sp|Q13243-3|SRSF5_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7516.3 92.97545 4 1525.7621 1525.7637 R L 127 141 PSM VLVAQHDVYK 1726 sp|P13804|ETFA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7394.3 89.74285 3 1170.6391 1170.6397 K G 76 86 PSM LRAELDEVNK 1727 sp|Q03252|LMNB2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7579.3 94.69642 3 1185.6322 1185.6353 K S 124 134 PSM RFPGYDSESK 1728 sp|P46777|RL5_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7322.7 87.8509 3 1184.5474 1184.5462 K E 179 189 PSM AALSEEELEKK 1729 sp|Q04637-9|IF4G1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7561.4 94.2044 3 1245.6403 1245.6452 K S 1242 1253 PSM FACHSASLTVR 1730 sp|Q15233-2|NONO_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 3-UNIMOD:4 ms_run[1]:scan=1.1.7711.4 98.2838 3 1247.6107 1247.6081 R N 54 65 PSM TRPDGNCFYR 1731 sp|Q96FW1|OTUB1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 7-UNIMOD:4 ms_run[1]:scan=1.1.7460.5 91.45412 3 1284.5665 1284.5670 K A 85 95 PSM INISEGNCPER 1732 sp|Q15365|PCBP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 8-UNIMOD:4 ms_run[1]:scan=1.1.7559.5 94.1513 3 1287.5833 1287.5877 R I 47 58 PSM EAPPMEKPEVVK 1733 sp|P62841|RS15_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7578.6 94.67402 3 1352.7001 1352.7010 K T 66 78 PSM QAHLTNQYMQR 1734 sp|P11940-2|PABP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7332.8 88.12379 3 1388.6593 1388.6619 R M 375 386 PSM LAHLGVQVK 1735 sp|P04843|RPN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7653.2 96.69746 3 963.5848 963.5865 R G 81 90 PSM REFTESQLQEGK 1736 sp|Q01995|TAGL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7557.7 94.0997 3 1450.7017 1450.7052 K H 161 173 PSM AEDAVEAIR 1737 sp|Q9BWF3|RBM4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7620.9 95.80797 2 972.4854 972.4876 R G 121 130 PSM LGLGEGAEEK 1738 sp|P18754-2|RCC1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7353.7 88.67925 2 1001.5034 1001.5029 R S 357 367 PSM SLQSVAEER 1739 sp|P61313|RL15_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7596.10 95.16995 2 1017.5058 1017.5091 R A 97 106 PSM TAVCDIPPR 1740 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 4-UNIMOD:4 ms_run[1]:scan=1.1.7491.9 92.30511 2 1027.5066 1027.5121 K G 351 360 PSM TAVCDIPPR 1741 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 4-UNIMOD:4 ms_run[1]:scan=1.1.7450.8 91.1955 2 1027.5156 1027.5121 K G 351 360 PSM TAVCDIPPR 1742 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 4-UNIMOD:4 ms_run[1]:scan=1.1.7430.8 90.67873 2 1027.5116 1027.5121 K G 351 360 PSM YRPGTVALR 1743 sp|Q71DI3|H32_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7337.3 88.2487 3 1031.5867 1031.5876 R E 42 51 PSM YRPGTVALR 1744 sp|Q71DI3|H32_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7375.2 89.25555 3 1031.5873 1031.5876 R E 42 51 PSM VIDDTNITR 1745 sp|P05783|K1C18_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7390.7 89.64782 2 1045.5414 1045.5404 K L 188 197 PSM IAELCDDPK 1746 sp|P18206|VINC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 5-UNIMOD:4 ms_run[1]:scan=1.1.7346.10 88.49865 2 1059.4924 1059.4906 K E 418 427 PSM NIVQHTTDSSLEEK 1747 sp|Q9H501|ESF1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7403.9 89.98254 3 1599.7684 1599.7740 K Q 171 185 PSM LGEYEDVSR 1748 sp|Q99426|TBCB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7634.7 96.1875 2 1066.4902 1066.4931 R V 95 104 PSM YLAEVASGEK 1749 sp|Q04917|1433F_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7558.8 94.12881 2 1065.5310 1065.5342 R K 133 143 PSM YLAEVASGEK 1750 sp|Q04917|1433F_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7551.9 93.93885 2 1065.5310 1065.5342 R K 133 143 PSM NGEVQNLAVK 1751 sp|Q86VP6|CAND1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7457.10 91.3824 2 1070.5720 1070.5720 K C 61 71 PSM QAEILQESR 1752 sp|O75347|TBCA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7368.9 89.08127 2 1072.5486 1072.5513 K M 53 62 PSM STLADYSAQK 1753 sp|Q9UKV3|ACINU_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7452.7 91.24596 2 1082.5244 1082.5244 K D 507 517 PSM LKGDDLQAIK 1754 sp|P07910-2|HNRPC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7700.4 97.98383 3 1099.6207 1099.6237 K Q 175 185 PSM LQETLSAADR 1755 sp|P78527|PRKDC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7531.9 93.39326 2 1102.5614 1102.5618 R C 15 25 PSM VTEDTSSVLR 1756 sp|P05165|PCCA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7577.11 94.65507 2 1105.5586 1105.5615 K S 654 664 PSM AFEEDQVAGR 1757 sp|O43818|U3IP2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7490.9 92.2779 2 1120.5128 1120.5149 R L 102 112 PSM YETTGLSEAR 1758 sp|Q15833-2|STXB2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7344.9 88.44397 2 1125.5336 1125.5302 R E 263 273 PSM EDLESSGLQR 1759 sp|Q9UK76-2|JUPI1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7662.10 96.95672 2 1132.5342 1132.5360 R R 75 85 PSM TTGEVVSGVVSK 1760 sp|Q14008-2|CKAP5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7678.8 97.39287 2 1161.6208 1161.6241 K V 85 97 PSM VDTCHTPFGK 1761 sp|P52701-3|MSH6_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 4-UNIMOD:4 ms_run[1]:scan=1.1.7354.5 88.7024 3 1160.5300 1160.5285 R R 632 642 PSM FDDGDVTECK 1762 sp|Q93008-1|USP9X_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 9-UNIMOD:4 ms_run[1]:scan=1.1.7440.10 90.93965 2 1184.4620 1184.4656 K M 1900 1910 PSM FEEQGASDLAK 1763 sp|Q7Z2Z2-2|EFL1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7628.11 96.02979 2 1193.5530 1193.5564 K E 851 862 PSM TEYLSNADER 1764 sp|Q14204|DYHC1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7326.9 87.96347 2 1196.5274 1196.5309 R L 3550 3560 PSM SGTVDPQELQK 1765 sp|P30626-2|SORCN_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7372.10 89.19006 2 1200.5964 1200.5986 R A 102 113 PSM EGDVLTPEQAR 1766 sp|Q9UKD2|MRT4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7670.11 97.17796 2 1213.5896 1213.5939 K V 178 189 PSM AFDTAGNGYCR 1767 sp|P49327|FAS_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 10-UNIMOD:4 ms_run[1]:scan=1.1.7710.9 98.26482 2 1230.5064 1230.5088 K S 214 225 PSM QEGGDNDLIER 1768 sp|P30566|PUR8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7550.10 93.91309 2 1244.5608 1244.5633 K I 416 427 PSM VIGSGCNLDSAR 1769 sp|P07195|LDHB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 6-UNIMOD:4 ms_run[1]:scan=1.1.7548.9 93.8568 2 1247.5922 1247.5928 R F 159 171 PSM VEVLNDEDCR 1770 sp|Q6DKJ4-3|NXN_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 9-UNIMOD:4 ms_run[1]:scan=1.1.7644.10 96.46571 2 1247.5440 1247.5452 R E 186 196 PSM ISSDLDGHPVPK 1771 sp|P29401-2|TKT_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7633.5 96.1569 3 1263.6421 1263.6459 K Q 103 115 PSM HVVPNEVVVQR 1772 sp|P06396-2|GELS_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7697.9 97.91077 2 1274.7064 1274.7095 K L 127 138 PSM EATTVDCNDLR 1773 sp|Q6UXK5|LRRN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 7-UNIMOD:4 ms_run[1]:scan=1.1.7458.11 91.4106 2 1292.5710 1292.5667 R L 52 63 PSM GVDLQENNPASR 1774 sp|P51148-2|RAB5C_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7526.9 93.25745 2 1298.6208 1298.6215 R S 232 244 PSM NCNDFQYESK 1775 sp|Q04917|1433F_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 2-UNIMOD:4 ms_run[1]:scan=1.1.7498.11 92.49944 2 1303.5122 1303.5139 K V 111 121 PSM FCANTCVECR 1776 sp|Q13642-4|FHL1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 2-UNIMOD:4,6-UNIMOD:4,9-UNIMOD:4 ms_run[1]:scan=1.1.7574.10 94.57103 2 1315.5094 1315.5108 K K 64 74 PSM NSEPAGLETPEAK 1777 sp|P07814|SYEP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7615.10 95.6748 2 1341.6374 1341.6412 R V 890 903 PSM ALQQEQEIEQR 1778 sp|Q86YP4-2|P66A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7454.11 91.305 2 1370.6752 1370.6790 K L 465 476 PSM YICENQDSISSK 1779 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 3-UNIMOD:4 ms_run[1]:scan=1.1.7413.11 90.2469 2 1442.6346 1442.6347 K L 287 299 PSM EVDEQMLNVQNK 1780 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 6-UNIMOD:35 ms_run[1]:scan=1.1.7640.10 96.35647 2 1461.6754 1461.6769 K N 325 337 PSM EVDEQMLNVQNK 1781 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 6-UNIMOD:35 ms_run[1]:scan=1.1.7607.11 95.46345 2 1461.6766 1461.6769 K N 325 337 PSM GVEEEEEDGEMRE 1782 sp|P62306|RUXF_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7652.7 96.67852 3 1536.5851 1536.5886 R - 74 87 PSM EGATVYATGTHAQVEDGR 1783 sp|P32322-3|P5CR1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7615.11 95.67647 2 1860.8590 1860.8602 R L 157 175 PSM VSVSPVVHVR 1784 sp|Q8WVV9-5|HNRLL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7969.2 105.2987 3 1077.6262 1077.6295 K G 72 82 PSM SSFSHYSGLK 1785 sp|Q8NC51-3|PAIRB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7920.2 103.9559 3 1111.5286 1111.5298 R H 202 212 PSM ILAHNNFVGR 1786 sp|Q9NZI8|IF2B1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7839.2 101.7339 3 1139.6173 1139.6200 K L 281 291 PSM LTGVFAPRPSTGPHK 1787 sp|P62701|RS4X_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8085.2 108.408 4 1563.8489 1563.8522 K L 23 38 PSM VDNDENEHQLSLR 1788 sp|P06748-2|NPM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7752.3 99.40393 4 1567.7201 1567.7226 K T 33 46 PSM DGNDLHMTYK 1789 sp|O60884|DNJA2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7845.3 101.8994 3 1192.5157 1192.5183 R I 263 273 PSM TLEQHDNIVTHYK 1790 sp|O60763-2|USO1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7781.2 100.1624 4 1596.7885 1596.7896 K N 655 668 PSM IFHELTQTDK 1791 sp|P11586|C1TC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7782.5 100.1936 3 1230.6235 1230.6245 R A 464 474 PSM HIDLVEGDEGR 1792 sp|P19367-4|HXK1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7975.5 105.4673 3 1238.5861 1238.5891 R M 232 243 PSM SGSSFVHQASFK 1793 sp|P49792|RBP2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8099.3 108.7729 3 1280.6116 1280.6150 K F 1447 1459 PSM AGVAPLQVK 1794 sp|P21333-2|FLNA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7949.5 104.7548 2 881.5318 881.5334 K V 1478 1487 PSM AIEAALAAR 1795 sp|P30038-2|AL4A1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8096.7 108.7014 2 884.5032 884.5079 K K 45 54 PSM EAGDVCYADVQK 1796 sp|Q13242|SRSF9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 6-UNIMOD:4 ms_run[1]:scan=1.1.7858.6 102.2602 3 1353.5836 1353.5871 R D 133 145 PSM SAVENCQDSWR 1797 sp|P52209-2|6PGD_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 6-UNIMOD:4 ms_run[1]:scan=1.1.7804.3 100.7829 3 1350.5596 1350.5623 K R 384 395 PSM ELEAENYHDIK 1798 sp|Q01082-3|SPTB2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8115.9 109.213 3 1359.6304 1359.6306 R R 474 485 PSM RTEEGPTLSYGR 1799 sp|P43243|MATR3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7731.6 98.83382 3 1364.6656 1364.6684 R D 149 161 PSM SEPIPESNDGPVK 1800 sp|P30101|PDIA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7785.4 100.2706 3 1367.6545 1367.6569 K V 367 380 PSM DGVVEITGK 1801 sp|P04792|HSPB1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7925.7 104.1015 2 916.4780 916.4866 K H 115 124 PSM IAGPGLGSGVR 1802 sp|O75369-2|FLNB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7993.9 105.9636 2 982.5522 982.5560 K A 1426 1437 PSM IAGPGLGSGVR 1803 sp|O75369-2|FLNB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8012.7 106.4784 2 982.5522 982.5560 K A 1426 1437 PSM IEANEALVK 1804 sp|P30049|ATPD_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7799.6 100.652 2 985.5422 985.5444 R A 157 166 PSM SAINEVVTR 1805 sp|P62899|RL31_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7907.6 103.6065 2 987.5320 987.5349 R E 15 24 PSM SAINEVVTR 1806 sp|P62899|RL31_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7888.6 103.085 2 987.5320 987.5349 R E 15 24 PSM RDPHLACVAYER 1807 sp|Q00610-2|CLH1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 7-UNIMOD:4 ms_run[1]:scan=1.1.7863.7 102.3991 3 1485.7111 1485.7147 K G 912 924 PSM DLEDKEGEIQAGAK 1808 sp|Q13409-2|DC1I2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7952.5 104.8375 3 1501.7221 1501.7260 R L 245 259 PSM LQSEVAELK 1809 sp|P53990-2|IST1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8111.11 109.1074 2 1015.5532 1015.5549 R I 110 119 PSM TAVCDIPPR 1810 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 4-UNIMOD:4 ms_run[1]:scan=1.1.7881.8 102.8962 2 1027.5078 1027.5121 K G 351 360 PSM TAVCDIPPR 1811 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 4-UNIMOD:4 ms_run[1]:scan=1.1.7738.8 99.0286 2 1027.5110 1027.5121 K G 351 360 PSM ADLEGSLDSK 1812 sp|Q15031|SYLM_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7892.6 103.1947 2 1033.4908 1033.4928 K I 364 374 PSM TADGIVSHLK 1813 sp|P30101|PDIA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8002.2 106.1967 3 1039.5652 1039.5662 R K 120 130 PSM QLSSGVSEIR 1814 sp|P04792|HSPB1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7913.9 103.7758 2 1074.5642 1074.5669 R H 80 90 PSM LEPKPQPPVAEATPR 1815 sp|Q9UHD8|SEPT9_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7799.9 100.657 3 1628.8837 1628.8886 R S 223 238 PSM QEAVVEEDYNENAK 1816 sp|P82970|HMGN5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7933.8 104.3221 3 1636.7179 1636.7216 K N 68 82 PSM LKGDDLQAIK 1817 sp|P07910-2|HNRPC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7719.4 98.50252 3 1099.6207 1099.6237 K Q 175 185 PSM CDEPILSNR 1818 sp|P30086|PEBP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 1-UNIMOD:4 ms_run[1]:scan=1.1.7817.9 101.1472 2 1102.5052 1102.5077 K S 133 142 PSM CDEPILSNR 1819 sp|P30086|PEBP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 1-UNIMOD:4 ms_run[1]:scan=1.1.7798.9 100.6299 2 1102.5054 1102.5077 K S 133 142 PSM EETQPPVALK 1820 sp|Q8NC51-3|PAIRB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7835.10 101.638 2 1110.5890 1110.5921 K K 93 103 PSM RDPHLACVAYER 1821 sp|Q00610-2|CLH1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 7-UNIMOD:4 ms_run[1]:scan=1.1.7857.2 102.2263 4 1485.7089 1485.7147 K G 912 924 PSM TPCEEVYVK 1822 sp|Q14315-2|FLNC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 3-UNIMOD:4 ms_run[1]:scan=1.1.7752.9 99.41393 2 1123.5218 1123.5220 K H 2644 2653 PSM ILAHNNFVGR 1823 sp|Q9NZI8|IF2B1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7820.2 101.2171 3 1139.6173 1139.6200 K L 281 291 PSM IGAEVYHNLK 1824 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8000.2 106.1423 3 1142.6074 1142.6084 R N 184 194 PSM IGAEVYHNLK 1825 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7981.3 105.6273 3 1142.6074 1142.6084 R N 184 194 PSM VLTVINQTQK 1826 sp|P42766|RL35_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8056.11 107.6772 2 1142.6622 1142.6659 R E 57 67 PSM EQLGEEIDSK 1827 sp|Q9NR30|DDX21_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7848.8 101.9897 2 1146.5360 1146.5404 K V 659 669 PSM NADLCIASGTK 1828 sp|Q06330-4|SUH_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 5-UNIMOD:4 ms_run[1]:scan=1.1.7754.10 99.47035 2 1148.5492 1148.5496 K V 161 172 PSM LNQSPSLAPVK 1829 sp|Q9H2P0|ADNP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7954.9 104.8988 2 1152.6458 1152.6503 R R 706 717 PSM NLDDGIDDER 1830 sp|P11940-2|PABP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7954.10 104.9005 2 1160.4940 1160.4946 K L 300 310 PSM LAPEYEAAATR 1831 sp|P30101|PDIA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7900.11 103.4227 2 1190.5910 1190.5931 R L 63 74 PSM AAVMVYDDANK 1832 sp|Q8N8S7|ENAH_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8074.8 108.1404 2 1195.5532 1195.5543 R K 11 22 PSM LGSTEVASNVPK 1833 sp|Q9Y5A9-2|YTHD2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7818.11 101.1777 2 1200.6322 1200.6350 K V 144 156 PSM VNWATTPSSQK 1834 sp|Q01085-2|TIAR_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7927.11 104.1629 2 1217.6034 1217.6040 K K 97 108 PSM AVENSSTAIGIR 1835 sp|P25788-2|PSA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8057.11 107.7031 2 1216.6406 1216.6411 K C 30 42 PSM EENSTEEQALEDQNAK 1836 sp|Q9NQZ2|SAS10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7765.11 99.7602 3 1833.7891 1833.7864 K R 393 409 PSM TAENATSGETLEENEAGD 1837 sp|Q9UQ80|PA2G4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8103.10 108.8902 3 1836.7528 1836.7497 K - 377 395 PSM ESEAVEWQQK 1838 sp|P26038|MOES_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8014.11 106.5398 2 1232.5642 1232.5673 K A 439 449 PSM NNTQVLINCR 1839 sp|P62316|SMD2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 9-UNIMOD:4 ms_run[1]:scan=1.1.7998.9 106.0996 2 1230.6132 1230.6139 K N 38 48 PSM IEQIQCYSAK 1840 sp|P52948-2|NUP98_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 6-UNIMOD:4 ms_run[1]:scan=1.1.8108.8 109.0211 2 1238.5958 1238.5965 R D 1639 1649 PSM AADSLQQNLQR 1841 sp|Q1ED39|KNOP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7875.10 102.7348 2 1242.6288 1242.6316 K D 408 419 PSM GTVIIIANHGDR 1842 sp|Q16851|UGPA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8043.11 107.3306 2 1264.6868 1264.6888 K I 474 486 PSM EYDELAETQGK 1843 sp|O60341-2|KDM1A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8004.10 106.2645 2 1281.5714 1281.5724 K L 517 528 PSM VYIASSSGSTAIK 1844 sp|O75368|SH3L1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7895.10 103.2838 2 1282.6738 1282.6769 R K 5 18 PSM VEDVVVSDECR 1845 sp|Q96EK6|GNA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 10-UNIMOD:4 ms_run[1]:scan=1.1.7834.10 101.6107 2 1305.5850 1305.5871 R G 119 130 PSM GGGPAGAGGEAPAALR 1846 sp|Q5RKV6|EXOS6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7822.11 101.2864 2 1307.6570 1307.6582 R G 78 94 PSM SAVENCQDSWR 1847 sp|P52209-2|6PGD_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 6-UNIMOD:4 ms_run[1]:scan=1.1.7795.10 100.5503 2 1350.5602 1350.5623 K R 384 395 PSM EAGDVCYADVQK 1848 sp|Q13242|SRSF9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 6-UNIMOD:4 ms_run[1]:scan=1.1.7860.9 102.3199 2 1353.5862 1353.5871 R D 133 145 PSM AITPQAQEELQK 1849 sp|Q02952-2|AKA12_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7873.11 102.6812 2 1354.7052 1354.7092 K Q 1660 1672 PSM YIASVQGSTPSPR 1850 sp|P49792|RBP2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7877.10 102.7896 2 1361.6920 1361.6939 R Q 11 24 PSM QSSSTNYTNELK 1851 sp|Q9UHB6-4|LIMA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7736.11 98.97874 2 1370.6324 1370.6314 K A 281 293 PSM AVANYDSVEEGEK 1852 sp|P51659-2|DHB4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7776.10 100.0457 2 1409.6300 1409.6310 K V 94 107 PSM EFHLNESGDPSSK 1853 sp|Q01105-2|SET_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8046.6 107.4038 3 1445.6413 1445.6423 K S 142 155 PSM SQTGVGELTTQNTR 1854 sp|Q96A65|EXOC4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7792.10 100.4689 2 1490.7324 1490.7325 R L 935 949 PSM TPEAVESPQEASGVR 1855 sp|Q7L190|DPPA4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7879.11 102.8463 2 1555.7450 1555.7478 R W 215 230 PSM LQMEQQQQLQQR 1856 sp|Q9NS69|TOM22_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7923.11 104.0534 2 1556.7692 1556.7729 K Q 106 118 PSM EQYQQQQQWGSR 1857 sp|Q14103-3|HNRPD_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7769.11 99.86414 2 1564.6976 1564.7019 K G 261 273 PSM LYPTSCHTACTLR 1858 sp|Q08431-2|MFGM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 6-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.7873.10 102.6795 3 1578.7276 1578.7283 R F 95 108 PSM KQPPVSPGTALVGSQK 1859 sp|P17096|HMGA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7946.11 104.6826 2 1592.8888 1592.8886 R E 31 47 PSM HQQQLLASPGSSTVDNK 1860 sp|Q9C0E2|XPO4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7738.10 99.03194 3 1808.8972 1808.9017 R M 514 531 PSM EYINECDSDYHEER 1861 sp|Q93008-1|USP9X_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 6-UNIMOD:4 ms_run[1]:scan=1.1.8013.9 106.509 3 1857.7093 1857.7111 R T 859 873 PSM LITDLQDQNQK 1862 sp|P33176|KINH_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8298.10 114.1915 2 1314.6744 1314.6779 K M 729 740 PSM RIATGSFLK 1863 sp|P22234-2|PUR6_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8470.2 118.8424 3 991.5781 991.5815 R R 109 118 PSM VHIDIGADGR 1864 sp|P31942-2|HNRH3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8238.3 112.5501 3 1051.5382 1051.5411 R A 208 218 PSM FAVLHGEAPR 1865 sp|P55884-2|EIF3B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8168.3 110.6463 3 1095.5794 1095.5825 K I 577 587 PSM EWNDSTSVQNPTR 1866 sp|Q9Y3Z3|SAMH1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8321.8 114.8076 2 1532.6798 1532.6855 K L 597 610 PSM KVTQLDLDGPK 1867 sp|Q13442|HAP28_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8265.5 113.2931 3 1212.6532 1212.6714 K E 95 106 PSM ESVFTVEGGHR 1868 sp|Q99623|PHB2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8338.3 115.2586 3 1216.5814 1216.5837 R A 38 49 PSM ITSEAIGQLHR 1869 sp|Q9UNY4|TTF2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8359.2 115.8283 3 1223.6596 1223.6622 K S 538 549 PSM VADMALHYANK 1870 sp|P50990|TCPQ_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8397.2 116.8657 3 1231.6000 1231.6019 K Y 297 308 PSM QLQAETEPIVK 1871 sp|P60228|EIF3E_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8376.4 116.2971 3 1254.6796 1254.6819 K M 83 94 PSM VDVTEQPGLSGR 1872 sp|Q9H3N1|TMX1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8230.2 112.3296 3 1256.6314 1256.6361 K F 83 95 PSM NFGSYVTHETK 1873 sp|P63167|DYL1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8183.5 111.059 3 1281.5965 1281.5990 R H 61 72 PSM LNEQHQLILSK 1874 sp|Q8IYB5-2|SMAP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8195.5 111.386 3 1321.7299 1321.7354 K L 13 24 PSM GQTHTLEDFQR 1875 sp|Q99714-2|HCD2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8223.4 112.142 3 1330.6252 1330.6266 K V 106 117 PSM QTVAVGVIK 1876 sp|Q5VTE0|EF1A3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8192.7 111.3078 2 913.5578 913.5597 R A 431 440 PSM QTVAVGVIK 1877 sp|Q5VTE0|EF1A3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8211.5 111.8178 2 913.5578 913.5597 R A 431 440 PSM AQAELVGTADEATR 1878 sp|P30049|ATPD_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8265.8 113.2981 3 1430.6968 1430.7001 K A 137 151 PSM QDPSVLHTEEMR 1879 sp|Q8NFI4|F10A5_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8336.4 115.2067 3 1440.6664 1440.6667 K F 18 30 PSM TGTVSLEVR 1880 sp|P49327|FAS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8278.9 113.6523 2 960.5210 960.5240 K L 928 937 PSM PAEFTVDAK 1881 sp|P21333-2|FLNA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8148.7 110.1087 2 976.4834 976.4866 K H 692 701 PSM VSGDDVIIGK 1882 sp|P30876|RPB2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8265.9 113.2998 2 1001.5358 1001.5393 R T 860 870 PSM EFTAQNLGK 1883 sp|O15372|EIF3H_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8174.7 110.8167 2 1006.5066 1006.5083 K L 332 341 PSM DAEDAIYGR 1884 sp|Q13242|SRSF9_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8241.7 112.6391 2 1008.4488 1008.4512 R N 64 73 PSM AAELETDIR 1885 sp|O94906|PRP6_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8131.8 109.6472 2 1016.5100 1016.5138 R A 379 388 PSM TAVCDIPPR 1886 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 4-UNIMOD:4 ms_run[1]:scan=1.1.8147.6 110.0798 2 1027.5010 1027.5121 K G 351 360 PSM AGDLLEDSPK 1887 sp|P51858|HDGF_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8454.8 118.4137 2 1043.5122 1043.5135 R R 158 168 PSM GDECGLALGR 1888 sp|P54886-2|P5CS_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 4-UNIMOD:4 ms_run[1]:scan=1.1.8407.4 117.1331 2 1046.4802 1046.4815 R L 85 95 PSM AVDDGVNTFK 1889 sp|P50990|TCPQ_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8123.9 109.4307 2 1064.5128 1064.5139 R V 391 401 PSM SIGTANRPMGAGEALR 1890 sp|Q12906-7|ILF3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8273.8 113.5153 3 1599.8128 1599.8151 K R 258 274 PSM CVNTTLQIK 1891 sp|Q01518-2|CAP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 1-UNIMOD:4 ms_run[1]:scan=1.1.8459.8 118.5508 2 1075.5654 1075.5696 K G 355 364 PSM TAAYVNAIEK 1892 sp|P00367|DHE3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8396.8 116.8491 2 1078.5642 1078.5658 R V 536 546 PSM QYTGINAISK 1893 sp|P61158|ARP3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8388.9 116.635 2 1093.5742 1093.5768 K K 255 265 PSM VEAIDVEEAK 1894 sp|P33991|MCM4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8318.9 114.7283 2 1101.5530 1101.5553 K R 753 763 PSM SPDSDVAATLK 1895 sp|O60841|IF2P_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8363.9 115.9491 2 1102.5484 1102.5506 K K 767 778 PSM HHLQPENPGPGGAAPSLEQNR 1896 sp|Q14684-2|RRP1B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8140.6 109.8891 4 2205.0677 2205.0675 K G 389 410 PSM ALAAAGYDVEK 1897 sp|P10412|H14_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8390.11 116.6928 2 1106.5600 1106.5608 K N 65 76 PSM ALAAAGYDVEK 1898 sp|P10412|H14_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8487.9 119.3177 2 1106.5580 1106.5608 K N 65 76 PSM ALAAAGYDVEK 1899 sp|P10412|H14_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8417.9 117.4103 2 1106.5600 1106.5608 K N 65 76 PSM VLVTTNVCAR 1900 sp|Q9NUU7|DD19A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 8-UNIMOD:4 ms_run[1]:scan=1.1.8143.8 109.9743 2 1131.6044 1131.6070 K G 385 395 PSM LFPVCHDSDESDTAK 1901 sp|Q9Y6K1|DNM3A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 5-UNIMOD:4 ms_run[1]:scan=1.1.8125.11 109.4885 3 1719.7657 1719.7410 K A 383 398 PSM DTLENTIGHR 1902 sp|P42126-2|ECI1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8151.10 110.1954 2 1154.5702 1154.5680 K A 174 184 PSM VDATADYICK 1903 sp|P53396|ACLY_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 9-UNIMOD:4 ms_run[1]:scan=1.1.8387.9 116.6077 2 1154.5270 1154.5278 K V 221 231 PSM NTTGSTIAEIR 1904 sp|Q9ULU4-13|PKCB1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8140.9 109.8941 2 1161.5976 1161.5990 K R 925 936 PSM DVQGWGENDR 1905 sp|P62136|PP1A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8167.8 110.6273 2 1174.5042 1174.5003 K G 212 222 PSM DAALATALGDKK 1906 sp|P20700|LMNB1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8479.2 119.0883 3 1172.6386 1172.6401 K S 146 158 PSM NLDDTIDDEK 1907 sp|Q13310-2|PABP4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8181.10 111.0127 2 1176.5156 1176.5146 K L 300 310 PSM ANSNLVLQADR 1908 sp|O75643|U520_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8366.9 116.031 2 1199.6262 1199.6258 K S 15 26 PSM IDEELVTNSGK 1909 sp|Q9NRZ9-2|HELLS_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8175.7 110.8441 2 1203.5962 1203.5983 K F 574 585 PSM VIATFTCSGEK 1910 sp|P49189|AL9A1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 7-UNIMOD:4 ms_run[1]:scan=1.1.8422.11 117.5487 2 1211.5818 1211.5856 R E 39 50 PSM NIEMTQEDVR 1911 sp|O75643|U520_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8146.9 110.0576 2 1233.5616 1233.5659 R L 638 648 PSM DQVANSAFVER 1912 sp|P07900-2|HS90A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8454.11 118.4186 2 1234.5922 1234.5942 K L 622 633 PSM ESWEMNSEEK 1913 sp|Q02790|FKBP4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8387.10 116.6093 2 1267.5028 1267.5026 K L 257 267 PSM EFTESQLQEGK 1914 sp|Q01995|TAGL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8362.8 115.9201 2 1294.6032 1294.6041 R H 162 173 PSM GVQVETISPGDGR 1915 sp|P62942|FKB1A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8487.11 119.321 2 1313.6554 1313.6576 M T 2 15 PSM LQNSASATALVSR 1916 sp|Q86YP4-2|P66A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8430.10 117.7627 2 1316.7030 1316.7048 K T 526 539 PSM SVQTTLQTDEVK 1917 sp|O94905|ERLN2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8476.11 119.0213 2 1347.6862 1347.6882 R N 61 73 PSM AAECNIVVTQPR 1918 sp|Q08211|DHX9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 4-UNIMOD:4 ms_run[1]:scan=1.1.8217.8 111.9856 2 1356.6822 1356.6820 R R 435 447 PSM VLIGGDETPEGQR 1919 sp|O60701|UGDH_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8416.11 117.3866 2 1369.6818 1369.6838 R A 178 191 PSM VLIGGDETPEGQR 1920 sp|O60701|UGDH_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8397.11 116.8807 2 1369.6818 1369.6838 R A 178 191 PSM SNLNSLDEQEGVK 1921 sp|O75223|GGCT_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8327.11 114.9753 2 1431.6840 1431.6841 K S 89 102 PSM QADNPHVALYQAR 1922 sp|Q9Y4L1|HYOU1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8120.10 109.3505 2 1481.7384 1481.7375 K F 107 120 PSM HLVGVCYTEDEAK 1923 sp|P08574|CY1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 6-UNIMOD:4 ms_run[1]:scan=1.1.8473.6 118.9311 3 1519.6960 1519.6977 R E 134 147 PSM YEQGTGCWQGPNR 1924 sp|P14314-2|GLU2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 7-UNIMOD:4 ms_run[1]:scan=1.1.8320.10 114.7839 2 1551.6514 1551.6525 K S 462 475 PSM YTPSQQGVAFNSGAK 1925 sp|Q13573|SNW1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8460.11 118.5833 2 1553.7444 1553.7474 R Q 179 194 PSM ELTSTCSPIISKPK 1926 sp|P34932|HSP74_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 6-UNIMOD:4 ms_run[1]:scan=1.1.8365.11 116.0072 2 1559.8256 1559.8229 K P 774 788 PSM QAEETYENIPGQSK 1927 sp|O00410-3|IPO5_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8336.11 115.2183 2 1592.7328 1592.7318 K I 46 60 PSM SQSLTNSLSTSDTSQR 1928 sp|O14994|SYN3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8315.11 114.6507 2 1710.7974 1710.8020 K G 539 555 PSM EEETSIDVAGKPNEVTK 1929 sp|P53985|MOT1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8150.11 110.1699 3 1844.9005 1844.9003 K A 463 480 PSM EESDDEAAVEEEEEEK 1930 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8269.11 113.4118 2 1865.7206 1865.7174 K K 304 320 PSM AAFTECCQAADK 1931 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 6-UNIMOD:4,7-UNIMOD:4 ms_run[1]:scan=1.1.7105.4 81.97266 3 1370.5591 1370.5595 K A 187 199 PSM VSEEAESQQQWDTSK 1932 sp|Q01082-3|SPTB2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7915.9 103.8305 3 1750.7638 1750.7646 K G 2096 2111 PSM KQQNQELQEQLR 1933 sp|Q14980|NUMA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7145.11 83.06316 3 1540.7911 1540.7957 K S 1625 1637 PSM DSLHQPQYVEK 1934 sp|Q93008-1|USP9X_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7222.5 85.10872 3 1342.6522 1342.6517 R L 402 413 PSM DQVANSAFVER 1935 sp|P07900-2|HS90A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8488.5 119.3381 3 1234.5919 1234.5942 K L 622 633 PSM SHMMDVQGSTQDSAIK 1936 sp|P13667|PDIA4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8112.10 109.133 3 1733.7751 1733.7713 R D 371 387 PSM EHDPVGQMVNNPK 1937 sp|P55060-3|XPO2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7562.8 94.23848 3 1463.6785 1463.6827 K I 913 926 PSM LDPHNHVLYSNR 1938 sp|P31948|STIP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7275.6 86.56188 3 1463.7268 1463.7269 K S 33 45 PSM ALSVLGCGHTSSTK 1939 sp|Q5T4S7-2|UBR4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 7-UNIMOD:4 ms_run[1]:scan=1.1.7713.7 98.34343 3 1416.6982 1416.7031 R C 3858 3872 PSM NNASTDYDLSDK 1940 sp|P39023|RL3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7509.7 92.79155 3 1341.5665 1341.5684 K S 301 313 PSM VDNDENEHQLSLR 1941 sp|P06748-2|NPM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8072.4 108.0844 3 1567.6987 1567.7226 K T 33 46 PSM SAHATAPVNIAGSR 1942 sp|Q9UQ35|SRRM2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7060.8 80.76643 3 1350.6985 1350.7004 R T 2343 2357 PSM SETAPAAPAAPAPAEK 1943 sp|P10412|H14_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7161.11 83.49308 2 1477.7416 1477.7412 M T 2 18 PSM SNVSDAVAQSTR 1944 sp|P60174|TPIS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7350.11 88.60633 2 1233.5946 1233.5949 K I 232 244 PSM VLVTTNVCAR 1945 sp|Q9NUU7|DD19A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 8-UNIMOD:4 ms_run[1]:scan=1.1.8151.9 110.1938 2 1131.6044 1131.6070 K G 385 395 PSM AADSLQQNLQR 1946 sp|Q1ED39|KNOP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7877.2 102.7763 3 1242.6265 1242.6316 K D 408 419 PSM TTHFVEGGDAGNR 1947 sp|P18124|RL7_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6372.7 62.13495 3 1359.6271 1359.6168 K E 224 237 PSM IYDLNKPEAEPK 1948 sp|Q9Y3F4-2|STRAP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8105.5 108.9351 3 1415.7277 1415.7296 R E 139 151 PSM LAAIAESGVER 1949 sp|P28072|PSB6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8237.9 112.5327 2 1114.5948 1114.5982 R Q 210 221 PSM NDAPLHEINGDHLK 1950 sp|O75487|GPC4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8364.8 115.9748 3 1571.7682 1571.7692 K I 45 59 PSM QEGGDNDLIER 1951 sp|P30566|PUR8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7530.9 93.36607 2 1244.5608 1244.5633 K I 416 427 PSM KPHTESLELQVR 1952 sp|Q9BSJ8-2|ESYT1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8009.8 106.3978 3 1435.7749 1435.7783 R G 865 877 PSM RMGESDDSILR 1953 sp|P63220|RS21_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7979.4 105.5744 3 1277.6011 1277.6034 R L 61 72 PSM SLVESVSSSPNK 1954 sp|Q9H2U2-3|IPYR2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7702.10 98.0482 2 1232.6022 1232.6248 R E 280 292 PSM ADLSAMSAER 1955 sp|P50453|SPB9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8026.9 106.8663 2 1049.4796 1049.4811 K D 298 308 PSM VQQAELHTGSLPR 1956 sp|Q13085-2|ACACA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8022.7 106.7529 3 1434.7567 1434.7579 K I 768 781 PSM HLSSCAAPAPLTSAER 1957 sp|Q6IBS0|TWF2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 5-UNIMOD:4 ms_run[1]:scan=1.1.8037.10 107.1657 3 1666.8055 1666.8097 K E 137 153 PSM ELGSSTNALR 1958 sp|P08579|RU2B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7185.9 84.11311 2 1046.5338 1046.5356 K Q 58 68 PSM GLGAQEQGATDHIK 1959 sp|Q96BK5|PINX1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.7141.8 82.94872 3 1423.7053 1423.7056 K V 44 58 PSM IQEVADELQK 1960 sp|P18085|ARF4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8446.2 118.1844 3 1171.6060 1171.6084 R M 100 110 PSM NVIHASDSVEGAQR 1961 sp|O00746|NDKM_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6818.8 74.27465 3 1481.7190 1481.7223 R E 148 162 PSM NADGTICYDSTHYK 1962 sp|P14550|AK1A1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 7-UNIMOD:4 ms_run[1]:scan=1.1.8270.8 113.434 3 1643.6902 1643.6886 K E 128 142 PSM RYDGSQQALDLK 1963 sp|Q9UBU9|NXF1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.8161.6 110.4604 3 1392.6913 1392.6997 K G 219 231 PSM HAEATLGSGNLR 1964 sp|Q7L9L4-2|MOB1B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 22 ms_run[1]:scan=1.1.6875.9 75.81333 3 1224.6196 1224.6211 K Q 36 48 PSM VEADRPGK 1965 sp|P38159|RBMX_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 22 1-UNIMOD:1 ms_run[1]:scan=1.1.6255.9 58.93637 2 912.4672 912.4660 M L 2 10 PSM HQGVMVGMGQK 1966 sp|P62736|ACTA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.6917.3 76.91254 3 1171.562171 1170.563783 R D 42 53 PSM VNGDASPAAAESGAK 1967 sp|P29966|MARCS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.6229.11 58.21965 2 1344.618647 1343.631723 K E 41 56 PSM PRNQGGYGGSSSSSSYGSGR 1968 sp|P09651|ROA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.6349.11 61.51535 3 1947.833771 1946.846694 K R 351 371 PSM QEMQEVQSSR 1969 sp|P22626|ROA2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 22 1-UNIMOD:28 ms_run[1]:scan=1.1.7639.10 96.32927 2 1203.5185 1203.5185 R S 191 201 PSM MEVKPPPGRPQPDSGR 1970 sp|P51991|ROA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 22 1-UNIMOD:1 ms_run[1]:scan=1.1.8247.10 112.8089 3 1789.8912 1788.8932 - R 1 17 PSM CRPLEENTADNEK 1971 sp|P49792|RBP2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 22 1-UNIMOD:385,1-UNIMOD:4 ms_run[1]:scan=1.1.7489.10 92.25208 3 1557.6842 1557.6722 K E 2696 2709 PSM EDKYEEEIK 1972 sp|P06753-2|TPM3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 22 ms_run[1]:scan=1.1.7028.11 79.9051 2 1181.5537 1181.5447 K I 182 191 PSM QKLEEDAEMK 1973 sp|P05455|LA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 22 1-UNIMOD:28 ms_run[1]:scan=1.1.8075.11 108.1661 2 1202.5483 1202.5484 K S 215 225 PSM TAVCDIPPR 1974 sp|Q13885|TBB2A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22 4-UNIMOD:4 ms_run[1]:scan=1.1.8081.6 108.3114 2 1028.509247 1027.512065 K G 351 360 PSM TAVCDIPPR 1975 sp|Q13885|TBB2A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22 4-UNIMOD:4 ms_run[1]:scan=1.1.8128.8 109.5654 2 1028.511247 1027.512065 K G 351 360 PSM TAVCDIPPR 1976 sp|Q13885|TBB2A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22 4-UNIMOD:4 ms_run[1]:scan=1.1.7294.10 87.09063 2 1028.506247 1027.512065 K G 351 360 PSM TAVCDIPPR 1977 sp|Q13885|TBB2A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22 4-UNIMOD:4 ms_run[1]:scan=1.1.7510.5 92.81543 2 1028.508847 1027.512065 K G 351 360 PSM TAVCDIPPR 1978 sp|Q13885|TBB2A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22 4-UNIMOD:4 ms_run[1]:scan=1.1.7292.9 87.03439 2 1028.506247 1027.512065 K G 351 360 PSM TAVCDIPPR 1979 sp|Q13885|TBB2A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22 4-UNIMOD:4 ms_run[1]:scan=1.1.7235.9 85.4694 2 1028.506847 1027.512065 K G 351 360 PSM QTYSTEPNNLK 1980 sp|P46779|RL28_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 22 1-UNIMOD:28 ms_run[1]:scan=1.1.8393.10 116.7723 2 1277.5942 1276.5932 K A 23 34 PSM TALAATNPAVR 1981 sp|Q14008|CKAP5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.7313.10 87.61 2 1084.611447 1083.603657 K T 762 773 PSM AAVQAAEVK 1982 sp|Q15046|SYK_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 22 1-UNIMOD:1 ms_run[1]:scan=1.1.7958.6 105.0038 2 927.5009 927.5020 M V 2 11 PSM QAGEVTYADAHK 1983 sp|Q13247|SRSF6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 22 1-UNIMOD:28 ms_run[1]:scan=1.1.7745.10 99.22346 2 1271.5751 1271.5777 R E 132 144 PSM SDKPDMAEIEK 1984 sp|P62328|TYB4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 22 1-UNIMOD:1,6-UNIMOD:35 ms_run[1]:scan=1.1.6664.5 70.04925 3 1319.6052 1319.5912 M F 2 13 PSM VASVFANADKGDDEK 1985 sp|Q86U86|PB1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.7844.7 101.8788 3 1565.733671 1564.736916 R N 1097 1112 PSM QVHPDTGISSK 1986 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 22 1-UNIMOD:28 ms_run[1]:scan=1.1.6931.10 77.29387 2 1150.5623 1150.5613 K A 48 59 PSM QVHPDTGISSK 1987 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 22 1-UNIMOD:28 ms_run[1]:scan=1.1.6092.5 54.45377 2 1150.5619 1150.5613 K A 48 59 PSM HFVLDECDK 1988 sp|O00148|DX39A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22 7-UNIMOD:4 ms_run[1]:scan=1.1.8433.10 117.8441 2 1162.514847 1161.512459 K M 191 200 PSM LDSSETTMVK 1989 sp|Q9UBE0|SAE1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.7182.11 84.03715 2 1110.524647 1109.527440 K K 199 209 PSM VFDPQNDKPSK 1990 sp|O15145|ARPC3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.6591.4 68.05901 3 1274.632271 1273.630266 K W 148 159 PSM SAVENCQDSWR 1991 sp|P52209|6PGD_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22 6-UNIMOD:4 ms_run[1]:scan=1.1.7776.9 100.044 2 1351.560247 1350.562263 K R 397 408 PSM QKTEDEVLTSK 1992 sp|Q9BQ61|TRIR_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 22 1-UNIMOD:28 ms_run[1]:scan=1.1.7495.10 92.41599 2 1259.6241 1259.6240 K G 136 147 PSM SETVICSSR 1993 sp|P50552|VASP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 22 1-UNIMOD:1,6-UNIMOD:4 ms_run[1]:scan=1.1.8121.7 109.3729 2 1080.4992 1079.4912 M A 2 11 PSM AEGGAADLDTQR 1994 sp|Q9Y4E8|UBP15_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 22 1-UNIMOD:1 ms_run[1]:scan=1.1.8213.9 111.8786 2 1244.5742 1244.5632 M S 2 14 PSM AFEGQAHGADR 1995 sp|Q8TDB8|GTR14_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.5972.10 51.18963 2 1158.524447 1157.521384 R S 488 499 PSM SDTSESGAGLTR 1996 sp|Q9UNF1|MAGD2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 22 1-UNIMOD:1 ms_run[1]:scan=1.1.7094.9 81.68156 2 1221.5465 1221.5468 M F 2 14 PSM QGQDNLSSVK 1997 sp|P30040|ERP29_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 22 1-UNIMOD:28 ms_run[1]:scan=1.1.7478.6 91.94435 2 1058.5012 1057.5032 K E 183 193 PSM GHQQLYWSHPR 1998 sp|P62273|RS29_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 22 ms_run[1]:scan=1.1.8280.7 113.7029 3 1408.6762 1407.6792 M K 2 13 PSM SASAPAAEGEGTPTQPASEK 1999 sp|P35659|DEK_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 22 1-UNIMOD:1 ms_run[1]:scan=1.1.7545.8 93.77319 3 1927.8802 1926.8802 M E 2 22 PSM QLEEEQAVRPK 2000 sp|P14635|CCNB1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.6627.5 69.03854 3 1328.681771 1325.693929 R Y 180 191 PSM HLIPAANTGESK 2001 sp|P62258|1433E_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.6662.6 69.99628 3 1235.634971 1236.646250 K V 107 119 PSM RPQGESYDQAIR 2002 sp|Q7KZ85|SPT6H_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.7014.5 79.52789 3 1417.672271 1418.690241 R N 1178 1190 PSM AVVGVVAGGGR 2003 sp|P62917|RL8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.7186.2 84.12828 3 939.548471 940.545414 R I 164 175 PSM PADEIAVDR 2004 sp|Q16658|FSCN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.7210.6 84.78705 2 984.488047 984.487624 R D 159 168 PSM KGTVEGFEPADNK 2005 sp|P37108|SRP14_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.7242.4 85.65252 3 1389.659771 1390.672859 K C 43 56 PSM TAVCDIPPR 2006 sp|Q13885|TBB2A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22 4-UNIMOD:4 ms_run[1]:scan=1.1.7677.8 97.36546 2 1026.494847 1027.512065 K G 351 360 PSM LLSGLQEKPDQK 2007 sp|Q92797|SYMPK_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.7727.6 98.72428 3 1353.745271 1354.745630 R D 649 661 PSM RDTAGDASESALLK 2008 sp|P50993|AT1A2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.7912.3 103.7384 3 1431.691271 1432.715787 K C 443 457 PSM TGSISSSVSVPAKPER 2009 sp|Q6PJT7|ZC3HE_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.8023.8 106.7821 3 1599.848771 1600.842050 R R 325 341 PSM VHIEIGPDGR 2010 sp|P31943|HNRH1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.8481.3 119.1445 3 1093.578071 1091.572357 R V 317 327 PSM IRYESLTDPSK 2011 sp|Q58FF8|H90B2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.8511.7 119.9689 3 1306.660571 1307.672131 K L 54 65 PSM RPMEEDGEEK 2012 sp|Q12906-7|ILF3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.5841.4 47.63238 3 1218.5206 1218.5186 K S 372 382 PSM HLQLAIRNDEELNK 2013 sp|P16104|H2AX_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.2092.2 15.01693 4 1691.8945 1691.8954 R L 83 97 PSM IDSEGGVSANHTSR 2014 sp|P51659-2|DHB4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.5990.7 51.6636 3 1428.6589 1428.6593 K A 327 341 PSM HIVENAVQK 2015 sp|O00410-3|IPO5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6009.8 52.19042 2 1036.5652 1036.5665 K E 558 567 PSM RQSPLPPQK 2016 sp|Q01105|SET_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6003.5 52.01917 3 1049.5990 1049.5982 K K 5 14 PSM TLVLSNLSYSATEETLQEVFEK 2017 sp|P19338|NUCL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.1661.3 11.56508 4 2500.2537 2500.2584 K A 487 509 PSM RPLEDGDQPDAK 2018 sp|Q96AE4-2|FUBP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6078.6 54.08548 3 1339.6393 1339.6368 K K 65 77 PSM RPLEDGDQPDAK 2019 sp|Q96AE4-2|FUBP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6111.3 54.95063 3 1339.6387 1339.6368 K K 65 77 PSM AAEDDEDDDVDTK 2020 sp|P06454-2|PTMA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6052.11 53.38497 2 1436.5436 1436.5427 R K 90 103 PSM VHGPGIQSGTTNKPNK 2021 sp|P21333-2|FLNA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.5972.8 51.1863 3 1633.8541 1633.8536 R F 1360 1376 PSM HAEMVHTGLK 2022 sp|Q01518-2|CAP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6331.4 61.01543 3 1121.5672 1121.5652 K L 71 81 PSM RMEELHNQEVQK 2023 sp|Q15233-2|NONO_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6280.6 59.62271 4 1539.7457 1539.7463 R R 236 248 PSM QVHPDTGISSK 2024 sp|Q99880|H2B1L_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6127.5 55.39594 3 1167.5878 1167.5884 K A 48 59 PSM HQGVMVGMGQK 2025 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 5-UNIMOD:35 ms_run[1]:scan=1.1.6349.7 61.50868 3 1186.5607 1186.5587 R D 40 51 PSM RSTCTINYSK 2026 sp|P49419-2|AL7A1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 4-UNIMOD:4 ms_run[1]:scan=1.1.6239.4 58.48632 3 1228.5871 1228.5870 R D 491 501 PSM VSRPENEQLR 2027 sp|Q8ND56-3|LS14A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6217.5 57.8778 3 1226.6374 1226.6367 K N 203 213 PSM VAHSDKPGSTSTASFR 2028 sp|Q9P0L0|VAPA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6270.6 59.34572 4 1646.8021 1646.8013 K D 206 222 PSM AAGTDGSDFQHR 2029 sp|Q8N5M9|JAGN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6166.7 56.46748 3 1260.5701 1260.5483 R E 9 21 PSM HEGVSCDACLK 2030 sp|Q9P0J7|KCMF1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 6-UNIMOD:4,9-UNIMOD:4 ms_run[1]:scan=1.1.6446.6 64.10439 3 1274.5378 1274.5384 R G 4 15 PSM SESPKEPEQLR 2031 sp|P09651-2|ROA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6503.7 65.6447 3 1298.6464 1298.6466 K K 4 15 PSM IHEGCEEPATHNALAK 2032 sp|Q00610-2|CLH1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 5-UNIMOD:4 ms_run[1]:scan=1.1.6484.6 65.12282 4 1775.8233 1775.8260 R I 866 882 PSM ATCAPQHGAPGPGPADASK 2033 sp|P21333-2|FLNA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 3-UNIMOD:4 ms_run[1]:scan=1.1.6163.7 56.38486 4 1788.8221 1788.8213 K V 2533 2552 PSM ECHLNADTVSSK 2034 sp|P63010-2|AP2B1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 2-UNIMOD:4 ms_run[1]:scan=1.1.6425.8 63.54323 3 1359.6085 1359.6089 K L 870 882 PSM VGEFSGANK 2035 sp|P10599-2|THIO_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6373.3 62.15443 2 907.4396 907.4399 K E 66 75 PSM HVVQSISTQQEK 2036 sp|P24539|AT5F1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6196.9 57.30102 3 1382.7166 1382.7154 K E 222 234 PSM HQEAEMAQNAVR 2037 sp|P35222|CTNB1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6461.8 64.51607 3 1382.6359 1382.6361 R L 475 487 PSM FSTYTSDKDENK 2038 sp|Q8WU90|ZC3HF_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6361.4 61.8333 3 1433.6329 1433.6310 R L 355 367 PSM NCGQTVHDEVANK 2039 sp|O14964-2|HGS_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 2-UNIMOD:4 ms_run[1]:scan=1.1.6193.10 57.2192 3 1470.6622 1470.6521 K Q 74 87 PSM LQQQQRPEDAEDGAEGGGK 2040 sp|Q08J23-2|NSUN2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6178.4 56.7941 4 2011.9237 2011.9195 R R 10 29 PSM HGVIVAADSR 2041 sp|P28074|PSB5_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6298.10 60.12678 2 1023.5450 1023.5461 R A 69 79 PSM TVGVEPAADGK 2042 sp|P46779|RL28_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6335.11 61.13458 2 1042.5310 1042.5295 K G 48 59 PSM LKGTEDELDK 2043 sp|P09493-3|TPM1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6310.8 60.45156 2 1146.5760 1146.5768 K Y 50 60 PSM ETGEHLVHVK 2044 sp|P21333-2|FLNA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6320.10 60.73162 2 1147.5982 1147.5986 K K 2007 2017 PSM FGGSGSQVDSAR 2045 sp|Q13200|PSMD2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6408.9 63.08812 2 1166.5326 1166.5316 R M 358 370 PSM VQVEYKGETK 2046 sp|P11142|HSP7C_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6376.11 62.24683 2 1179.6132 1179.6135 K T 103 113 PSM LGQEQQTLNR 2047 sp|Q9P2M7|CING_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6504.9 65.6754 2 1185.6114 1185.6102 R A 806 816 PSM ATCAPQHGAPGPGPADASK 2048 sp|P21333-2|FLNA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 3-UNIMOD:4 ms_run[1]:scan=1.1.6136.11 55.65445 3 1788.8242 1788.8213 K V 2533 2552 PSM KPNEGADGQWK 2049 sp|Q8NC51-3|PAIRB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6278.10 59.57397 2 1228.5838 1228.5836 R K 295 306 PSM HLVYESDQNK 2050 sp|O43852-2|CALU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6355.10 61.67837 2 1231.5824 1231.5833 R D 272 282 PSM AAQDRDQIYR 2051 sp|P62995-3|TRA2B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6362.5 61.86268 3 1234.6048 1234.6054 R R 152 162 PSM FCENTQAGEGR 2052 sp|Q92896|GSLG1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 2-UNIMOD:4 ms_run[1]:scan=1.1.6252.11 58.85723 2 1267.5250 1267.5251 R V 323 334 PSM CTDDFNGAQCK 2053 sp|P17980|PRS6A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 1-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.6478.9 64.96402 2 1314.4978 1314.4969 R A 387 398 PSM HVVQSISTQQEK 2054 sp|P24539|AT5F1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6214.9 57.80136 3 1382.7166 1382.7154 K E 222 234 PSM EELQANGSAPAADK 2055 sp|P29966|MARCS_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6408.10 63.08978 2 1399.6572 1399.6579 K E 56 70 PSM ESEPQAAAEPAEAK 2056 sp|P80723|BASP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6427.11 63.60008 2 1426.6584 1426.6575 K E 39 53 PSM ESEPQAAAEPAEAK 2057 sp|P80723|BASP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6446.11 64.11272 2 1426.6576 1426.6575 K E 39 53 PSM TDNAGDQHGGGGGGGGGAGAAGGGGGGENYDDPHK 2058 sp|P14866|HNRPL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6235.10 58.38482 4 2980.2001 2980.1953 K T 63 98 PSM CCAAADPHECYAK 2059 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.6338.7 61.20903 3 1551.5929 1551.5905 K V 384 397 PSM NEENTEPGAESSENADDPNK 2060 sp|P43243|MATR3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6250.11 58.80222 3 2145.8620 2145.8570 K D 737 757 PSM SGKPAELLK 2061 sp|P29401-2|TKT_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6662.2 69.98962 3 941.5558 941.5545 R M 603 612 PSM RIAVVGEGR 2062 sp|O75083|WDR1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6529.2 66.35142 3 955.5526 955.5563 K E 116 125 PSM EGVHGGLINK 2063 sp|P07737|PROF1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6571.2 67.5049 3 1022.5501 1022.5509 K K 117 127 PSM KDGEDEFVK 2064 sp|Q5T7N2|LITD1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6683.2 70.5653 3 1065.4981 1065.4978 R E 201 210 PSM VIHELANER 2065 sp|Q02880-2|TOP2B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6545.3 66.79256 3 1079.5720 1079.5723 K W 304 313 PSM LGVIEDHSNR 2066 sp|P14625|ENPL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6768.2 72.89535 3 1138.5742 1138.5731 K T 494 504 PSM QAHTMDPQLR 2067 sp|P49327|FAS_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6777.4 73.14518 3 1195.5751 1195.5768 K L 71 81 PSM ALQASALK 2068 sp|P04075-2|ALDOA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6834.6 74.69057 2 800.4742 800.4756 R A 359 367 PSM NSLTSKDPDIK 2069 sp|Q14974|IMB1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6695.8 70.90385 3 1216.6276 1216.6299 K A 63 74 PSM VLANPGNSQVAR 2070 sp|Q14974|IMB1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6741.6 72.1643 3 1224.6559 1224.6575 R V 43 55 PSM HLIPAANTGESK 2071 sp|P62258|1433E_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6630.4 69.1192 3 1236.6457 1236.6462 K V 107 119 PSM GGPGGELPR 2072 sp|Q04637-9|IF4G1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6799.7 73.75417 2 838.4286 838.4297 R G 693 702 PSM GGPGGELPR 2073 sp|Q04637-9|IF4G1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6801.3 73.80233 2 838.4286 838.4297 R G 693 702 PSM GGPGGELPR 2074 sp|Q04637-9|IF4G1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6802.5 73.8331 2 838.4286 838.4297 R G 693 702 PSM LTDEGAVHVNDR 2075 sp|O95487-2|SC24B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6817.6 74.2445 3 1324.6378 1324.6371 R I 1092 1104 PSM AISSSAISR 2076 sp|Q16630-2|CPSF6_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6569.6 67.45685 2 890.4798 890.4821 R A 460 469 PSM GSAITGPVAK 2077 sp|P62829|RL23_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6560.6 67.20987 2 899.5068 899.5076 K E 114 124 PSM RIHGVGFK 2078 sp|P62899|RL31_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6638.2 69.33492 3 912.5293 912.5294 K K 32 40 PSM DASLVTNEDHQR 2079 sp|P49454|CENPF_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1000663, ProteinPilot, ] 21 ms_run[1]:scan=1.1.6669.6 70.1879 3 1383.62947064349 1383.63787019531 K S 771 783 PSM IFSGSSHQDLSQK 2080 sp|P60891|PRPS1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6880.5 75.94386 3 1432.6945 1432.6947 K I 6 19 PSM VTDALNATR 2081 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6698.7 70.9845 2 959.5030 959.5036 R A 421 430 PSM IGHPAPNFK 2082 sp|Q06830|PRDX1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6822.2 74.37057 3 979.5232 979.5239 K A 8 17 PSM EPSEVPTPK 2083 sp|P17096|HMGA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6638.10 69.34825 2 982.4960 982.4971 K R 47 56 PSM EPSEVPTPK 2084 sp|P17096|HMGA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6657.8 69.86279 2 982.4960 982.4971 K R 47 56 PSM APQVVAEAAK 2085 sp|O60832|DKC1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6581.9 67.79148 2 982.5442 982.5447 K T 434 444 PSM ATFNPAQDK 2086 sp|O00592-2|PODXL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6803.8 73.86557 2 990.4762 990.4771 K C 354 363 PSM DAQDVQASQAEADQQQTR 2087 sp|Q9P2E9|RRBP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6853.8 75.2083 4 1987.8793 1987.8831 R L 971 989 PSM ATEGMVVADK 2088 sp|Q99436|PSB7_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6768.8 72.90535 2 1019.4954 1019.4957 R N 63 73 PSM NAGFTPQER 2089 sp|P27695|APEX1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6751.8 72.44302 2 1018.4814 1018.4832 K Q 229 238 PSM LVEPGSPAEK 2090 sp|O14745|NHRF1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6614.8 68.69112 2 1025.5400 1025.5393 R A 41 51 PSM LLQAAAGASAR 2091 sp|Q96T76-8|MMS19_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6772.10 73.01798 2 1027.5756 1027.5774 K A 395 406 PSM YTHAANTVVYSSNK 2092 sp|Q6UXN9|WDR82_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6654.11 69.78574 3 1553.7475 1553.7474 R I 71 85 PSM EVSSATNALR 2093 sp|P09012|SNRPA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6799.10 73.75916 2 1046.5356 1046.5356 K S 61 71 PSM EGETVEPYK 2094 sp|Q08211|DHX9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6800.10 73.78665 2 1050.4832 1050.4869 K V 267 276 PSM VVVVGDQSAGK 2095 sp|O60313-10|OPA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6584.11 67.87738 2 1057.5742 1057.5768 R T 346 357 PSM ITITNDQNR 2096 sp|P11021|BIP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6589.3 68.00214 3 1073.5459 1073.5465 K L 524 533 PSM VAQPTITDNK 2097 sp|P21333-2|FLNA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6605.9 68.4515 2 1085.5716 1085.5717 K D 1807 1817 PSM VAQPTITDNK 2098 sp|P21333-2|FLNA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6586.10 67.93093 2 1085.5716 1085.5717 K D 1807 1817 PSM IANPVEGSSGR 2099 sp|Q15365|PCBP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6861.8 75.42733 2 1085.5452 1085.5465 K Q 315 326 PSM IVAVTGAEAQK 2100 sp|P49588|SYAC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6803.9 73.86723 2 1085.6078 1085.6081 R A 752 763 PSM EATDEELER 2101 sp|Q13619-2|CUL4A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6564.9 67.32467 2 1090.4778 1090.4778 K T 323 332 PSM GAGTDDSTLVR 2102 sp|P20073-2|ANXA7_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6751.9 72.44469 2 1090.5228 1090.5255 K I 409 420 PSM VAASTFSSDSK 2103 sp|Q9Y5J1|UTP18_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6537.10 66.5847 2 1098.5188 1098.5193 R K 385 396 PSM LEEQAQQIR 2104 sp|P02649|APOE_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6636.8 69.29015 2 1113.5788 1113.5778 K L 261 270 PSM ESGASVDEVAR 2105 sp|P50579-2|MAP2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6601.11 68.34541 2 1118.5194 1118.5204 K Q 58 69 PSM ALAEGPGAEGPR 2106 sp|Q13263|TIF1B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1000663, ProteinPilot, ] 21 ms_run[1]:scan=1.1.6781.10 73.26466 2 1123.5586470956603 1123.56218607391 M L 580 592 PSM QPVLSQTEAR 2107 sp|P28070|PSB4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6846.9 75.01904 2 1127.5936 1127.5935 K D 202 212 PSM KIEQELTAAK 2108 sp|Q9H444|CHM4B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6805.10 73.92357 2 1129.6340 1129.6342 K K 46 56 PSM LEQSEAQLGR 2109 sp|Q92905|CSN5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6812.11 74.11712 2 1129.5704 1129.5727 K G 273 283 PSM CATITPDEAR 2110 sp|P48735|IDHP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 1-UNIMOD:4 ms_run[1]:scan=1.1.6761.11 72.71954 2 1132.5194 1132.5183 K V 113 123 PSM LECVEPNCR 2111 sp|P83881|RL36A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 3-UNIMOD:4,8-UNIMOD:4 ms_run[1]:scan=1.1.6855.10 75.26627 2 1175.5054 1175.5063 R S 70 79 PSM LECVEPNCR 2112 sp|P83881|RL36A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 3-UNIMOD:4,8-UNIMOD:4 ms_run[1]:scan=1.1.6874.11 75.78913 2 1175.5054 1175.5063 R S 70 79 PSM QVENAGAIGPSR 2113 sp|Q9UHD8|SEPT9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6751.10 72.44635 2 1197.6084 1197.6102 K F 118 130 PSM DSYVGDEAQSK 2114 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6600.10 68.31644 2 1197.5172 1197.5150 K R 51 62 PSM QVENAGAIGPSR 2115 sp|Q9UHD8|SEPT9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6748.11 72.36546 2 1197.6084 1197.6102 K F 118 130 PSM LTVAENEAETK 2116 sp|P07814|SYEP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6814.9 74.16835 2 1203.5968 1203.5983 K L 1390 1401 PSM NGYEYEESTK 2117 sp|O75717|WDHD1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6829.11 74.56808 2 1218.5040 1218.5040 K N 745 755 PSM NCTYTQVQTR 2118 sp|P23193-2|TCEA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 2-UNIMOD:4 ms_run[1]:scan=1.1.6636.10 69.29348 2 1269.5754 1269.5772 K S 249 259 PSM ADTQTYQPYNK 2119 sp|P84090|ERH_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6878.11 75.89893 2 1327.6034 1327.6044 R D 74 85 PSM VEQATKPSFESGR 2120 sp|P38159-2|RBMX_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6764.7 72.79432 3 1434.7087 1434.7103 K R 68 81 PSM APVQPQQSPAAAPGGTDEKPSGK 2121 sp|Q13200|PSMD2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6640.11 69.40453 3 2217.1054 2217.1026 K E 9 32 PSM RVLIAAHGNSLR 2122 sp|P18669|PGAM1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7112.3 82.1612 4 1305.7613 1305.7629 K G 180 192 PSM HCLLTCEECK 2123 sp|Q56VL3|OCAD2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 2-UNIMOD:4,6-UNIMOD:4,9-UNIMOD:4 ms_run[1]:scan=1.1.7173.11 83.80305 2 1348.5580 1348.5574 R I 129 139 PSM GPLPLSSQHR 2124 sp|P43243|MATR3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7103.3 81.91666 3 1090.5856 1090.5883 R G 93 103 PSM LDPHNHVLYSNR 2125 sp|P31948|STIP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7296.4 87.1355 4 1463.7265 1463.7269 K S 33 45 PSM EDKYEEEIK 2126 sp|P06753-2|TPM3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7047.3 80.40477 3 1181.5462 1181.5452 K L 182 191 PSM KIAELCDDPK 2127 sp|P18206|VINC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 6-UNIMOD:4 ms_run[1]:scan=1.1.6969.4 78.30865 3 1187.5849 1187.5856 R E 417 427 PSM HVGDLGNVTADK 2128 sp|P00441|SODC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7292.4 87.02605 3 1224.6082 1224.6099 R D 81 93 PSM DGDLIATK 2129 sp|O43852-2|CALU_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7030.5 79.94805 2 831.4336 831.4338 K E 166 174 PSM FTSDTKPIINK 2130 sp|Q8N1F7|NUP93_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7217.4 84.97215 3 1262.6854 1262.6870 K V 601 612 PSM DAIAQAVR 2131 sp|P29401-2|TKT_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7106.6 82.00314 2 842.4620 842.4610 R G 618 626 PSM VGEVIVTK 2132 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7050.5 80.48995 2 843.5070 843.5066 K D 345 353 PSM QEPERNECFLQHK 2133 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 8-UNIMOD:4 ms_run[1]:scan=1.1.7299.6 87.2208 4 1713.7897 1713.7893 K D 118 131 PSM ADLAAVEAK 2134 sp|Q14204|DYHC1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7194.5 84.35043 2 886.4738 886.4760 K V 3463 3472 PSM DHEDYDPQTVR 2135 sp|Q93008-1|USP9X_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6973.7 78.42298 3 1373.5834 1373.5848 R L 633 644 PSM TDEGIAYR 2136 sp|P32119|PRDX2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7019.10 79.6672 2 923.4344 923.4348 K G 120 128 PSM TDEGIAYR 2137 sp|P32119|PRDX2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7000.9 79.16493 2 923.4344 923.4348 K G 120 128 PSM PAAVVLQTK 2138 sp|Q14697|GANAB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7229.5 85.29905 2 925.5576 925.5597 K G 900 909 PSM VAVQGDVVR 2139 sp|P07814|SYEP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6976.6 78.50352 2 941.5290 941.5294 R E 757 766 PSM AVVGVVAGGGR 2140 sp|P62917|RL8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7199.6 84.48801 2 940.5450 940.5454 R I 164 175 PSM DDEVQVVR 2141 sp|P61254|RL26_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7044.6 80.32805 2 958.4702 958.4720 K G 52 60 PSM AGLLNTSGTK 2142 sp|Q08AM6|VAC14_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7193.5 84.32322 2 960.5184 960.5240 R G 503 513 PSM TSDQTWVK 2143 sp|Q14204|DYHC1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7219.8 85.03273 2 963.4652 963.4662 R L 2695 2703 PSM DAEDAVYGR 2144 sp|Q07955|SRSF1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7220.8 85.0597 2 994.4368 994.4356 R D 66 75 PSM QGANINEIR 2145 sp|Q15365|PCBP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7311.7 87.55035 2 1013.5250 1013.5254 R Q 298 307 PSM QGANINEIR 2146 sp|Q15365|PCBP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7309.8 87.49737 2 1013.5250 1013.5254 R Q 298 307 PSM TEGTQEADQYADEK 2147 sp|Q02952-2|AKA12_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7103.8 81.925 3 1583.6608 1583.6587 K T 1163 1177 PSM GLEVTDDSPK 2148 sp|P49588|SYAC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7271.9 86.45627 2 1059.5082 1059.5084 R Y 477 487 PSM NMMAACDPR 2149 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 6-UNIMOD:4 ms_run[1]:scan=1.1.7215.9 84.92673 2 1064.4198 1064.4201 K H 298 307 PSM VTQEIVTER 2150 sp|Q14126|DSG2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7152.10 83.25322 2 1073.5714 1073.5717 K S 902 911 PSM VDNSSLTGESEPQTR 2151 sp|P05023-4|AT1A1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7187.8 84.16541 3 1618.7428 1618.7435 K S 213 228 PSM IIHEDGYSEEECR 2152 sp|P04899-4|GNAI2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 12-UNIMOD:4 ms_run[1]:scan=1.1.7261.9 86.18115 3 1635.6838 1635.6835 K Q 55 68 PSM NGYDYGQCR 2153 sp|Q13242|SRSF9_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 8-UNIMOD:4 ms_run[1]:scan=1.1.6930.9 77.2654 2 1131.4420 1131.4404 R L 73 82 PSM VTLTSEEEAR 2154 sp|P00338-3|LDHA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7260.9 86.15385 2 1133.5548 1133.5564 K L 335 345 PSM VATSSLDQTVK 2155 sp|Q9BV38|WDR18_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7230.8 85.33121 2 1147.6068 1147.6085 R L 189 200 PSM ITESEEVVSR 2156 sp|P02545-2|LMNA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7021.8 79.71616 2 1147.5510 1147.5721 R E 63 73 PSM IANPVEGSTDR 2157 sp|Q15366-2|PCBP2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7232.9 85.3875 2 1157.5680 1157.5677 K Q 324 335 PSM NAITSSYSSTR 2158 sp|Q96HA1|P121A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7286.11 86.87335 2 1185.5544 1185.5626 R G 411 422 PSM YSQSDLEQTK 2159 sp|Q14683|SMC1A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7142.10 82.97945 2 1197.5522 1197.5513 K T 714 724 PSM DGEEAGAYDGPR 2160 sp|P30101|PDIA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7158.11 83.41502 2 1235.5046 1235.5054 R T 108 120 PSM DGEEAGAYDGPR 2161 sp|P30101|PDIA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7178.11 83.93265 2 1235.5046 1235.5054 R T 108 120 PSM VNTLIRPDGEK 2162 sp|P62750|RL23A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7243.11 85.69157 2 1240.6770 1240.6775 K K 124 135 PSM KEETQPPVALK 2163 sp|Q8NC51-3|PAIRB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7000.11 79.16827 2 1238.6888 1238.6870 K K 92 103 PSM VNTLIRPDGEK 2164 sp|P62750|RL23A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7238.5 85.54483 3 1240.6768 1240.6775 K K 124 135 PSM ASRDEIFAQSK 2165 sp|P35580-3|MYH10_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7304.11 87.3657 2 1250.6246 1250.6255 R E 1687 1698 PSM MDATANDVPSDR 2166 sp|P13667|PDIA4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6949.11 77.78145 2 1290.5498 1290.5510 K Y 583 595 PSM DEFTNTCPSDK 2167 sp|Q9Y696|CLIC4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 7-UNIMOD:4 ms_run[1]:scan=1.1.7082.5 81.34838 3 1312.5241 1312.5242 R E 228 239 PSM TNTLAVTGGEDDK 2168 sp|Q13685|AAMP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7087.11 81.49445 2 1319.6224 1319.6205 K A 103 116 PSM AAFTECCQAADK 2169 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 6-UNIMOD:4,7-UNIMOD:4 ms_run[1]:scan=1.1.7035.10 80.09075 2 1370.5608 1370.5595 K A 187 199 PSM ACIDSNEDGDLSK 2170 sp|P29144|TPP2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 2-UNIMOD:4 ms_run[1]:scan=1.1.7150.11 83.19997 2 1422.5938 1422.5933 R S 208 221 PSM TGQAPGYSYTAANK 2171 sp|P99999|CYC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7301.7 87.27718 3 1427.6653 1427.6681 K N 41 55 PSM TAEDYSVDENGQR 2172 sp|O60488-2|ACSL4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6971.10 78.3733 2 1482.6240 1482.6223 K W 496 509 PSM LQSIGTENTEENR 2173 sp|P04075-2|ALDOA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7097.11 81.76665 2 1489.7022 1489.7008 R R 98 111 PSM SETAPAETATPAPVEK 2174 sp|P16401|H15_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7170.11 83.72552 2 1597.7868 1597.7835 M S 2 18 PSM HYGGLTGLNK 2175 sp|P18669|PGAM1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7531.3 93.38327 3 1058.5495 1058.5509 R A 91 101 PSM IFAPNHVVAK 2176 sp|Q02543|RL18A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7628.2 96.01479 3 1094.6206 1094.6237 R S 32 42 PSM QEPERNECFLQHK 2177 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 8-UNIMOD:4 ms_run[1]:scan=1.1.7337.4 88.25037 4 1713.7897 1713.7893 K D 118 131 PSM TVGATALPR 2178 sp|P50990|TCPQ_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7335.6 88.2005 2 884.5066 884.5080 K L 327 336 PSM TVGATALPR 2179 sp|P50990|TCPQ_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7354.6 88.70406 2 884.5066 884.5080 K L 327 336 PSM RLAPEYEAAATR 2180 sp|P30101|PDIA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7578.5 94.67235 3 1346.6932 1346.6942 K L 62 74 PSM TSTILAAAR 2181 sp|P35249-2|RFC4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7693.7 97.79905 2 902.5156 902.5185 K E 85 94 PSM DGNPDNETYLHR 2182 sp|Q9NUU7|DD19A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7455.9 91.32795 3 1429.6210 1429.6222 K I 414 426 PSM NSVEVALNK 2183 sp|P54577|SYYC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7560.7 94.18203 2 972.5220 972.5240 K L 311 320 PSM QFLSETEK 2184 sp|P09936|UCHL1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7647.7 96.54235 2 980.4794 980.4815 K M 116 124 PSM QAYTQFGGK 2185 sp|P25789-2|PSA4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7482.8 92.05703 2 998.4802 998.4821 K R 48 57 PSM VLNTNIDGR 2186 sp|P62269|RS18_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7527.8 93.28298 2 1000.5298 1000.5302 R R 15 24 PSM GGGALSAVAATK 2187 sp|P61011|SRP54_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7651.8 96.65298 2 1001.5486 1001.5506 K S 256 268 PSM ADTIDTIEK 2188 sp|Q9Y4E8-2|UBP15_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7670.9 97.17464 2 1004.4922 1004.5026 K E 155 164 PSM ALDLDSSCK 2189 sp|P31948|STIP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 8-UNIMOD:4 ms_run[1]:scan=1.1.7526.6 93.25245 2 1007.4578 1007.4594 K E 454 463 PSM YRPGTVALR 2190 sp|Q71DI3|H32_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7318.3 87.7349 3 1031.5873 1031.5876 R E 42 51 PSM YRPGTVALR 2191 sp|Q71DI3|H32_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7356.2 88.75062 3 1031.5867 1031.5876 R E 42 51 PSM YRPGTVALR 2192 sp|Q71DI3|H32_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7415.3 90.28585 3 1031.5873 1031.5876 R E 42 51 PSM YRPGTVALR 2193 sp|Q71DI3|H32_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7395.2 89.76665 3 1031.5873 1031.5876 R E 42 51 PSM TLLEGEESR 2194 sp|P04264|K2C1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7502.9 92.60474 2 1032.5060 1032.5087 R M 484 493 PSM SEVATLTAAGK 2195 sp|P36542-2|ATPG_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7696.9 97.88377 2 1046.5580 1046.5608 K E 116 127 PSM EGLQNMEAR 2196 sp|P31948|STIP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7507.9 92.7405 2 1046.4784 1046.4815 K L 110 119 PSM DTQEVPLEK 2197 sp|Q9Y5A9-2|YTHD2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7336.8 88.23051 2 1057.5264 1057.5291 R A 478 487 PSM QPDSGISSIR 2198 sp|P04843|RPN1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7626.10 95.97338 2 1058.5334 1058.5356 R S 269 279 PSM IATGQIAGVDK 2199 sp|Q9HC35-2|EMAL4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7705.7 98.12489 2 1071.5912 1071.5924 R D 266 277 PSM AAPGAEFAPNK 2200 sp|Q15233-2|NONO_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7588.8 94.95052 2 1071.5416 1071.5349 R R 368 379 PSM AESQLLECK 2201 sp|P12270|TPR_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 8-UNIMOD:4 ms_run[1]:scan=1.1.7646.9 96.51853 2 1076.5150 1076.5172 K A 1120 1129 PSM AQYEDIANR 2202 sp|P05787-2|K2C8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7465.9 91.596 2 1078.5042 1078.5043 K S 293 302 PSM LEGQGDVPTPK 2203 sp|Q9Y2Z0-2|SGT1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7336.9 88.23219 2 1139.5806 1139.5823 K Q 225 236 PSM LDQEVAEVDK 2204 sp|Q99816-2|TS101_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7400.8 89.90411 2 1144.5608 1144.5612 R N 172 182 PSM VNTPTTTVYR 2205 sp|P26639-2|SYTC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7488.10 92.22473 2 1150.5964 1150.5983 K C 277 287 PSM YIDQEELNK 2206 sp|P07900-2|HS90A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7690.11 97.7242 2 1150.5504 1150.5506 K T 406 415 PSM IGNTEDGAPHKEDEPSVGQVAR 2207 sp|Q9C0C9|UBE2O_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7603.9 95.35413 4 2305.0873 2305.0935 R V 662 684 PSM ALQATVGNSYK 2208 sp|P11279|LAMP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.7507.10 92.74216 2 1150.596447 1150.598238 R C 327 338 PSM INSITVDNCK 2209 sp|Q01518-2|CAP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 9-UNIMOD:4 ms_run[1]:scan=1.1.7316.10 87.69195 2 1162.5652 1162.5652 K K 366 376 PSM RAAVLLEQER 2210 sp|Q13435|SF3B2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7490.11 92.28123 2 1183.6654 1183.6673 K Q 183 193 PSM ELQSQIQEAR 2211 sp|Q9P2X0-2|DPM3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7413.9 90.24357 2 1200.6082 1200.6098 R A 103 113 PSM VDVDEYDENK 2212 sp|O15511-2|ARPC5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7676.10 97.34138 2 1224.5240 1224.5146 K F 14 24 PSM VDKLDASESLR 2213 sp|Q00610-2|CLH1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7670.5 97.16797 3 1231.6390 1231.6408 K K 1610 1621 PSM VIGSGCNLDSAR 2214 sp|P07195|LDHB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 6-UNIMOD:4 ms_run[1]:scan=1.1.7567.11 94.38071 2 1247.5912 1247.5928 R F 159 171 PSM EGEGLGSEGQGIK 2215 sp|Q8IWZ8|SUGP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7405.10 90.03553 2 1259.6078 1259.5993 K N 577 590 PSM NNNQQLAQLQK 2216 sp|Q9Y2A7-2|NCKP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7370.11 89.1382 2 1297.6716 1297.6738 R E 77 88 PSM GVDLQENNPASR 2217 sp|P51148-2|RAB5C_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7545.9 93.77485 2 1298.6208 1298.6215 R S 232 244 PSM NCNDFQYESK 2218 sp|Q04917|1433F_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 2-UNIMOD:4 ms_run[1]:scan=1.1.7517.11 93.01591 2 1303.5122 1303.5139 K V 111 121 PSM YSPGYNTEVGDK 2219 sp|O95299|NDUAA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7568.11 94.40807 2 1328.5864 1328.5885 K W 339 351 PSM ASGNYATVISHNPETKK 2220 sp|P62917|RL8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7708.6 98.20523 4 1815.9077 1815.9115 R T 129 146 PSM LGIKPESVQPHRPTTNPNTSK 2221 sp|Q16527|CSRP2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7715.7 98.39803 5 2300.2231 2300.2237 R F 88 109 PSM SLDNNYSTPNER 2222 sp|O60716-3|CTND1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7336.11 88.23552 2 1408.6218 1408.6219 K G 899 911 PSM VTSGGVSESPSGFSK 2223 sp|O14757|CHK1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7666.11 97.06803 2 1424.6788 1424.6784 R H 278 293 PSM DGNPDNETYLHR 2224 sp|Q9NUU7|DD19A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7453.11 91.27883 2 1429.6252 1429.6222 K I 414 426 PSM EWGDDEEEQPSK 2225 sp|Q15020-4|SART3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7456.10 91.35593 2 1447.5722 1447.5739 K R 596 608 PSM GVEEEEEDGEMRE 2226 sp|P62306|RUXF_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7636.11 96.24885 2 1536.5884 1536.5886 R - 74 87 PSM AAEAAAAPAESAAPAAGEEPSKEEGEPK 2227 sp|P80723|BASP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7680.11 97.45237 3 2635.2283 2635.2248 K K 122 150 PSM KLIELQAGK 2228 sp|P14314-2|GLU2B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7865.2 102.4456 3 998.6101 998.6124 K K 158 167 PSM LAQGLTHLGK 2229 sp|Q13200|PSMD2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7766.2 99.77132 3 1036.6006 1036.6029 R G 764 774 PSM DPQALSEHLK 2230 sp|P31948|STIP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7890.3 103.1348 3 1136.5798 1136.5826 K N 514 524 PSM CYEMASHLR 2231 sp|P07737|PROF1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 1-UNIMOD:4 ms_run[1]:scan=1.1.7806.3 100.8376 3 1165.4986 1165.5008 K R 128 137 PSM LGHELQQAGLK 2232 sp|Q14980|NUMA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7749.7 99.32809 3 1192.6531 1192.6564 R T 1655 1666 PSM VEPHATIAEIK 2233 sp|Q9NZ01|TECR_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8020.2 106.6894 3 1206.6595 1206.6608 K N 23 34 PSM IFHELTQTDK 2234 sp|P11586|C1TC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7801.7 100.7081 3 1230.6235 1230.6245 R A 464 474 PSM GTVIIIANHGDR 2235 sp|Q16851|UGPA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8043.5 107.3206 3 1264.6864 1264.6888 K I 474 486 PSM STVAQLVK 2236 sp|P25705-3|ATPA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7852.4 102.0926 2 844.4988 844.5018 R R 232 240 PSM STVAQLVK 2237 sp|P25705-3|ATPA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7871.5 102.6159 2 844.4988 844.5018 R R 232 240 PSM HRPELIEYDK 2238 sp|O43707|ACTN4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7828.5 101.4391 3 1298.6584 1298.6619 R L 205 215 PSM HQEGEIFDTEK 2239 sp|Q02878|RL6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7916.4 103.8494 3 1331.5984 1331.5993 R E 227 238 PSM ATISALEAK 2240 sp|P35580-3|MYH10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7948.7 104.7308 2 902.5042 902.5073 K I 1835 1844 PSM GPNAVQLVK 2241 sp|Q7Z6Z7-2|HUWE1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7942.8 104.5682 2 924.5324 924.5393 K T 1918 1927 PSM KGPSTVTDLEDTK 2242 sp|O94973-2|AP2A2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7762.6 99.67368 3 1389.6994 1389.6987 K R 620 633 PSM ISVYYNEASSHK 2243 sp|Q13509|TBB3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7953.7 104.868 3 1396.6621 1396.6623 R Y 47 59 PSM AADAVEDLR 2244 sp|Q9UNF0|PACN2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7809.5 100.9228 2 958.4694 958.4720 R W 276 285 PSM LHVGNISPTCTNK 2245 sp|Q9BWF3|RBM4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 10-UNIMOD:4 ms_run[1]:scan=1.1.7883.6 102.9477 3 1439.7151 1439.7191 K E 80 93 PSM LEHQFAVGEDSGR 2246 sp|O00754|MA2B1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7889.4 103.1091 3 1443.6757 1443.6743 R N 917 930 PSM IIEVGDTPK 2247 sp|P61619|S61A1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7843.3 101.8448 2 970.5300 970.5335 K D 99 108 PSM HVLVTLGEK 2248 sp|P60660-2|MYL6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8058.7 107.7224 2 994.5790 994.5811 R M 111 120 PSM SALFSESQK 2249 sp|Q96JM3|CHAP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7879.5 102.8363 2 995.4914 995.4924 K A 566 575 PSM IVIGYQSHADTATK 2250 sp|P06730-3|IF4E_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8035.8 107.1085 3 1502.7676 1502.7729 K S 213 227 PSM AEELGQELK 2251 sp|Q14980|NUMA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8027.7 106.8904 2 1015.5118 1015.5186 R A 1322 1331 PSM AALSASEGEEVPQDK 2252 sp|O95831|AIFM1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7846.7 101.9334 3 1529.7181 1529.7209 K A 113 128 PSM TADGIVSHLK 2253 sp|P30101|PDIA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8022.3 106.7462 3 1039.5652 1039.5662 R K 120 130 PSM LQMEQQQQLQQR 2254 sp|Q9NS69|TOM22_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7921.9 103.9952 3 1556.7688 1556.7729 K Q 106 118 PSM ILGPQGNTIK 2255 sp|Q07666|KHDR1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7748.9 99.30393 2 1039.6000 1039.6026 K R 176 186 PSM VGSDQCLLR 2256 sp|P78310|CXAR_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 6-UNIMOD:4 ms_run[1]:scan=1.1.7997.7 106.0689 2 1046.5164 1046.5179 R L 218 227 PSM IAQITGPPDR 2257 sp|Q96AE4-2|FUBP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7794.8 100.5198 2 1066.5742 1066.5771 R C 321 331 PSM TVDLSSHLAK 2258 sp|P04843|RPN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7916.2 103.8461 3 1069.5754 1069.5768 R V 39 49 PSM DAEEDDDTGGINLHK 2259 sp|Q13206|DDX10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7911.8 103.7192 3 1627.6966 1627.6962 K A 710 725 PSM LTTDFGNAEK 2260 sp|P02786|TFR1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8037.9 107.164 2 1094.5218 1094.5244 R T 656 666 PSM EAVAMESYAK 2261 sp|P78371-2|TCPB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8060.9 107.7772 2 1097.5050 1097.5063 K A 385 395 PSM IASQMITEGR 2262 sp|Q9BT78|CSN4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7932.10 104.298 2 1104.5566 1104.5597 K M 338 348 PSM EHGVGGVSQCPEPGLR 2263 sp|Q9C0C2|TB182_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 10-UNIMOD:4 ms_run[1]:scan=1.1.7926.8 104.1306 3 1677.7834 1677.7893 R H 1364 1380 PSM DLEGSDIDTR 2264 sp|P55060-3|XPO2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7747.9 99.27654 2 1119.5030 1119.5044 R R 373 383 PSM VLDNAIETEK 2265 sp|Q01082-3|SPTB2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7811.10 100.9855 2 1130.5798 1130.5819 K M 280 290 PSM MGESDDSILR 2266 sp|P63220|RS21_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 1-UNIMOD:35 ms_run[1]:scan=1.1.7822.8 101.2814 2 1137.4962 1137.4972 R L 62 72 PSM SSDVSWSDTR 2267 sp|O14776-2|TCRG1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7925.10 104.1065 2 1138.4922 1138.4891 R R 892 902 PSM EAESSPFVER 2268 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8097.10 108.7324 2 1149.5282 1149.5302 K L 548 558 PSM ITELTDENVK 2269 sp|P19387|RPB3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7931.8 104.2673 2 1160.5872 1160.5925 R F 11 21 PSM CNTNTAIELK 2270 sp|O14929|HAT1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 1-UNIMOD:4 ms_run[1]:scan=1.1.7764.9 99.73074 2 1162.5606 1162.5652 K L 27 37 PSM VVGDVAYDEAK 2271 sp|P11586|C1TC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7819.9 101.2016 2 1164.5632 1164.5663 K E 252 263 PSM STGCDFAVSPK 2272 sp|P55809|SCOT1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 4-UNIMOD:4 ms_run[1]:scan=1.1.7936.10 104.4075 2 1167.5230 1167.5230 K L 501 512 PSM EDTEEYNLR 2273 sp|P51991|ROA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7788.8 100.3572 2 1167.5032 1167.5044 K D 135 144 PSM TIQGDEEDLR 2274 sp|P54920|SNAA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7783.7 100.2232 2 1174.5450 1174.5466 K - 286 296 PSM LITDNTVEER 2275 sp|P28370|SMCA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7767.10 99.81055 2 1188.5970 1188.5986 R I 622 632 PSM VESLDVDSEAK 2276 sp|P49321|NASP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7805.10 100.822 2 1190.5640 1190.5666 K K 34 45 PSM EATDAIGHLDR 2277 sp|Q12906-7|ILF3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7971.9 105.3649 2 1196.5768 1196.5786 K Q 298 309 PSM QEATLVVGGDGR 2278 sp|P36871|PGM1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7912.7 103.7451 2 1200.6080 1200.6099 R F 53 65 PSM AVENSSTAIGIR 2279 sp|P25788-2|PSA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8038.9 107.1912 2 1216.6406 1216.6411 K C 30 42 PSM FVTSNTQELGK 2280 sp|Q9BXP5-2|SRRT_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7812.9 101.0113 2 1222.6166 1222.6194 K D 700 711 PSM EFLHAQEEVK 2281 sp|P43686|PRS6B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8034.9 107.0833 2 1228.6098 1228.6088 K R 71 81 PSM ITQCSVEIQR 2282 sp|O15400-2|STX7_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 4-UNIMOD:4 ms_run[1]:scan=1.1.7742.10 99.14135 2 1232.6150 1232.6183 K T 25 35 PSM QLAEQEELER 2283 sp|Q9UH65|SWP70_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8034.10 107.085 2 1243.6018 1243.6044 K Q 330 340 PSM VELVTGEEDEK 2284 sp|P49792|RBP2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7867.11 102.5157 2 1246.5902 1246.5929 K V 2023 2034 PSM VIQQESYTYK 2285 sp|P60228|EIF3E_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7763.8 99.70313 2 1257.6226 1257.6241 K D 280 290 PSM VGIPVTDENGNR 2286 sp|Q9H9B4|SFXN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8069.10 108.011 2 1269.6294 1269.6313 K L 203 215 PSM LVESDAEAEAVR 2287 sp|Q9BZJ0-3|CRNL1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7987.11 105.8039 2 1287.6286 1287.6306 R E 488 500 PSM QCQCTSVGAQNTVICSK 2288 sp|P16422|EPCAM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 2-UNIMOD:4,4-UNIMOD:4,15-UNIMOD:4 ms_run[1]:scan=1.1.7908.11 103.6422 3 1939.8511 1939.8550 R L 45 62 PSM GSQFGQSCCLR 2289 sp|P07814|SYEP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 8-UNIMOD:4,9-UNIMOD:4 ms_run[1]:scan=1.1.7907.10 103.6132 2 1298.5472 1298.5496 K A 329 340 PSM SSGASVTTQPTEFK 2290 sp|Q9BY77-2|PDIP3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8022.10 106.7579 2 1438.6942 1438.6940 K I 376 390 PSM DQTPDENDQVIVK 2291 sp|Q9NZI8|IF2B1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8010.10 106.4284 2 1499.7102 1499.7104 R I 526 539 PSM QEYDESGPSIVHR 2292 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8046.9 107.4088 3 1515.6922 1515.6954 K K 360 373 PSM AEPVEVVAPR 2293 sp|P09874|PARP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8265.3 113.2898 3 1065.5803 1065.5818 K G 487 497 PSM NKLDHYAIIK 2294 sp|P62750|RL23A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8413.3 117.2923 3 1213.6777 1213.6819 R F 69 79 PSM HIYYITGETK 2295 sp|P07900-2|HS90A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8412.3 117.2652 3 1223.6176 1223.6186 K D 612 622 PSM AHVVPCFDASK 2296 sp|P21333-2|FLNA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 6-UNIMOD:4 ms_run[1]:scan=1.1.8380.2 116.4036 3 1229.5861 1229.5863 K V 1152 1163 PSM AVAGNISDPGLQK 2297 sp|P18206|VINC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8166.5 110.5949 3 1268.6686 1268.6725 K S 803 816 PSM DPNIVIAK 2298 sp|P30101|PDIA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8221.6 112.091 2 868.5010 868.5018 K M 426 434 PSM DPNIVIAK 2299 sp|P30101|PDIA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8202.6 111.5763 2 868.5010 868.5018 K M 426 434 PSM NASDMPETITSR 2300 sp|Q8TCT9-2|HM13_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8451.7 118.3298 3 1320.5950 1320.5980 K D 62 74 PSM GLSEDTTEETLK 2301 sp|P19338|NUCL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8336.3 115.205 3 1321.6225 1321.6249 K E 578 590 PSM LCDSYEIRPGK 2302 sp|O43390-2|HNRPR_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 2-UNIMOD:4 ms_run[1]:scan=1.1.8190.5 111.2501 3 1336.6426 1336.6445 K H 225 236 PSM ASITALEAK 2303 sp|P35579|MYH9_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8171.7 110.7349 2 902.5060 902.5073 K I 1807 1816 PSM TTLTAAITK 2304 sp|P49411|EFTU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8186.5 111.1409 2 918.5378 918.5386 K I 71 80 PSM VQLVVGDGR 2305 sp|P22061-2|PIMT_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8333.5 115.1277 2 941.5290 941.5294 R M 136 145 PSM THAVLVALK 2306 sp|P25786-2|PSA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8159.7 110.4079 2 950.5900 950.5913 K R 48 57 PSM ALEEALEAK 2307 sp|P35580-3|MYH10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8478.4 119.0645 2 972.5086 972.5127 R E 1512 1521 PSM VGTDGVITVK 2308 sp|P12830-2|CADH1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8252.3 112.9346 2 987.5564 987.5601 K R 77 87 PSM LEVNELSGK 2309 sp|Q5T7N2|LITD1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8489.7 119.3687 2 987.5200 987.5237 K L 137 146 PSM VIMVGSGGVGK 2310 sp|P11234-2|RALB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8236.8 112.5039 2 1002.5538 1002.5532 K S 39 50 PSM APVPGTPDSLSSGSSR 2311 sp|Q9UJZ1-2|STML2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8317.8 114.6997 3 1513.7377 1513.7373 K D 277 293 PSM EQSGTIYLQHADEEREK 2312 sp|P37198|NUP62_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8245.7 112.749 4 2031.9453 2031.9497 K T 416 433 PSM LLLSATSGEK 2313 sp|Q9NW13|RBM28_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8416.9 117.3832 2 1017.5676 1017.5706 K G 506 516 PSM CLDAVVSTR 2314 sp|Q86VP6|CAND1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 1-UNIMOD:4 ms_run[1]:scan=1.1.8145.8 110.0286 2 1019.5042 1019.5070 K H 356 365 PSM VLGGSFADQK 2315 sp|Q93008-1|USP9X_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8216.8 111.9583 2 1020.5204 1020.5240 K I 1713 1723 PSM GTGIVSAPVPK 2316 sp|P15880|RS2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8273.6 113.5119 2 1024.5898 1024.5917 R K 201 212 PSM GTGIVSAPVPK 2317 sp|P15880|RS2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8292.8 114.0274 2 1024.5898 1024.5917 R K 201 212 PSM AAVLLEQER 2318 sp|Q13435|SF3B2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8313.8 114.5919 2 1027.5746 1027.5662 R Q 184 193 PSM TAVCDIPPR 2319 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 4-UNIMOD:4 ms_run[1]:scan=1.1.8391.6 116.7116 2 1027.5038 1027.5121 K G 351 360 PSM AENQVLAMR 2320 sp|P51572-2|BAP31_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8406.5 117.1083 2 1030.5194 1030.5229 K K 272 281 PSM LTRDETNYGIPQR 2321 sp|P63244|RACK1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8399.10 116.9318 3 1561.7845 1561.7849 K A 45 58 PSM LTRDETNYGIPQR 2322 sp|P63244|RACK1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8386.6 116.5751 3 1561.7845 1561.7849 K A 45 58 PSM LEDAADVYR 2323 sp|Q9BXJ9|NAA15_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8271.8 113.461 2 1050.4964 1050.4982 R G 240 249 PSM YGEAGEGPGWGGAHPR 2324 sp|P26640|SYVC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8485.9 119.2633 3 1596.7045 1596.7070 R I 24 40 PSM AEPVEVVAPR 2325 sp|P09874|PARP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8246.3 112.7699 3 1065.5803 1065.5818 K G 487 497 PSM EQIVPKPEEEVAQK 2326 sp|P18621-3|RL17_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8185.9 111.1203 3 1622.8507 1622.8515 K K 154 168 PSM QENGASVILR 2327 sp|P29692-2|EF1D_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8314.8 114.6188 2 1085.5790 1085.5829 R D 405 415 PSM AEEDEILNR 2328 sp|P27824-2|CALX_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8318.8 114.7266 2 1087.5146 1087.5145 K S 609 618 PSM TISSDAVLQR 2329 sp|Q6P1M3-2|L2GL2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8353.7 115.6731 2 1088.5732 1088.5826 R L 168 178 PSM RAAAEVNQDYGLDPK 2330 sp|P07954-2|FUMH_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8316.9 114.6743 3 1645.8031 1645.8060 K I 58 73 PSM TGQEIPVNVR 2331 sp|Q96KP4|CNDP2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8480.7 119.1239 2 1111.5950 1111.5986 K F 150 160 PSM DVNQQEFVR 2332 sp|P39019|RS19_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8312.7 114.5629 2 1133.5464 1133.5465 K A 8 17 PSM DADIGVAEAER 2333 sp|Q14254|FLOT2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8120.6 109.3439 2 1144.5328 1144.5360 R D 178 189 PSM ERGDYVLAVK 2334 sp|O75369-2|FLNB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8465.10 118.7191 2 1148.6174 1148.6190 K W 2553 2563 PSM GEFVTTVQQR 2335 sp|P40925-3|MDHC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8159.10 110.4129 2 1163.5930 1163.5935 K G 239 249 PSM QTESTSFLEK 2336 sp|P60900|PSA6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8465.11 118.7207 2 1168.5598 1168.5612 K K 172 182 PSM KGEFETGFEK 2337 sp|Q8IYD1|ERF3B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8313.9 114.5935 2 1170.5536 1170.5557 R G 316 326 PSM LQIASDENYK 2338 sp|Q13813|SPTN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8260.10 113.1653 2 1179.5768 1179.5771 K D 64 74 PSM DNSTMGYMAAK 2339 sp|P07900-2|HS90A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8225.10 112.2065 2 1187.4918 1187.4951 R K 743 754 PSM QPAPTTIGGLNK 2340 sp|P27816-6|MAP4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8235.10 112.4795 2 1195.6516 1195.6561 K K 727 739 PSM ENLTELSGGQR 2341 sp|O95347-2|SMC2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8454.10 118.417 2 1202.5898 1202.5891 K S 1080 1091 PSM LVVDSHVQYR 2342 sp|Q6P2Q9|PRP8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8233.4 112.4149 3 1214.6365 1214.6408 K L 556 566 PSM ALVDGPCTQVR 2343 sp|P50914|RL14_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 7-UNIMOD:4 ms_run[1]:scan=1.1.8390.4 116.6811 3 1214.6068 1214.6078 R R 36 47 PSM LVVDSHVQYR 2344 sp|Q6P2Q9|PRP8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8240.3 112.605 3 1214.6365 1214.6408 K L 556 566 PSM EEETSIDVAGKPNEVTK 2345 sp|P53985|MOT1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8131.11 109.6522 3 1844.9005 1844.9003 K A 463 480 PSM TTQQDLSALQK 2346 sp|Q9UPN3|MACF1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8323.10 114.8651 2 1231.6378 1231.6408 R N 3644 3655 PSM HGGVIHIYVDK 2347 sp|Q14498-2|RBM39_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8288.3 113.912 3 1236.6574 1236.6615 K N 451 462 PSM NDNDSWDYTK 2348 sp|Q8WVV9-5|HNRLL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8421.9 117.5185 2 1256.4944 1256.4946 R P 218 228 PSM EIPSATQSPISK 2349 sp|Q9BQG0-2|MBB1A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8159.11 110.4146 2 1256.6574 1256.6612 K K 1156 1168 PSM INENDPEYIR 2350 sp|Q9UEY8-2|ADDG_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8312.10 114.5679 2 1261.5918 1261.5938 R E 28 38 PSM VVTQNICQYR 2351 sp|Q8N163|CCAR2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 7-UNIMOD:4 ms_run[1]:scan=1.1.8425.11 117.6294 2 1279.6334 1279.6343 R S 748 758 PSM TQIQSVEPYTK 2352 sp|P40763-2|STAT3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8432.10 117.8169 2 1292.6562 1292.6612 K Q 632 643 PSM DIQEESTFSSR 2353 sp|P42704|LPPRC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8417.11 117.4136 2 1297.5774 1297.5786 K K 67 78 PSM VLETAEDIQER 2354 sp|Q13813|SPTN1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8440.11 118.0356 2 1301.6456 1301.6463 K R 8 19 PSM TEGDGVYTLNDK 2355 sp|P00738|HPT_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8498.11 119.6205 2 1310.5960 1310.5990 R K 60 72 PSM FEEQGDFESEK 2356 sp|Q9BZF1-2|OSBL8_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8307.10 114.4331 2 1343.5488 1343.5517 K L 660 671 PSM VEGELEEMERK 2357 sp|P35580-3|MYH10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8406.11 117.1182 2 1347.6334 1347.6340 K H 892 903 PSM EQSGTIYLQHADEEREK 2358 sp|P37198|NUP62_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8238.11 112.5634 3 2031.9352 2031.9497 K T 416 433 PSM IQTQPGYANTLR 2359 sp|Q00325-2|MPCP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8475.11 118.994 2 1360.7062 1360.7099 R D 189 201 PSM LNQPPEDGISSVK 2360 sp|O43684-2|BUB3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8381.10 116.4445 2 1382.7042 1382.7041 K F 9 22 PSM TWEQQQEVVSR 2361 sp|Q9UJU6-2|DBNL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8468.11 118.8028 2 1388.6684 1388.6684 R N 237 248 PSM ATTGTQTLLSSGTR 2362 sp|Q8IX01-3|SUGP2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8407.11 117.1448 2 1392.7198 1392.7209 R L 696 710 PSM TATTQETDGFQVK 2363 sp|Q96GM5-2|SMRD1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8217.10 111.989 2 1424.6776 1424.6784 R R 261 274 PSM AQAELVGTADEATR 2364 sp|P30049|ATPD_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8286.10 113.8697 2 1430.6970 1430.7001 K A 137 151 PSM FEGGDRDLEHLSK 2365 sp|P13667|PDIA4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8369.11 116.1168 2 1501.7184 1501.7161 K F 617 630 PSM RQQEQQVPILEK 2366 sp|P49327|FAS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8383.7 116.4945 3 1494.8122 1494.8154 R F 1105 1117 PSM STVEGIQASVK 2367 sp|P18206|VINC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8031.6 106.9977 2 1117.5970 1117.5979 K T 656 667 PSM DPSASPGDAGEQAIR 2368 sp|P18206|VINC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7596.7 95.16495 3 1469.6692 1469.6746 R Q 286 301 PSM AGFAGDDAPR 2369 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7026.9 79.84914 2 975.4478 975.4410 K A 19 29 PSM LNEQQSVLQR 2370 sp|Q14683|SMC1A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7651.11 96.65798 2 1213.6374 1213.6415 K I 1010 1020 PSM VFPSHFTQQR 2371 sp|Q7Z6Z7-2|HUWE1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8175.4 110.8391 3 1245.6256 1245.6255 K T 3330 3340 PSM RYDDPEVQK 2372 sp|P38646|GRP75_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6204.4 57.51488 3 1148.5477 1148.5462 R D 127 136 PSM LNGHQLENHALK 2373 sp|Q9NZI8|IF2B1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6850.2 75.11643 4 1372.7189 1372.7211 K V 139 151 PSM KIQVLQQQADDAEER 2374 sp|P06753-2|TPM3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8360.9 115.8672 3 1769.8900 1769.8908 R A 13 28 PSM YKPESEELTAER 2375 sp|P07237|PDIA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7498.8 92.49443 3 1450.6906 1450.6939 K I 327 339 PSM ETPAATEAPSSTPK 2376 sp|P80723|BASP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6328.6 60.9387 3 1385.6713 1385.6674 K A 185 199 PSM LITQTFSHHNQLAQK 2377 sp|Q9Y266|NUDC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8145.6 110.0253 4 1764.9225 1764.9271 K T 54 69 PSM VNTPTTTVYR 2378 sp|P26639-2|SYTC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7507.10 92.74216 2 1150.5964 1150.5983 K C 277 287 PSM QSVENDIHGLR 2379 sp|P05783|K1C18_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8499.5 119.6377 3 1266.6283 1266.6317 R K 176 187 PSM QSVENDIHGLR 2380 sp|P05783|K1C18_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8497.4 119.5816 3 1266.6283 1266.6317 R K 176 187 PSM AVTEQGHELSNEER 2381 sp|P31946-2|1433B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6487.9 65.20997 3 1597.7302 1597.7332 K N 28 42 PSM TCLDNLASK 2382 sp|P46940|IQGA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 2-UNIMOD:4 ms_run[1]:scan=1.1.7937.6 104.4282 2 1020.4890 1020.4910 K G 1533 1542 PSM QGDNCDSIIR 2383 sp|Q9P2J5-2|SYLC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 5-UNIMOD:4 ms_run[1]:scan=1.1.7223.10 85.1441 2 1176.5194 1176.5193 R R 1035 1045 PSM VLANPGNSQVAR 2384 sp|Q14974|IMB1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6727.5 71.77662 3 1224.6559 1224.6575 R V 43 55 PSM QEYVDYSESAK 2385 sp|O60832|DKC1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7956.11 104.9571 2 1317.5736 1317.5724 K K 414 425 PSM TAVCDIPPR 2386 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 4-UNIMOD:4 ms_run[1]:scan=1.1.7145.11 83.06316 2 1027.5116 1027.5121 K G 351 360 PSM TAVCDIPPR 2387 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 4-UNIMOD:4 ms_run[1]:scan=1.1.7976.9 105.5012 2 1027.5138 1027.5121 K G 351 360 PSM LQGQLEQGDDTAAER 2388 sp|Q8NE71-2|ABCF1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7323.10 87.88323 3 1629.7687 1629.7594 R L 359 374 PSM VEQLGAEGNVEESQK 2389 sp|Q9Y383-3|LC7L2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7562.10 94.24181 3 1615.7662 1615.7689 K V 137 152 PSM LESENDEYER 2390 sp|O94906|PRP6_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6534.11 66.50391 2 1282.5322 1282.5313 K A 651 661 PSM FELQHGTEEQQEEVRK 2391 sp|O94906|PRP6_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7814.7 101.0624 4 1985.9385 1985.9443 K R 884 900 PSM VLVATNVAAR 2392 sp|Q9BQ39|DDX50_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7916.6 103.8528 2 1012.6002 1012.6029 K G 441 451 PSM CGSSEDLHDSVR 2393 sp|Q7Z4V5-3|HDGR2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 1-UNIMOD:4 ms_run[1]:scan=1.1.6348.7 61.48113 3 1360.5682 1360.5677 R E 636 648 PSM INSITVDNCK 2394 sp|Q01518-2|CAP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 9-UNIMOD:4 ms_run[1]:scan=1.1.7297.10 87.17284 2 1162.5652 1162.5652 K K 366 376 PSM TADDSATSDYCPAPK 2395 sp|Q9UBC3-8|DNM3B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 11-UNIMOD:4 ms_run[1]:scan=1.1.7063.9 80.84807 3 1597.6564 1597.6566 R R 321 336 PSM IANPVEGSTDR 2396 sp|Q15366-2|PCBP2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7200.3 84.51035 3 1157.5669 1157.5677 K Q 324 335 PSM KGAVAEDGDELR 2397 sp|P27695|APEX1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6481.5 65.03928 3 1258.6294 1258.6153 K T 7 19 PSM FQDDNVEGDK 2398 sp|Q92621|NU205_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6532.11 66.4489 2 1165.4902 1165.4888 K V 1733 1743 PSM KEVVEEAENGR 2399 sp|P06454-2|PTMA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6185.8 56.994 3 1258.6174 1258.6153 K D 21 32 PSM ANGMELDGRR 2400 sp|P62995-3|TRA2B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6597.5 68.22585 3 1117.5286 1117.5298 R I 79 89 PSM SLESTTLTEK 2401 sp|Q16527|CSRP2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7886.9 103.035 2 1107.5618 1107.5659 K E 152 162 PSM RAIYQATYR 2402 sp|P28074|PSB5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7355.5 88.72898 3 1140.5995 1140.6040 R D 217 226 PSM HVEAVAYYK 2403 sp|O43765|SGTA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7317.7 87.71432 2 1078.5548 1078.5447 K K 175 184 PSM NREEFEDQSLEK 2404 sp|Q12830-2|BPTF_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7857.6 102.2329 3 1522.6846 1522.6899 K D 593 605 PSM SRVEEVDGSLVR 2405 sp|Q15047-3|SETB1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8184.9 111.0929 3 1344.6973 1344.6997 K I 365 377 PSM QQALTVSTDPEHR 2406 sp|P35606|COPB2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7551.8 93.93718 3 1480.7236 1480.7270 K F 632 645 PSM RDNTNEIYSGK 2407 sp|P05556|ITB1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6375.7 62.21377 3 1295.6071 1295.6106 K F 541 552 PSM ELDVEEAHAASTEEK 2408 sp|Q96C86|DCPS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7831.10 101.5289 3 1656.7381 1656.7478 R E 14 29 PSM SEDSSGAAGLSGLHR 2409 sp|Q86U86-8|PB1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7914.8 103.8016 3 1442.6740 1442.6750 K T 946 961 PSM TRDDEPVCGRPLGIR 2410 sp|Q9HDC9-2|APMAP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 8-UNIMOD:4 ms_run[1]:scan=1.1.8398.5 116.8972 4 1739.8681 1739.8737 K A 142 157 PSM NKFDVDAADEK 2411 sp|Q9H0D6-2|XRN2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7146.3 83.07713 3 1250.6017 1250.5779 K F 447 458 PSM EATADDLIK 2412 sp|Q16531|DDB1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8269.10 113.4102 2 974.4916 974.4920 R V 1123 1132 PSM DGVVEITGK 2413 sp|P04792|HSPB1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7930.5 104.2349 2 916.4780 916.4866 K H 115 124 PSM RLISENSVYEK 2414 sp|Q13111|CAF1A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7926.3 104.1222 3 1336.7020 1336.6986 K R 800 811 PSM PASSSFGSEAK 2415 sp|Q9Y4W2-2|LAS1L_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6307.9 60.3706 2 1066.4832 1066.4931 K A 524 535 PSM RQITIEEGEQR 2416 sp|Q9NRW1-2|RAB6B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.6970.6 78.33929 3 1357.6912 1357.6950 K A 121 132 PSM TDAASKPFAEVR 2417 sp|Q13427|PPIG_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7686.4 97.60387 3 1290.6526 1290.6568 K I 159 171 PSM QAGEVTFADAHRPK 2418 sp|Q13243-3|SRSF5_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.7514.7 92.92767 3 1525.7611 1525.7637 R L 127 141 PSM KGDYIEAESSYSR 2419 sp|Q99614|TTC1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 21 ms_run[1]:scan=1.1.8084.7 108.3904 3 1503.6703 1503.6841 K A 129 142 PSM EATNPPVIQEEK 2420 sp|P30101|PDIA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.7429.10 90.65638 2 1354.678047 1353.677610 R P 483 495 PSM NSEPAGLETPEAK 2421 sp|P07814|SYEP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.7590.11 95.0099 2 1342.641247 1341.641225 R V 890 903 PSM YHTVNGHNCEVR 2422 sp|P09651|ROA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21 9-UNIMOD:4 ms_run[1]:scan=1.1.6252.4 58.84557 4 1485.645294 1484.657895 K K 167 179 PSM YHTVNGHNCEVR 2423 sp|P09651|ROA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21 9-UNIMOD:4 ms_run[1]:scan=1.1.6233.5 58.32087 4 1485.645294 1484.657895 K K 167 179 PSM RMEELHNQEMQK 2424 sp|P23246|SFPQ_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.6456.4 64.37548 4 1572.718894 1571.718446 R R 548 560 PSM FGQGGAGPVGGQGPR 2425 sp|P23246|SFPQ_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.7420.3 90.41423 3 1341.658871 1340.658546 R G 667 682 PSM YHTINGHNAEVR 2426 sp|P22626|ROA2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.6647.5 69.58477 4 1410.664094 1409.680010 K K 174 186 PSM QEMQEVQSSR 2427 sp|P22626|ROA2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 21 1-UNIMOD:28 ms_run[1]:scan=1.1.7620.10 95.80963 2 1203.5185 1203.5185 R S 191 201 PSM VVLIGGKPDR 2428 sp|P61978|HNRPK_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.7363.2 88.93645 3 1053.634271 1052.634229 R V 192 202 PSM MEVKPPPGRPQPDSGR 2429 sp|P51991|ROA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 21 1-UNIMOD:1 ms_run[1]:scan=1.1.8228.10 112.2884 3 1788.8912 1788.8936 - R 1 17 PSM MEVKPPPGRPQPDSGR 2430 sp|P51991|ROA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 21 1-UNIMOD:1 ms_run[1]:scan=1.1.8209.9 111.7702 3 1789.8912 1788.8932 - R 1 17 PSM RTVDLSSHLAK 2431 sp|P04843|RPN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.7259.5 86.11983 3 1226.678471 1225.677885 K V 38 49 PSM QQSELQSQVR 2432 sp|Q14847|LASP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 21 1-UNIMOD:28 ms_run[1]:scan=1.1.8279.11 113.6826 2 1184.5747 1184.5780 K Y 76 86 PSM TQDQISNIK 2433 sp|Q14847|LASP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.6764.9 72.79765 2 1046.541647 1045.540388 K Y 113 122 PSM EDLPAENGETKTEESPASDEAGEK 2434 sp|P05114|HMGN1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.7877.11 102.7913 3 2533.077071 2532.098731 K E 72 96 PSM IANPVEGSTDR 2435 sp|Q15366|PCBP2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.7155.10 83.33437 2 1158.566447 1157.567666 K Q 323 334 PSM KPEDWDERPK 2436 sp|P27824|CALX_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 21 ms_run[1]:scan=1.1.6708.6 71.25703 3 1299.6332 1298.6252 R I 283 293 PSM HLQLAIRNDEELNK 2437 sp|Q96QV6|H2A1A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2000.2 14.37183 4 1692.894894 1691.895482 R L 83 97 PSM AAVQAAEVK 2438 sp|Q15046|SYK_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 21 1-UNIMOD:1 ms_run[1]:scan=1.1.7977.7 105.5251 2 927.5009 927.5020 M V 2 11 PSM EAEGAPQVEAGK 2439 sp|Q05682|CALD1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.6300.11 60.18338 2 1185.571047 1184.567331 K R 523 535 PSM AAAFEQLQK 2440 sp|O94826|TOM70_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 21 ms_run[1]:scan=1.1.8271.6 113.4577 2 1005.5182 1004.5282 R W 160 169 PSM EREQQDLEFAK 2441 sp|O43242|PSMD3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.7910.6 103.6886 3 1392.669371 1391.668108 R E 513 524 PSM ASSDIQVK 2442 sp|P16949|STMN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 21 1-UNIMOD:1 ms_run[1]:scan=1.1.7568.7 94.4014 2 888.4527 888.4547 M E 2 10 PSM YRPGTVALR 2443 sp|Q16695|H31T_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.1673.2 11.85248 3 1032.591671 1031.587613 R E 42 51 PSM QTESTSFLEK 2444 sp|P60900|PSA6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.8485.11 119.2667 2 1169.561247 1168.561183 K K 172 182 PSM AIEVLSDEHAR 2445 sp|Q9HCS7|SYF1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.8055.3 107.638 3 1239.627671 1238.625515 K E 655 666 PSM KLEAQETLNEEDK 2446 sp|Q9UIF9|BAZ2A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.7281.9 86.73248 3 1546.749671 1545.752232 K A 695 708 PSM CTESEEEEVTK 2447 sp|P54578|UBP14_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 21 1-UNIMOD:385,1-UNIMOD:4 ms_run[1]:scan=1.1.8311.11 114.5425 2 1322.5182 1322.5179 K G 257 268 PSM AAGVDCGDGVGAR 2448 sp|Q5TBB1|RNH2B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 21 1-UNIMOD:1,6-UNIMOD:4 ms_run[1]:scan=1.1.7845.9 101.9094 2 1245.5431 1245.5403 M Q 2 15 PSM TFGETHPFTK 2449 sp|P09960|LKHA4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.8116.2 109.2284 3 1164.574271 1163.561124 K L 356 366 PSM GHQQLYWSHPR 2450 sp|P62273|RS29_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 21 ms_run[1]:scan=1.1.8272.5 113.4831 3 1408.6622 1407.6792 M K 2 13 PSM VAEVEGEQVDNK 2451 sp|O95202|LETM1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.6588.6 67.97943 3 1314.624971 1315.625575 K A 452 464 PSM VVQSLEQTAR 2452 sp|Q15631|TSN_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.6983.8 78.69852 2 1128.600247 1129.609137 K E 27 37 PSM AAFTECCQAADK 2453 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21 6-UNIMOD:4,7-UNIMOD:4 ms_run[1]:scan=1.1.7064.11 80.87801 2 1369.548847 1370.559486 K A 187 199 PSM PGFSIADKK 2454 sp|P62913|RL11_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.7402.2 89.94534 3 961.523771 961.523282 R R 137 146 PSM IHGTEEGQQILK 2455 sp|Q14980|NUMA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.7502.6 92.59973 3 1350.707171 1351.709579 R Q 43 55 PSM CESAFLSK 2456 sp|P83731|RL24_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21 1-UNIMOD:4 ms_run[1]:scan=1.1.7769.7 99.85747 2 941.431847 940.432418 K R 36 44 PSM SEAQLQEIR 2457 sp|P35658|NU214_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.7850.10 102.0478 2 1071.540047 1072.551287 K R 807 816 PSM PVAVALDTK 2458 sp|P14618|KPYM_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.7885.6 103.0026 2 912.526247 912.528033 R G 107 116 PSM GVTIKPTVDDD 2459 sp|Q2VIR3|IF2GL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.7965.9 105.2008 2 1159.559247 1158.576833 R - 462 473 PSM TCVSLAVSR 2460 sp|O95782|AP2A1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21 2-UNIMOD:4 ms_run[1]:scan=1.1.8095.7 108.6754 2 992.512247 991.512065 K L 224 233 PSM RALEQQVEEMK 2461 sp|P35579|MYH9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.8410.4 117.213 3 1358.697671 1359.681650 K T 1528 1539 PSM AADLNGDLTATR 2462 sp|Q15293|RCN1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.8450.11 118.3091 2 1217.586447 1216.604780 K E 177 189 PSM LVIVGDGACGK 2463 sp|P61586|RHOA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 21 9-UNIMOD:4 ms_run[1]:scan=1.1.8508.9 119.8902 2 1086.564247 1087.569580 K T 8 19 PSM HGRPGIGATHSSR 2464 sp|P62841|RS15_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.5918.2 49.69335 4 1331.6845 1331.6807 K F 128 141 PSM EREAELGAR 2465 sp|P11940-2|PABP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6050.4 53.31813 3 1029.5224 1029.5203 K A 178 187 PSM EGVHGGLINKK 2466 sp|P07737|PROF1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6115.6 55.06628 3 1150.6474 1150.6458 K C 117 128 PSM AAVAGEDGR 2467 sp|P07910-2|HNRPC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.5774.2 46.00611 2 844.4042 844.4039 R M 65 74 PSM REPAEQPGDGER 2468 sp|Q15424-3|SAFB1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.5844.4 47.71315 3 1339.6162 1339.6116 K T 295 307 PSM KAQQELEEQTR 2469 sp|P26038|MOES_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6099.9 54.63277 3 1358.6794 1358.6790 K R 360 371 PSM FKDPNAPK 2470 sp|B2RPK0|HGB1A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6045.2 53.17735 3 915.4810 915.4814 K R 89 97 PSM IDASKNEEDEGHSNSSPR 2471 sp|Q14103-3|HNRPD_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.5852.5 47.92842 4 1970.8585 1970.8566 K H 68 86 PSM KYHNVGLSK 2472 sp|Q14103-3|HNRPD_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6051.8 53.3525 2 1044.5710 1044.5716 K C 243 252 PSM AETPTAAEDDNEGDKK 2473 sp|O60841|IF2P_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.5920.9 49.75975 3 1689.7366 1689.7329 K K 299 315 PSM DNIQGITKPAIR 2474 sp|P62805|H4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.1656.4 11.4314 3 1324.7449 1324.7463 R R 25 37 PSM TVTAMDVVYALK 2475 sp|P62805|H4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 5-UNIMOD:35 ms_run[1]:scan=1.1.1638.11 11.01192 2 1325.6866 1325.6901 K R 81 93 PSM RISGLIYEETR 2476 sp|P62805|H4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.1708.2 12.32782 3 1335.7126 1335.7146 K G 46 57 PSM EGRPSGEAFVELESEDEVK 2477 sp|P31943|HNRH1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.1656.7 11.4364 3 2105.9719 2105.9753 R L 50 69 PSM NNFSDTGNFGFGIQEHIDLGIK 2478 sp|P62913-2|RL11_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.1655.5 11.41347 3 2422.1503 2422.1553 K Y 96 118 PSM VSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFR 2479 sp|Q9BVA1|TBB2B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 27-UNIMOD:4,37-UNIMOD:4 ms_run[1]:scan=1.1.1656.11 11.44307 4 4592.0989 4592.0999 K T 175 214 PSM EGSALSHVR 2480 sp|Q3MHD2-2|LSM12_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6236.3 58.40112 3 954.5071 954.4883 K K 158 167 PSM KQDPPVTHDLR 2481 sp|P25685|DNJB1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6254.2 58.89713 4 1304.6869 1304.6837 K V 159 170 PSM RDHALLEEQSK 2482 sp|O43707|ACTN4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6319.3 60.69217 4 1324.6733 1324.6735 K Q 633 644 PSM RVEEELEK 2483 sp|Q9NWB6|ARGL1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6233.3 58.31753 3 1030.5310 1030.5294 K R 141 149 PSM VLEDSDLKK 2484 sp|P11021|BIP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6474.3 64.84628 3 1045.5649 1045.5655 K S 345 354 PSM ANHEEVLAAGK 2485 sp|P00491|PNPH_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6276.5 59.5103 3 1137.5785 1137.5778 K Q 255 266 PSM VVASGPGLEHGK 2486 sp|O75369-2|FLNB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6263.4 59.14877 3 1149.6139 1149.6142 K V 1136 1148 PSM ERPPEEVAAR 2487 sp|Q16891-2|MIC60_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6197.5 57.32215 3 1152.5878 1152.5887 R L 185 195 PSM MREVCDEVK 2488 sp|P34897-2|GLYM_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 5-UNIMOD:4 ms_run[1]:scan=1.1.6502.4 65.6123 3 1164.5338 1164.5267 R A 227 236 PSM LNECVDHTPK 2489 sp|P78417|GSTO1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 4-UNIMOD:4 ms_run[1]:scan=1.1.6209.5 57.65558 3 1211.5627 1211.5605 K L 189 199 PSM GHLENNPALEK 2490 sp|P05388-2|RLA0_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6472.6 64.79855 3 1220.6146 1220.6149 R L 67 78 PSM PGSDTIKPDVQK 2491 sp|Q06830|PRDX1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6412.4 63.18903 3 1283.6743 1283.6721 K S 179 191 PSM VGTVIGSNK 2492 sp|P09874|PARP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6298.5 60.11845 2 873.4916 873.4920 R L 592 601 PSM HPSKPDPSGECNPDLR 2493 sp|Q09028-2|RBBP4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 11-UNIMOD:4 ms_run[1]:scan=1.1.6487.4 65.20163 4 1804.8141 1804.8162 K L 156 172 PSM MEELHNQEVQK 2494 sp|Q15233-2|NONO_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6442.6 63.99467 3 1383.6478 1383.6452 R R 237 248 PSM GFGSEEGSR 2495 sp|Q9Y5S9|RBM8A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6239.7 58.49132 2 924.3936 924.3937 R A 39 48 PSM IAVHCTVR 2496 sp|P62913-2|RL11_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 5-UNIMOD:4 ms_run[1]:scan=1.1.6255.11 58.9397 2 954.5074 954.5069 K G 67 75 PSM FHVEEEGK 2497 sp|P00558-2|PGK1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6427.8 63.59509 2 973.4504 973.4505 R G 96 104 PSM HYASEEIK 2498 sp|Q01082-3|SPTB2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6141.9 55.78825 2 975.4658 975.4661 K E 1969 1977 PSM HLVYESDK 2499 sp|Q15293-2|RCN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6335.10 61.13292 2 989.4808 989.4818 R N 236 244 PSM GEDKDEGPVAEQVK 2500 sp|Q8WWM7-3|ATX2L_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6516.8 66.00418 3 1499.7067 1499.7104 K K 642 656 PSM GEGQLGPAER 2501 sp|P13639|EF2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6454.9 64.32883 2 1012.4938 1012.4938 K A 240 250 PSM FEETTADGR 2502 sp|Q01469|FABP5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6251.10 58.8281 2 1024.4470 1024.4462 K K 73 82 PSM VGGSSVDLHR 2503 sp|O60716-3|CTND1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6473.2 64.8182 3 1025.5252 1025.5254 R F 265 275 PSM VTNLSEDTR 2504 sp|O75821|EIF3G_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6428.9 63.62275 2 1033.5042 1033.5040 R E 243 252 PSM SQSAAVTPSSTTSSTR 2505 sp|Q16186|ADRM1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6127.9 55.4026 3 1566.7498 1566.7486 R A 211 227 PSM QGGESETFAK 2506 sp|Q13485|SMAD4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6315.11 60.59458 2 1052.4782 1052.4774 R R 28 38 PSM LEGSSGGIGER 2507 sp|Q9Y5B6-2|PAXB1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6438.9 63.89008 2 1060.5210 1060.5149 R Y 430 441 PSM ENQQATSGPNQPSVR 2508 sp|P16989-2|YBOX3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6199.9 57.38435 3 1611.7606 1611.7601 K R 243 258 PSM QQLTNTEVR 2509 sp|O60313-10|OPA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6492.9 65.34703 2 1087.5606 1087.5622 R R 951 960 PSM RHLTGEFEK 2510 sp|P62826|RAN_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6400.4 62.86378 3 1115.5732 1115.5723 K K 29 38 PSM GSGTAEVELKK 2511 sp|P14618-2|KPYM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6299.10 60.15434 2 1117.5984 1117.5979 K G 126 137 PSM MEGGTENDLR 2512 sp|Q9BXP5-2|SRRT_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6513.11 65.92658 2 1120.4802 1120.4819 K I 257 267 PSM KLENEVEQR 2513 sp|P12270|TPR_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6221.11 57.9983 2 1143.5872 1143.5884 K H 854 863 PSM TCEESSFCK 2514 sp|Q14697|GANAB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 2-UNIMOD:4,8-UNIMOD:4 ms_run[1]:scan=1.1.6500.9 65.5658 2 1146.4316 1146.4322 K R 40 49 PSM SAEEGELAESK 2515 sp|Q9C0C2|TB182_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6346.9 61.42983 2 1148.5228 1148.5197 R S 1666 1677 PSM RYDDPEVQK 2516 sp|P38646|GRP75_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6206.10 57.5806 2 1148.5458 1148.5462 R D 127 136 PSM TDGCHAYLSK 2517 sp|Q01518-2|CAP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 4-UNIMOD:4 ms_run[1]:scan=1.1.6323.5 60.80572 3 1150.5103 1150.5077 K N 412 422 PSM LYAVHQEGNK 2518 sp|P50990|TCPQ_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6272.10 59.40788 2 1157.5838 1157.5829 K N 467 477 PSM VTQVDGNSPVR 2519 sp|P48444|COPD_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6512.10 65.89727 2 1170.5982 1170.5993 K F 486 497 PSM YNGESSEYTK 2520 sp|Q9BXF3|CECR2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6244.11 58.63675 2 1176.4940 1176.4935 K M 513 523 PSM TENNDHINLK 2521 sp|P61956-2|SUMO2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6510.6 65.83552 3 1196.5789 1196.5785 K V 12 22 PSM LAGESESNLRK 2522 sp|P55072|TERA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6192.6 57.1849 3 1202.6257 1202.6255 K A 278 289 PSM VQNIHPVESAK 2523 sp|P80303-2|NUCB2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6270.5 59.34405 3 1220.6485 1220.6513 K I 34 45 PSM TSNEVQYDQR 2524 sp|Q13573|SNW1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6384.10 62.45557 2 1238.5518 1238.5527 R L 401 411 PSM EESAASGGAAYTK 2525 sp|Q9Y2W1|TR150_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6123.9 55.29232 2 1240.5604 1240.5571 K R 334 347 PSM AGLSPANCQSDR 2526 sp|Q14692|BMS1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 8-UNIMOD:4 ms_run[1]:scan=1.1.6362.11 61.87268 2 1274.5696 1274.5673 K V 549 561 PSM FIHDQTSPNPK 2527 sp|P53007|TXTP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6240.6 58.51737 3 1282.6315 1282.6306 K Y 150 161 PSM CTESEEEEVTK 2528 sp|P54578-2|UBP14_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 1-UNIMOD:4 ms_run[1]:scan=1.1.6269.10 59.3247 2 1339.5466 1339.5449 K G 222 233 PSM DDREAQSICER 2529 sp|P63010-2|AP2B1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 9-UNIMOD:4 ms_run[1]:scan=1.1.6403.10 62.9537 2 1377.5970 1377.5943 K V 233 244 PSM HVVQSISTQQEK 2530 sp|P24539|AT5F1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6205.10 57.55265 3 1382.7166 1382.7154 K E 222 234 PSM EQTFSGGTSQDTK 2531 sp|Q9Y2W1|TR150_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6235.9 58.38315 2 1384.6130 1384.6107 K A 203 216 PSM SYCNDQSTGDIK 2532 sp|P00492|HPRT_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 3-UNIMOD:4 ms_run[1]:scan=1.1.6518.11 66.06437 2 1386.5708 1386.5722 K V 104 116 PSM SGKPAELLK 2533 sp|P29401-2|TKT_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6643.2 69.47097 3 941.5558 941.5545 R M 603 612 PSM IHNVGSPLK 2534 sp|P52701-3|MSH6_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6604.3 68.41417 3 963.5494 963.5502 K S 695 704 PSM KLELSDNR 2535 sp|P39687|AN32A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6559.3 67.17757 3 973.5187 973.5192 K V 68 76 PSM IDDIVSGHK 2536 sp|P49368|TCPG_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6691.3 70.78582 3 982.5073 982.5084 R K 519 528 PSM AKFENLCK 2537 sp|P08238|HS90B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 7-UNIMOD:4 ms_run[1]:scan=1.1.6803.3 73.85723 3 1008.5065 1008.5062 K F 558 566 PSM EGVHGGLINK 2538 sp|P07737|PROF1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6552.3 66.98513 3 1022.5501 1022.5509 K K 117 127 PSM VNTLIRPDGEKK 2539 sp|P62750|RL23A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6592.3 68.08497 4 1368.7717 1368.7725 K A 124 136 PSM AEHDSILAEK 2540 sp|P26639-2|SYTC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6778.4 73.1726 3 1111.5484 1111.5509 K A 66 76 PSM THNDIIHNENMR 2541 sp|P15311|EZRI_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6794.2 73.60854 4 1492.6837 1492.6841 R Q 548 560 PSM GAVIVVSHDAR 2542 sp|Q8NE71-2|ABCF1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6822.4 74.3739 3 1122.6163 1122.6146 K L 752 763 PSM GAGTDDHTLIR 2543 sp|P08758|ANXA5_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6808.3 73.99429 3 1154.5669 1154.5680 K V 261 272 PSM RSTTLDAGNIK 2544 sp|O75400-3|PR40A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6722.3 71.6357 3 1174.6318 1174.6306 K L 690 701 PSM SHEGETSYIR 2545 sp|Q13242|SRSF9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6520.5 66.10934 3 1177.5358 1177.5363 R V 172 182 PSM DSDKTDTDWR 2546 sp|P23588|IF4B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6745.8 72.27808 3 1237.5223 1237.5211 R A 191 201 PSM EETQPPVALKK 2547 sp|Q8NC51-3|PAIRB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6837.6 74.76994 3 1238.6857 1238.6870 K E 93 104 PSM VAPAPAVVK 2548 sp|P62424|RL7A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6596.5 68.19842 2 850.5276 850.5276 K K 12 21 PSM YDHQAEEDLR 2549 sp|Q15417|CNN3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6674.5 70.32333 3 1274.5531 1274.5527 K N 24 34 PSM YNAQCQETIR 2550 sp|P21741|MK_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 5-UNIMOD:4 ms_run[1]:scan=1.1.6772.6 73.01131 3 1281.5800 1281.5772 R V 112 122 PSM QAVEQQIQSHR 2551 sp|P33176|KINH_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6572.8 67.54232 3 1322.6650 1322.6691 K E 699 710 PSM DNIQGITK 2552 sp|P62805|H4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6807.6 73.97182 2 887.4708 887.4712 R P 25 33 PSM SKAEAESLYQSK 2553 sp|P04264|K2C1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6776.9 73.1261 3 1339.6597 1339.6619 K Y 365 377 PSM SKAEAESLYQSK 2554 sp|P04264|K2C1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6775.10 73.10028 3 1339.6597 1339.6619 K Y 365 377 PSM SGYLSSER 2555 sp|P15311|EZRI_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6689.8 70.73945 2 897.4186 897.4192 K L 144 152 PSM TGLEDPER 2556 sp|P35580-3|MYH10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6685.7 70.62842 2 915.4288 915.4298 R Y 5 13 PSM PISTLDNR 2557 sp|P31689-2|DNJA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6810.8 74.05748 2 914.4798 914.4821 K T 276 284 PSM THLSLSHNPEQK 2558 sp|P11586|C1TC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6528.8 66.334 3 1389.6937 1389.7001 K G 867 879 PSM ALLQSSASR 2559 sp|Q9UQ80|PA2G4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6662.8 69.99962 2 931.5090 931.5087 K K 356 365 PSM VVSSSIVDK 2560 sp|P62333|PRS10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6768.5 72.90035 2 932.5172 932.5179 K Y 198 207 PSM DDNPNLPR 2561 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6750.5 72.41055 2 939.4400 939.4410 K L 131 139 PSM AFHNEAQVNPER 2562 sp|P17987|TCPA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6624.8 68.96105 3 1410.6643 1410.6640 R K 469 481 PSM AAAAAAALQAK 2563 sp|P36578|RL4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6637.6 69.31423 2 955.5450 955.5450 K S 354 365 PSM LEGDAALNR 2564 sp|Q9Y2Z0-2|SGT1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6878.7 75.89227 2 957.4994 957.4879 K L 271 280 PSM VVAMAQVAR 2565 sp|A6PVS8|LRIQ3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 4-UNIMOD:35 ms_run[1]:scan=1.1.6850.9 75.12808 2 959.5276 959.5222 R E 442 451 PSM EPSEVPTPK 2566 sp|P17096|HMGA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6619.9 68.82568 2 982.4960 982.4971 K R 47 56 PSM LLADQAEAR 2567 sp|P84098|RL19_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6759.9 72.66232 2 985.5176 985.5192 K R 154 163 PSM NTSDVISAAK 2568 sp|P35221-2|CTNA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6812.10 74.11545 2 1004.5108 1004.5138 K K 738 748 PSM IQQNTFTR 2569 sp|P21333-2|FLNA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6806.8 73.9477 2 1006.5192 1006.5196 K W 44 52 PSM TEDEVLTSK 2570 sp|Q9BQ61|TRIR_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6706.9 71.20708 2 1020.4958 1020.4975 K G 138 147 PSM DCVGPEVEK 2571 sp|P00558-2|PGK1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 2-UNIMOD:4 ms_run[1]:scan=1.1.6605.8 68.44984 2 1031.4614 1031.4594 K A 70 79 PSM SAYESQPIR 2572 sp|Q96EY7|PTCD3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6731.8 71.89167 2 1049.5144 1049.5141 K Q 557 566 PSM GAGGQGQLDVR 2573 sp|Q14315-2|FLNC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6656.8 69.83542 2 1056.5300 1056.5312 R M 992 1003 PSM GISAGAVQTAGK 2574 sp|P46087-4|NOP2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6759.10 72.66399 2 1058.5698 1058.5720 K K 80 92 PSM ETCFAEEGK 2575 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 3-UNIMOD:4 ms_run[1]:scan=1.1.6642.8 69.45377 2 1069.4364 1069.4386 K K 589 598 PSM SITHDIEEK 2576 sp|Q9UHD8|SEPT9_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6669.10 70.19456 2 1070.5278 1070.5244 K G 344 353 PSM TTTGSYIANR 2577 sp|P28072|PSB6_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6769.10 72.93602 2 1082.5326 1082.5356 R V 54 64 PSM LQNALNEQR 2578 sp|Q14980|NUMA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6659.11 69.92245 2 1084.5634 1084.5625 R V 1034 1043 PSM AEAGPEGVAPAPEGEKK 2579 sp|Q9Y4L1|HYOU1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6624.10 68.96439 3 1635.8089 1635.8104 K Q 670 687 PSM TAQEVETYR 2580 sp|P17844-2|DDX5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6698.10 70.9895 2 1095.5192 1095.5196 R R 69 78 PSM TQLAVCQQR 2581 sp|Q02790|FKBP4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 6-UNIMOD:4 ms_run[1]:scan=1.1.6789.10 73.48444 2 1102.5530 1102.5553 K I 391 400 PSM ALGSEVQDASK 2582 sp|Q9H2G2-2|SLK_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6838.10 74.80331 2 1103.5406 1103.5459 K V 664 675 PSM VEQIEAGTPGR 2583 sp|Q16881-2|TRXR1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6898.11 76.43397 2 1155.5870 1155.5884 K L 300 311 PSM TLHTEELTSK 2584 sp|Q5T7N2|LITD1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6741.10 72.17097 2 1157.5908 1157.5928 R E 596 606 PSM IAEVDCTAER 2585 sp|Q8NBS9|TXND5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 6-UNIMOD:4 ms_run[1]:scan=1.1.6693.11 70.85403 2 1162.5298 1162.5288 K N 376 386 PSM GMTENEVEDR 2586 sp|Q13617-2|CUL2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6716.9 71.48115 2 1178.4918 1178.4874 K L 424 434 PSM DSAQCAAIAER 2587 sp|Q96RS6-2|NUDC1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 5-UNIMOD:4 ms_run[1]:scan=1.1.6847.10 75.04785 2 1190.5336 1190.5350 R L 343 354 PSM QVENAGAIGPSR 2588 sp|Q9UHD8|SEPT9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6747.11 72.33787 2 1197.6084 1197.6102 K F 118 130 PSM QVENAGAIGPSR 2589 sp|Q9UHD8|SEPT9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6746.10 72.30882 2 1197.6084 1197.6102 K F 118 130 PSM DADLTDTAQTR 2590 sp|Q13630|FCL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6840.10 74.85745 2 1205.5524 1205.5524 K A 45 56 PSM AGDEIDEPSER 2591 sp|Q96ME7-3|ZN512_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6721.11 71.62154 2 1216.5236 1216.5208 K E 199 210 PSM LSSDCEDQIR 2592 sp|Q92896|GSLG1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 5-UNIMOD:4 ms_run[1]:scan=1.1.6867.10 75.59535 2 1221.5276 1221.5296 R I 980 990 PSM LINDCHGSVSEASSEQK 2593 sp|P50851-2|LRBA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 5-UNIMOD:4 ms_run[1]:scan=1.1.6719.11 71.56655 3 1859.8327 1859.8319 K I 1224 1241 PSM HVTSEQEWDK 2594 sp|P37268|FDFT_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6697.8 70.95869 3 1257.5647 1257.5626 K Y 161 171 PSM LLQAETASNSAR 2595 sp|Q14980|NUMA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6753.11 72.50278 2 1259.6472 1259.6469 R A 1271 1283 PSM MDSTEPPYSQK 2596 sp|Q5VTE0|EF1A3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6905.10 76.61305 2 1281.5544 1281.5547 K R 155 166 PSM NLSSTTDDEAPR 2597 sp|O00515|LAD1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6571.11 67.5199 2 1304.5888 1304.5844 R L 36 48 PSM EGIESGDPGTDDGR 2598 sp|Q12797-10|ASPH_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6675.11 70.36083 2 1403.5814 1403.5801 K F 484 498 PSM STVNCSTTPVAER 2599 sp|Q99567|NUP88_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 5-UNIMOD:4 ms_run[1]:scan=1.1.6572.11 67.54732 2 1420.6622 1420.6617 K F 151 164 PSM APEQEQAAPGPAAGGEAPK 2600 sp|P80723|BASP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6671.11 70.25111 2 1774.8508 1774.8486 K A 103 122 PSM LNLSTRPEK 2601 sp|P26639-2|SYTC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6999.4 79.12959 3 1056.5920 1056.5927 K F 529 538 PSM STTTGHLIYK 2602 sp|Q5VTE0|EF1A3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6943.4 77.60783 3 1119.5926 1119.5924 K C 21 31 PSM GGLGLSGAK 2603 sp|P22695|QCR2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6985.3 78.74493 2 758.4278 758.4286 R A 242 251 PSM KNEIMVAPDK 2604 sp|Q9NP97|DLRB1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6956.2 77.95486 3 1143.5941 1143.5958 K D 75 85 PSM VHELNEEIGK 2605 sp|Q9Y383-3|LC7L2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7164.5 83.56078 3 1166.5939 1166.5931 R L 123 133 PSM AGLLSQAK 2606 sp|Q5RKV6|EXOS6_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7088.3 81.50832 2 786.4572 786.4599 R G 43 51 PSM GRPYDYNGPR 2607 sp|P13667|PDIA4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7241.4 85.62515 3 1193.5570 1193.5578 K E 261 271 PSM ANGHLLLNSEK 2608 sp|Q9P2J5-2|SYLC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7145.7 83.0565 3 1194.6343 1194.6357 R M 652 663 PSM RLEIEHSVPK 2609 sp|Q9NZI8|IF2B1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7290.6 86.97473 3 1206.6703 1206.6720 K K 67 77 PSM LVSDSLSEHEK 2610 sp|Q96KR1|ZFR_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6954.5 77.90625 3 1242.6085 1242.6092 K N 757 768 PSM RYESHPVCADLQAK 2611 sp|Q9NX63|MIC19_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 8-UNIMOD:4 ms_run[1]:scan=1.1.7180.6 83.9764 4 1672.7957 1672.7991 K I 176 190 PSM VGEVIVTK 2612 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7069.3 80.99738 2 843.5070 843.5066 K D 345 353 PSM SCYDLSCHAR 2613 sp|P41250|GARS_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 2-UNIMOD:4,7-UNIMOD:4 ms_run[1]:scan=1.1.7079.6 81.26825 3 1267.5085 1267.5074 R A 465 475 PSM GTLDPVEK 2614 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6933.7 77.3428 2 857.4492 857.4494 R A 312 320 PSM SLNDITAK 2615 sp|P48047|ATPO_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7071.7 81.05708 2 860.4590 860.4603 K E 91 99 PSM HTNYTMEHIR 2616 sp|O43707|ACTN4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7032.6 80.0031 3 1300.5973 1300.5982 K V 724 734 PSM TADEVPLK 2617 sp|Q9NZI8|IF2B1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6970.5 78.33762 2 871.4650 871.4651 K I 273 281 PSM TSVETALR 2618 sp|P47755-2|CAZA2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7244.8 85.71387 2 875.4706 875.4712 R A 122 130 PSM AEFAEVSK 2619 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7083.6 81.3773 2 879.4334 879.4338 K L 250 258 PSM AEFAEVSK 2620 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7064.7 80.87135 2 879.4334 879.4338 K L 250 258 PSM VGQDPVLR 2621 sp|Q04837|SSBP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6996.10 79.05795 2 882.4912 882.4923 R Q 39 47 PSM KGDIVDIK 2622 sp|P46778|RL21_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7175.4 83.84322 2 886.5082 886.5124 K G 36 44 PSM ATDVMIAGK 2623 sp|P23526-2|SAHH_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7216.6 84.94859 2 904.4584 904.4688 R V 178 187 PSM AYDIAGSTK 2624 sp|P11388-4|TOP2A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6950.7 77.80183 2 924.4536 924.4552 R D 243 252 PSM AHSIQIMK 2625 sp|Q02543|RL18A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7013.8 79.50665 2 926.5006 926.5007 R V 121 129 PSM SVGIVTTTR 2626 sp|P05186|PPBT_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7192.7 84.29937 2 932.5292 932.5291 K V 160 169 PSM EGSLVINSK 2627 sp|Q9Y5B9|SP16H_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7186.6 84.13495 2 945.5134 945.5131 R N 358 367 PSM ASMQQQQQLASAR 2628 sp|Q9Y3Y2-3|CHTOP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6937.7 77.45071 3 1445.7031 1445.7045 R N 39 52 PSM YICENQDSISSK 2629 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 3-UNIMOD:4 ms_run[1]:scan=1.1.7034.4 80.05367 3 1442.6344 1442.6347 K L 287 299 PSM IGDTSVSYK 2630 sp|P20700|LMNB1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7047.7 80.41143 2 968.4816 968.4815 K Y 475 484 PSM ELAEAVAGGR 2631 sp|Q9UBT2|SAE2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7255.7 86.01358 2 971.5010 971.5036 R V 10 20 PSM AGFAGDDAPR 2632 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6984.5 78.72097 2 975.4480 975.4410 K A 19 29 PSM LEALDANSR 2633 sp|P09496-2|CLCA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7279.10 86.67892 2 987.4990 987.4985 R K 121 130 PSM NIGVDNPAAK 2634 sp|P78371-2|TCPB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6976.7 78.50518 2 997.5180 997.5192 K V 26 36 PSM NLINQTTAK 2635 sp|Q9Y6D6|BIG1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7083.9 81.3823 2 1001.5508 1001.5505 K A 187 196 PSM LITEDVQGK 2636 sp|P61247|RS3A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7295.8 87.11478 2 1001.5386 1001.5393 K N 86 95 PSM SLDQAINDK 2637 sp|Q9UQE7|SMC3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7268.10 86.37532 2 1002.4978 1002.4982 K K 401 410 PSM GRYEITAEDSQEK 2638 sp|Q9H814|PHAX_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7097.7 81.75999 3 1524.7096 1524.7056 K V 217 230 PSM SSFTVDCSK 2639 sp|P21333-2|FLNA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 7-UNIMOD:4 ms_run[1]:scan=1.1.7107.9 82.03535 2 1029.4424 1029.4437 K A 2568 2577 PSM DCAVIVTQK 2640 sp|P60900|PSA6_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 2-UNIMOD:4 ms_run[1]:scan=1.1.7046.8 80.38582 2 1032.5268 1032.5274 K K 46 55 PSM NNFEGEVTK 2641 sp|P07237|PDIA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7142.9 82.97778 2 1036.4818 1036.4825 R E 214 223 PSM YESLTDPSK 2642 sp|P07900-2|HS90A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7267.6 86.34123 2 1038.4844 1038.4869 R L 183 192 PSM YESLTDPSK 2643 sp|P07900-2|HS90A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7229.8 85.30405 2 1038.4844 1038.4869 R L 183 192 PSM YESLTDPSK 2644 sp|P07900-2|HS90A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7248.9 85.82502 2 1038.4844 1038.4869 R L 183 192 PSM SGGAVEPLGTR 2645 sp|O75312|ZPR1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7051.11 80.52744 2 1042.5320 1042.5407 K I 300 311 PSM GGVTEISAADK 2646 sp|Q9NQW7-3|XPP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7044.7 80.32972 2 1046.5202 1046.5244 K A 398 409 PSM ALEEAMEQK 2647 sp|P35579|MYH9_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7208.6 84.73292 2 1047.4914 1047.4906 R A 1484 1493 PSM STCIYGGAPK 2648 sp|Q92841-1|DDX17_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 3-UNIMOD:4 ms_run[1]:scan=1.1.7171.9 83.74805 2 1052.4962 1052.4961 K G 196 206 PSM EATNPPVIQEEKPK 2649 sp|P30101|PDIA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7229.9 85.30572 3 1578.8248 1578.8253 R K 483 497 PSM AANGVVLATEK 2650 sp|P25787|PSA2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7278.9 86.64977 2 1071.5922 1071.5924 K K 40 51 PSM DGGAWGTEQR 2651 sp|P09382|LEG1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7163.10 83.54324 2 1075.4660 1075.4683 K E 65 75 PSM FAQTLQQSR 2652 sp|P55072|TERA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1000663, ProteinPilot, ] 20 ms_run[1]:scan=1.1.6960.10 78.07513 2 1077.5560470956602 1077.5567067706502 M G 758 767 PSM LIEVDDERK 2653 sp|P62753|RS6_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6929.8 77.23698 2 1115.5824 1115.5822 K L 15 24 PSM DNQLSEVANK 2654 sp|Q14978-2|NOLC1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7302.9 87.30782 2 1116.5418 1116.5411 R F 24 34 PSM STTTGHLIYK 2655 sp|Q5VTE0|EF1A3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6924.5 77.09938 3 1119.5926 1119.5924 K C 21 31 PSM DAMQYASESK 2656 sp|Q00610-2|CLH1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7259.10 86.12817 2 1128.4744 1128.4757 K D 1536 1546 PSM IANPVEGSTDR 2657 sp|Q15366-2|PCBP2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7175.9 83.85155 2 1157.5680 1157.5677 K Q 324 335 PSM IANPVEGSTDR 2658 sp|Q15366-2|PCBP2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7194.9 84.3571 2 1157.5680 1157.5677 K Q 324 335 PSM ITPAHDQNDYEVGQR 2659 sp|P26640|SYVC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7174.11 83.82893 3 1741.8034 1741.8020 K H 592 607 PSM PALPAGTEDTAK 2660 sp|P06396-2|GELS_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7078.11 81.24957 2 1169.5926 1169.5928 K E 227 239 PSM EDKYEEEIK 2661 sp|P06753-2|TPM3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7019.8 79.66386 3 1181.5444 1181.5452 K L 182 191 PSM DLEADEEDTR 2662 sp|P20042|IF2B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7151.10 83.22577 2 1191.4896 1191.4891 K K 53 63 PSM HPQPGAVELAAK 2663 sp|P27708|PYR1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7105.10 81.98267 2 1216.6560 1216.6564 R H 2025 2037 PSM VELAEEDDGEK 2664 sp|Q9H4A3-2|WNK1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6935.11 77.40337 2 1232.5482 1232.5408 R I 487 498 PSM MDATANDVPSDR 2665 sp|P13667|PDIA4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 1-UNIMOD:35 ms_run[1]:scan=1.1.6958.10 78.0217 2 1306.5458 1306.5459 K Y 583 595 PSM ILQEDPTNTAAR 2666 sp|Q15006|EMC2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7226.11 85.22743 2 1327.6742 1327.6732 R K 113 125 PSM SEDDESGAGELTR 2667 sp|P33993|MCM7_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6925.11 77.13578 2 1364.5688 1364.5692 K E 309 322 PSM AQAAAPASVPAQAPK 2668 sp|P47914|RL29_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7056.11 80.66358 2 1376.7436 1376.7412 K R 135 150 PSM ELEEEAEEEQR 2669 sp|Q9H2J4|PDCL3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7172.11 83.77713 2 1389.5918 1389.5895 K I 28 39 PSM VTAIHIDPATHR 2670 sp|P49327|FAS_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7617.2 95.71512 4 1329.7125 1329.7153 R Q 1052 1064 PSM MADLHAVPR 2671 sp|Q14195-2|DPYL3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7642.2 96.39775 3 1008.5149 1008.5175 K G 602 611 PSM SLQSVAEER 2672 sp|P61313|RL15_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1000663, ProteinPilot, ] 20 ms_run[1]:scan=1.1.7609.2 95.50142 3 1017.5268706434902 1017.5090878718898 R A 97 106 PSM DANNGNLQLR 2673 sp|P05455|LA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7480.3 91.99406 3 1113.5506 1113.5527 K N 288 298 PSM REATADDLIK 2674 sp|Q16531|DDB1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7511.3 92.83935 3 1130.5909 1130.5931 K V 1122 1132 PSM ICSKPVVLPK 2675 sp|P78527|PRKDC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 2-UNIMOD:4 ms_run[1]:scan=1.1.7685.2 97.5734 3 1139.6641 1139.6736 R G 490 500 PSM AQLGLGHSYSR 2676 sp|O00567|NOP56_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7627.4 95.9907 3 1187.5939 1187.6047 K A 144 155 PSM RDVSLGTYGSR 2677 sp|Q9C0C2|TB182_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7566.6 94.34478 3 1209.5989 1209.6102 K A 933 944 PSM GASQAGMLAPGTR 2678 sp|Q15417|CNN3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7583.3 94.80576 3 1215.5998 1215.6030 K R 213 226 PSM TTHFVEGGDAGNREDQINR 2679 sp|P18124|RL7_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7502.5 92.59807 5 2114.9646 2114.9730 K L 224 243 PSM QEPERNECFLQHK 2680 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 8-UNIMOD:4 ms_run[1]:scan=1.1.7318.6 87.7399 4 1713.7897 1713.7893 K D 118 131 PSM SQLLGSAHEVQR 2681 sp|Q13813|SPTN1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7339.5 88.30497 3 1323.6832 1323.6895 R F 1226 1238 PSM SQLLGSAHEVQR 2682 sp|Q13813|SPTN1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7340.9 88.3381 3 1323.6832 1323.6895 R F 1226 1238 PSM QPSLHMSAAAASR 2683 sp|O94776|MTA2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7490.5 92.27123 3 1325.6470 1325.6510 R D 215 228 PSM RLAPEYEAAATR 2684 sp|P30101|PDIA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7604.5 95.3739 3 1346.6932 1346.6942 K L 62 74 PSM SPDTILQK 2685 sp|P20042|IF2B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7368.7 89.07793 2 900.4886 900.4916 R D 286 294 PSM APTNIVYK 2686 sp|P15927-3|RFA2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7335.7 88.20216 2 904.5004 904.5018 K I 174 182 PSM VQAVVAVAR 2687 sp|Q01082-3|SPTB2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7325.8 87.93449 2 911.5556 911.5553 R E 465 474 PSM AAILETAPK 2688 sp|Q9P2E9|RRBP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7546.5 93.7955 2 912.5264 912.5280 K E 167 176 PSM SDPVVSYR 2689 sp|P13639|EF2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7367.7 89.05125 2 921.4550 921.4556 K E 573 581 PSM TLVGICSEHQSR 2690 sp|Q9H3U1-2|UN45A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 6-UNIMOD:4 ms_run[1]:scan=1.1.7407.3 90.07558 3 1385.6671 1385.6722 R T 203 215 PSM LREDENAEPVGTTYQK 2691 sp|Q16643-3|DREB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7359.9 88.842 4 1848.8833 1848.8853 R T 150 166 PSM DDLSGADIK 2692 sp|P62191|PRS4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7498.7 92.49277 2 932.4446 932.4451 K A 388 397 PSM YLAEVACGDDRK 2693 sp|P27348|1433T_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 7-UNIMOD:4 ms_run[1]:scan=1.1.7399.6 89.87524 3 1395.6463 1395.6452 R Q 128 140 PSM ISAVSVAER 2694 sp|Q08211|DHX9_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7530.5 93.3594 2 930.5108 930.5134 R V 448 457 PSM VCNPIITK 2695 sp|P11142|HSP7C_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 2-UNIMOD:4 ms_run[1]:scan=1.1.7621.7 95.83185 2 943.5120 943.5161 K L 602 610 PSM ASSLIEEAK 2696 sp|Q9Y490|TLN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7508.8 92.76601 2 946.4926 946.4971 K K 1162 1171 PSM TIDDLEDK 2697 sp|P06753-2|TPM3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7357.4 88.78053 2 947.4444 947.4447 K L 216 224 PSM SIRPDNMSEYSK 2698 sp|Q92769|HDAC2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7695.7 97.85335 3 1425.6547 1425.6558 R Q 79 91 PSM IDNLDVNR 2699 sp|O75475|PSIP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7459.6 91.42889 2 957.4864 957.4879 K C 365 373 PSM IDNLDVNR 2700 sp|O75475|PSIP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7452.5 91.24263 2 957.4864 957.4879 K C 365 373 PSM CAADLGLNK 2701 sp|P49773|HINT1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 1-UNIMOD:4 ms_run[1]:scan=1.1.7541.8 93.66393 2 960.4686 960.4698 K G 84 93 PSM TDAVDSVVR 2702 sp|Q7KZF4|SND1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7602.8 95.32602 2 960.4870 960.4876 R D 811 820 PSM NSALSAQLR 2703 sp|P47897-2|SYQ_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7688.6 97.6615 2 958.5168 958.5196 K E 26 35 PSM MRAEDGENYDIK 2704 sp|O75347|TBCA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7562.7 94.23682 3 1439.6350 1439.6351 K K 40 52 PSM YICENQDSISSK 2705 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 3-UNIMOD:4 ms_run[1]:scan=1.1.7343.11 88.42087 3 1442.6365 1442.6347 K L 287 299 PSM KVVVYLQK 2706 sp|P53634|CATC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7425.8 90.5504 2 975.6108 975.6117 K L 63 71 PSM FLSSAAAVSK 2707 sp|P27708|PYR1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7685.7 97.58173 2 979.5322 979.5338 R E 1110 1120 PSM SPSLLQSGAK 2708 sp|Q9BQG0-2|MBB1A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7513.9 92.90383 2 986.5394 986.5396 R K 1308 1318 PSM TVAELEAEK 2709 sp|Q13423|NNTM_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7406.9 90.05967 2 988.5052 988.5077 K A 454 463 PSM AQSLLSTDR 2710 sp|O00231-2|PSD11_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7704.9 98.1008 2 989.5116 989.5142 R E 12 21 PSM LVQTAELTK 2711 sp|P60983|GMFB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7486.9 92.1683 2 1001.5736 1001.5757 K V 111 120 PSM VLNTNIDGR 2712 sp|P62269|RS18_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7546.8 93.8005 2 1000.5298 1000.5302 R R 15 24 PSM GGGALSAVAATK 2713 sp|P61011|SRP54_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7644.8 96.46239 2 1001.5486 1001.5506 K S 256 268 PSM DAHLLVESK 2714 sp|P42704|LPPRC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7390.5 89.64449 2 1010.5382 1010.5396 K N 641 650 PSM GGEIQPVSVK 2715 sp|P61604|CH10_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7439.11 90.91555 2 1012.5528 1012.5553 K V 57 67 PSM QGANINEIR 2716 sp|Q15365|PCBP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7330.7 88.0683 2 1013.5250 1013.5254 R Q 298 307 PSM TLGQAEALDK 2717 sp|P27144|KAD4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7544.7 93.74429 2 1044.5444 1044.5451 R I 93 103 PSM FQDELESGK 2718 sp|O15042-2|SR140_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7675.7 97.30895 2 1051.4808 1051.4822 K R 853 862 PSM IEQVDKEDEITEK 2719 sp|Q9Y2X3|NOP58_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7424.6 90.52143 3 1574.7670 1574.7675 K K 445 458 PSM DLTTGYDDSQPDKK 2720 sp|Q96G03|PGM2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7467.11 91.65356 3 1581.7150 1581.7159 R A 520 534 PSM AEAAVVAVAEK 2721 sp|Q8IZQ5|SELH_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7670.10 97.1763 2 1056.5800 1056.5815 K R 10 21 PSM QPDSGISSIR 2722 sp|P04843|RPN1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7607.9 95.46011 2 1058.5334 1058.5356 R S 269 279 PSM LQELSAEER 2723 sp|Q9NTK5|OLA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7349.9 88.57645 2 1073.5444 1073.5353 K Q 271 280 PSM AQYEDIANR 2724 sp|P05787-2|K2C8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7446.9 91.0931 2 1078.5042 1078.5043 K S 293 302 PSM EISQDSLAAR 2725 sp|Q07157-2|ZO1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7449.7 91.16779 2 1088.5436 1088.5462 K D 210 220 PSM LQEALEDER 2726 sp|Q9UH65|SWP70_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7417.10 90.34908 2 1101.5320 1101.5302 K Q 429 438 PSM LETELDEEK 2727 sp|Q9P2M7|CING_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7480.9 92.00407 2 1104.5254 1104.5186 R N 968 977 PSM RAEFTVETR 2728 sp|P21333-2|FLNA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7316.9 87.69028 2 1107.5650 1107.5673 K S 301 310 PSM DANNGNLQLR 2729 sp|P05455|LA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7477.10 91.92387 2 1113.5498 1113.5527 K N 288 298 PSM GMGPGTPAGYGR 2730 sp|P23246|SFPQ_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7654.8 96.73468 2 1119.5116 1119.5131 R G 682 694 PSM DLDTGEEVTR 2731 sp|Q14166|TTL12_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7379.11 89.37376 2 1133.5246 1133.5201 R D 231 241 PSM ELADESQTLK 2732 sp|Q9UNZ2-4|NSF1C_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7399.10 89.8819 2 1132.5584 1132.5612 K E 316 326 PSM QLIVANAGDSR 2733 sp|O15355|PPM1G_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7692.9 97.77513 2 1142.6020 1142.6044 K C 340 351 PSM YIDQEELNK 2734 sp|P07900-2|HS90A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7709.10 98.23922 2 1150.5504 1150.5506 K T 406 415 PSM ILDYSCSQDRDTQK 2735 sp|Q93008-1|USP9X_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 6-UNIMOD:4 ms_run[1]:scan=1.1.7494.11 92.39046 3 1727.7787 1727.7785 K I 535 549 PSM NSDEADLVPAK 2736 sp|P83916|CBX1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7634.9 96.19083 2 1157.5554 1157.5564 K E 140 151 PSM TVEVAEGEAVR 2737 sp|Q86UE4|LYRIC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7438.10 90.88811 2 1158.5856 1158.5881 R T 132 143 PSM FFQEENTEK 2738 sp|O00232|PSD12_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7449.10 91.17278 2 1170.5204 1170.5193 K L 213 222 PSM EDSNLTLQEK 2739 sp|P46940|IQGA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7367.10 89.05625 2 1175.5674 1175.5670 K K 1446 1456 PSM FDDGDVTECK 2740 sp|Q93008-1|USP9X_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 9-UNIMOD:4 ms_run[1]:scan=1.1.7460.9 91.46078 2 1184.4620 1184.4656 K M 1900 1910 PSM QAQILASEAEK 2741 sp|Q9UJZ1-2|STML2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7435.11 90.81237 2 1186.6172 1186.6193 K A 178 189 PSM DQNTVETLQR 2742 sp|Q01082-3|SPTB2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7370.10 89.13654 2 1202.5894 1202.5891 R M 1822 1832 PSM TIVEAASDEER 2743 sp|Q9NWY4|HPF1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7389.6 89.62908 2 1218.5728 1218.5728 K L 254 265 PSM LRDTEEMLSK 2744 sp|Q9H444|CHM4B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7530.3 93.35606 3 1220.6062 1220.6071 R K 29 39 PSM KEEELQGALAR 2745 sp|P35580-3|MYH10_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7653.11 96.71246 2 1242.6570 1242.6568 K G 1109 1120 PSM INISEGNCPER 2746 sp|Q15365|PCBP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 8-UNIMOD:4 ms_run[1]:scan=1.1.7516.11 92.98878 2 1287.5852 1287.5877 R I 47 58 PSM NVESGEEELASK 2747 sp|Q96HS1-2|PGAM5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7487.11 92.19891 2 1290.5946 1290.5939 R L 77 89 PSM EAPPMEKPEVVK 2748 sp|P62841|RS15_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7570.11 94.46304 2 1352.6976 1352.7010 K T 66 78 PSM EGATVYATGTHAQVEDGR 2749 sp|P32322-3|P5CR1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7634.10 96.1925 3 1860.8575 1860.8602 R L 157 175 PSM TTHFVEGGDAGNREDQINR 2750 sp|P18124|RL7_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7496.11 92.44505 3 2114.9683 2114.9730 K L 224 243 PSM VKPLLQVSR 2751 sp|P35579|MYH9_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8108.3 109.0127 3 1038.6529 1038.6550 K Q 834 843 PSM KIPDTVLEK 2752 sp|P78527|PRKDC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7974.4 105.4383 3 1041.5953 1041.6070 K V 165 174 PSM FLQEHLAPK 2753 sp|P26440|IVD_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7975.2 105.4623 3 1081.5916 1081.5920 K A 59 68 PSM SNYNLPMHK 2754 sp|P36578|RL4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7856.6 102.2056 3 1102.5196 1102.5229 K M 275 284 PSM TLLADKGEIR 2755 sp|Q13330|MTA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7940.3 104.5054 3 1114.6315 1114.6346 K V 159 169 PSM IGAEVYHNLK 2756 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8021.2 106.717 3 1142.6008 1142.6084 R N 184 194 PSM KFTNAVTLQQHVR 2757 sp|Q9Y467|SALL2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8096.3 108.6947 4 1540.8409 1540.8474 K M 699 712 PSM EAIHSQLLEK 2758 sp|O60925|PFD1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7901.4 103.4386 3 1166.6257 1166.6295 K Q 74 84 PSM AAHLCAEAALR 2759 sp|Q9UQ80|PA2G4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 5-UNIMOD:4 ms_run[1]:scan=1.1.7758.3 99.5649 3 1181.5945 1181.5975 K L 145 156 PSM VPQIEVETHK 2760 sp|Q14204|DYHC1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7739.4 99.04926 3 1178.6266 1178.6295 K V 2552 2562 PSM AILQNHTDFK 2761 sp|Q86X55-1|CARM1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7984.4 105.7105 3 1185.6124 1185.6142 R D 175 185 PSM RIIDDSEITK 2762 sp|Q96A72|MGN2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1000663, ProteinPilot, ] 20 ms_run[1]:scan=1.1.7870.2 102.5834 3 1188.6525706434902 1188.635016661 K E 64 74 PSM RQELEAELAK 2763 sp|Q15149|PLEC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7720.4 98.52977 3 1185.6301 1185.6353 K V 1887 1897 PSM VTVAGLAGK 2764 sp|Q99497|PARK7_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8063.6 107.8498 2 814.4892 814.4913 K D 33 42 PSM LREYEAALNSK 2765 sp|P20700|LMNB1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7836.4 101.6553 3 1292.6683 1292.6724 K D 135 146 PSM HRPELIEYDK 2766 sp|O43707|ACTN4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7809.3 100.9195 3 1298.6578 1298.6619 R L 205 215 PSM AGVENGKPTHFTVYTK 2767 sp|O75369-2|FLNB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8047.5 107.4292 4 1747.8849 1747.8893 K G 858 874 PSM SSVINSIR 2768 sp|Q5T7N2|LITD1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7919.3 103.9302 2 874.4846 874.4872 R E 619 627 PSM KAEEVQAWAQR 2769 sp|Q9BYN8|RT26_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7937.2 104.4215 3 1314.6673 1314.6680 R K 142 153 PSM FHHTFSTEIAK 2770 sp|P13667|PDIA4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7856.7 102.2073 3 1316.6500 1316.6513 K F 336 347 PSM TGAQELLR 2771 sp|P06396-2|GELS_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7957.5 104.9746 2 886.4878 886.4872 K V 565 573 PSM QELSHALYQHDAACR 2772 sp|Q9UMS4|PRP19_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 14-UNIMOD:4 ms_run[1]:scan=1.1.7943.4 104.5889 4 1797.8193 1797.8216 R V 101 116 PSM SGEVLVNVK 2773 sp|Q13347|EIF3I_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8105.5 108.9351 2 943.5306 943.5338 K E 177 186 PSM AACNLLQR 2774 sp|Q01813-2|PFKAP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 3-UNIMOD:4 ms_run[1]:scan=1.1.7956.6 104.9487 2 944.4844 944.4862 K G 102 110 PSM LDDLVSTGK 2775 sp|Q92499-3|DDX1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7866.8 102.4831 2 946.4918 946.4971 R L 222 231 PSM EVDGLDVSK 2776 sp|Q14204|DYHC1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7833.7 101.5785 2 960.4736 960.4764 K E 532 541 PSM EFHLNESGDPSSK 2777 sp|Q01105-2|SET_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8057.6 107.6948 3 1445.6413 1445.6423 K S 142 155 PSM SCQFVAVR 2778 sp|P07814|SYEP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 2-UNIMOD:4 ms_run[1]:scan=1.1.8077.7 108.2107 2 965.4736 965.4753 K R 1376 1384 PSM SGTSEFLNK 2779 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7765.7 99.75353 2 981.4746 981.4767 K M 169 178 PSM MAPTPIPTR 2780 sp|Q16643-3|DREB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7864.6 102.4248 2 982.5234 982.5270 R S 374 383 PSM IEANEALVK 2781 sp|P30049|ATPD_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7818.6 101.1694 2 985.5422 985.5444 R A 157 166 PSM VVGSEFVQK 2782 sp|P43686|PRS6B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8095.7 108.6754 2 991.5298 991.5339 R Y 230 239 PSM ERHPGSFDVVHVK 2783 sp|P62701|RS4X_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7969.9 105.3104 3 1505.7706 1505.7739 R D 199 212 PSM ILNDDTALK 2784 sp|P54727|RD23B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7991.9 105.9093 2 1001.5364 1001.5393 K E 52 61 PSM VVDTLYDGK 2785 sp|Q9UDY2-7|ZO2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8027.6 106.8888 2 1008.5122 1008.5128 R L 664 673 PSM QFAPEYEK 2786 sp|P13667|PDIA4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7876.7 102.7572 2 1010.4672 1010.4709 K I 96 104 PSM ASAVSELSPR 2787 sp|Q9Y2W1|TR150_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7854.9 102.1556 2 1015.5278 1015.5298 R E 236 246 PSM NCLALADDK 2788 sp|O75367-3|H2AY_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 2-UNIMOD:4 ms_run[1]:scan=1.1.7794.6 100.5165 2 1018.4740 1018.4753 K K 295 304 PSM DSFIGENSR 2789 sp|Q99661|KIF2C_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7857.7 102.2346 2 1023.4612 1023.4621 R T 550 559 PSM ADLAEEYSK 2790 sp|P68036|UB2L3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7742.8 99.13802 2 1024.4708 1024.4713 R D 123 132 PSM GTVVTGTLER 2791 sp|P49411|EFTU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7729.9 98.784 2 1031.5588 1031.5611 R G 272 282 PSM GLSSDLEGEK 2792 sp|Q02952-2|AKA12_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7985.11 105.7494 2 1033.5066 1033.4928 K T 1397 1407 PSM AGITTTLNSR 2793 sp|P33992|MCM5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7829.9 101.4729 2 1032.5536 1032.5564 K C 472 482 PSM LAQGLTHLGK 2794 sp|Q13200|PSMD2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7773.8 99.96391 2 1036.5966 1036.6029 R G 764 774 PSM VDEVPDGAVKPPTNK 2795 sp|O75475|PSIP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7844.7 101.8788 3 1564.8073 1564.8097 R L 25 40 PSM ADLSAMSAER 2796 sp|P50453|SPB9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8021.10 106.7303 2 1049.4796 1049.4811 K D 298 308 PSM GVNTFSPEGR 2797 sp|P28066|PSA5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7732.7 98.86279 2 1062.5064 1062.5094 R L 11 21 PSM AVDDGVNTFK 2798 sp|P50990|TCPQ_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8104.9 108.9151 2 1064.5128 1064.5139 R V 391 401 PSM SLGPSLATDKS 2799 sp|Q9H3N1|TMX1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8075.8 108.1611 2 1074.5536 1074.5557 R - 270 281 PSM YLAEVATGEK 2800 sp|P61981|1433G_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7879.8 102.8413 2 1079.5482 1079.5499 R R 133 143 PSM EQVYDAMGEKEEAK 2801 sp|P49321|NASP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7803.6 100.7609 3 1625.7364 1625.7243 R K 145 159 PSM GTEVQVDDIK 2802 sp|Q9Y230-2|RUVB2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8026.10 106.8679 2 1102.5494 1102.5506 K R 373 383 PSM YDDMAACMK 2803 sp|P63104|1433Z_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 7-UNIMOD:4 ms_run[1]:scan=1.1.8065.8 107.9046 2 1103.4048 1103.4086 R S 19 28 PSM VLSQQAASVVK 2804 sp|P30566|PUR8_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7719.11 98.51418 2 1128.6486 1128.6503 R Q 405 416 PSM LLQQEEEIK 2805 sp|P54136|SYRC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7982.7 105.6612 2 1128.6012 1128.6026 R S 12 21 PSM YDDMATCMK 2806 sp|P27348|1433T_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 7-UNIMOD:4 ms_run[1]:scan=1.1.7858.10 102.2669 2 1133.4180 1133.4191 R A 19 28 PSM GNLGVYQETR 2807 sp|O95400|CD2B2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7853.8 102.1266 2 1135.5544 1135.5622 R E 213 223 PSM MSISEGTVSDK 2808 sp|P46821|MAP1B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8025.7 106.8354 2 1152.5310 1152.5332 K S 1519 1530 PSM GDIIGVQGNPGK 2809 sp|Q15046-2|SYK_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8105.7 108.9385 2 1153.6072 1153.6091 R T 207 219 PSM IVGPSGAAVPCK 2810 sp|P21333-2|FLNA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 11-UNIMOD:4 ms_run[1]:scan=1.1.7766.10 99.78465 2 1154.6086 1154.6118 K V 1008 1020 PSM NLDDGIDDER 2811 sp|P11940-2|PABP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7973.11 105.4227 2 1160.4940 1160.4946 K L 300 310 PSM SSENPNEVFR 2812 sp|P45974-2|UBP5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8016.11 106.5945 2 1177.5372 1177.5363 R F 453 463 PSM GPVKPTGGPGGGGTQTQQQMNQLK 2813 sp|P26196|DDX6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7871.10 102.6242 4 2365.1721 2365.1809 R N 23 47 PSM LAPEYEAAATR 2814 sp|P30101|PDIA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7881.11 102.9012 2 1190.5910 1190.5931 R L 63 74 PSM SEMTPEELQK 2815 sp|P62316|SMD2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7919.10 103.9418 2 1190.5466 1190.5489 K R 9 19 PSM MDYEDDRLR 2816 sp|P43243|MATR3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8060.4 107.7689 3 1211.5216 1211.5241 R D 217 226 PSM YHDIEPGAVVK 2817 sp|Q14690|RRP5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8097.3 108.7207 3 1226.6224 1226.6295 R G 447 458 PSM LQTLVSEQPNK 2818 sp|Q86UP2|KTN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8011.10 106.4557 2 1255.6754 1255.6772 K D 717 728 PSM LLQAVENGDAEK 2819 sp|Q9P0K7-3|RAI14_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7836.11 101.667 2 1285.6432 1285.6514 R V 15 27 PSM LKEELSEVETK 2820 sp|Q15075|EEA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7879.4 102.8347 3 1303.6795 1303.6871 K Y 377 388 PSM GGGPAGAGGEAPAALR 2821 sp|Q5RKV6|EXOS6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7841.8 101.7984 2 1307.6570 1307.6582 R G 78 94 PSM EGNPEEDLTADK 2822 sp|P40121-2|CAPG_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7956.11 104.9571 2 1316.5738 1316.5732 K A 217 229 PSM SFAANGIQAHPESSTGSDAR 2823 sp|Q5QJE6|TDIF2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7943.10 104.5989 3 2001.9076 2001.9140 K T 25 45 PSM IYIDSNNNPER 2824 sp|Q00610-2|CLH1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7769.10 99.86246 2 1333.6234 1333.6262 K F 882 893 PSM VQEQLGNDVVEK 2825 sp|O15305|PMM2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7968.11 105.2863 2 1356.6878 1356.6885 K Y 52 64 PSM SEPIPESNDGPVK 2826 sp|P30101|PDIA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7781.6 100.169 3 1367.6545 1367.6569 K V 367 380 PSM YTAESSDTLCPR 2827 sp|Q9NSE4|SYIM_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 10-UNIMOD:4 ms_run[1]:scan=1.1.7722.11 98.59593 2 1398.6166 1398.6085 K C 993 1005 PSM AVANYDSVEEGEK 2828 sp|P51659-2|DHB4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7756.9 99.52345 2 1409.6300 1409.6310 K V 94 107 PSM QQNQELQEQLR 2829 sp|Q14980|NUMA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7943.11 104.6006 2 1412.6998 1412.7008 K S 1626 1637 PSM ETYGEMADCCAK 2830 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 9-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.7958.11 105.0121 2 1433.5254 1433.5261 R Q 106 118 PSM NDAPTPGTSTTPGLR 2831 sp|Q04726-4|TLE3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7788.11 100.3622 2 1483.7288 1483.7267 R S 329 344 PSM ELNNTCEPVVTQPK 2832 sp|Q92598-4|HS105_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 6-UNIMOD:4 ms_run[1]:scan=1.1.8112.11 109.1347 2 1627.7886 1627.7876 K P 793 807 PSM GHQQLYWSHPR 2833 sp|P62273-2|RS29_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8295.2 114.0978 4 1407.6749 1407.6796 M K 2 13 PSM RVATPVDWK 2834 sp|P30041|PRDX6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8486.2 119.2788 3 1070.5849 1070.5873 K D 174 183 PSM ALAAGGYDVEK 2835 sp|P16401|H15_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8142.4 109.9403 3 1092.5416 1092.5451 K N 68 79 PSM LIDREIISHDTR 2836 sp|P00387-2|NB5R3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8368.3 116.0759 4 1466.7849 1466.7841 R R 24 36 PSM LQLEIDQKK 2837 sp|Q9Y266|NUDC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8471.2 118.8697 3 1113.6349 1113.6393 R D 115 124 PSM KPGDLSDELR 2838 sp|Q13435|SF3B2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8184.2 111.0813 3 1128.5752 1128.5775 K I 605 615 PSM GGDLMAYDRR 2839 sp|P61978|HNRPK_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8148.2 110.1004 3 1152.5332 1152.5346 R G 317 327 PSM GEFVTTVQQR 2840 sp|P40925-3|MDHC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8184.3 111.0829 3 1163.5915 1163.5935 K G 239 249 PSM GCHLLVATPGR 2841 sp|O00571-2|DDX3X_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 2-UNIMOD:4 ms_run[1]:scan=1.1.8205.2 111.6505 3 1179.6163 1179.6183 R L 300 311 PSM ALVDGPCTQVR 2842 sp|P50914|RL14_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 7-UNIMOD:4 ms_run[1]:scan=1.1.8371.3 116.1581 3 1214.6068 1214.6078 R R 36 47 PSM LVVDSHVQYR 2843 sp|Q6P2Q9|PRP8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8244.4 112.7165 3 1214.6365 1214.6408 K L 556 566 PSM LVVDSHVQYR 2844 sp|Q6P2Q9|PRP8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8243.4 112.689 3 1214.6365 1214.6408 K L 556 566 PSM LVVDSHVQYR 2845 sp|Q6P2Q9|PRP8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8245.5 112.7456 3 1214.6365 1214.6408 K L 556 566 PSM LVVDSHVQYR 2846 sp|Q6P2Q9|PRP8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8242.5 112.6631 3 1214.6365 1214.6408 K L 556 566 PSM LVVDSHVQYR 2847 sp|Q6P2Q9|PRP8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8246.5 112.7732 3 1214.6365 1214.6408 K L 556 566 PSM NVQLQENEIR 2848 sp|P36873-2|PP1G_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8483.4 119.2005 3 1241.6341 1241.6364 K G 27 37 PSM EQVANSAFVER 2849 sp|P08238|HS90B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8206.7 111.6859 3 1248.6061 1248.6098 K V 492 503 PSM DLVKPGDENLR 2850 sp|Q4V328-4|GRAP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8179.3 110.9465 3 1254.6457 1254.6568 R E 748 759 PSM RNPDTQWITK 2851 sp|P61313|RL15_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8271.3 113.4527 3 1257.6442 1257.6466 R P 144 154 PSM KTGCNVLLIQK 2852 sp|P50991|TCPD_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 4-UNIMOD:4 ms_run[1]:scan=1.1.8446.4 118.1878 3 1272.7165 1272.7224 K S 292 303 PSM NGVPAVGLK 2853 sp|P53621-2|COPA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8251.3 112.9071 2 853.5014 853.5022 K L 1003 1012 PSM VNELREELQR 2854 sp|Q9BUJ2-2|HNRL1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8381.3 116.4328 3 1284.6775 1284.6786 K R 8 18 PSM VGELKDDDFEK 2855 sp|Q02750-2|MP2K1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8188.4 111.1938 3 1293.6034 1293.6089 K I 60 71 PSM DPNIVIAK 2856 sp|P30101|PDIA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8164.5 110.5404 2 868.5008 868.5018 K M 426 434 PSM DPNIVIAK 2857 sp|P30101|PDIA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8183.6 111.0607 2 868.5010 868.5018 K M 426 434 PSM NASDMPETITSR 2858 sp|Q8TCT9-2|HM13_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8449.4 118.2701 3 1320.5950 1320.5980 K D 62 74 PSM AAECNIVVTQPR 2859 sp|Q08211|DHX9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 4-UNIMOD:4 ms_run[1]:scan=1.1.8241.6 112.6374 3 1356.6808 1356.6820 R R 435 447 PSM ADQDRLDLEER 2860 sp|Q14683|SMC1A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8134.8 109.7291 3 1358.6404 1358.6426 K K 402 413 PSM VGAAEIISR 2861 sp|O75533|SF3B1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8249.7 112.859 2 914.5162 914.5185 K I 844 853 PSM QFVPAVEK 2862 sp|Q96RP9-2|EFGM_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8293.6 114.0509 2 916.4974 916.5018 K G 600 608 PSM LSIVPVRR 2863 sp|P15880|RS2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8436.2 117.9122 3 938.6002 938.6025 K G 160 168 PSM GINVALANGK 2864 sp|Q92520|FAM3C_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8429.6 117.729 2 955.5432 955.5451 R T 103 113 PSM YELISETGGSHDK 2865 sp|Q12906-7|ILF3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8157.5 110.35 3 1434.6616 1434.6627 K R 545 558 PSM TGTVSLEVR 2866 sp|P49327|FAS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8259.7 113.1329 2 960.5210 960.5240 K L 928 937 PSM RSENEEFVEVGR 2867 sp|P10644|KAP0_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1000663, ProteinPilot, ] 20 ms_run[1]:scan=1.1.8465.7 118.7141 3 1449.69247064349 1449.68482038773 R L 306 318 PSM VVGSELIQK 2868 sp|P62191|PRS4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8439.7 118.0019 2 971.5536 971.5651 R Y 250 259 PSM ATAVVDGAFK 2869 sp|P32119|PRDX2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8357.5 115.7787 2 977.5170 977.5182 K E 17 27 PSM YATLATVSR 2870 sp|Q14204|DYHC1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8173.10 110.7944 2 980.5282 980.5291 K C 2350 2359 PSM LAQLITQAK 2871 sp|Q9NXE4-2|NSMA3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8467.6 118.7671 2 984.5914 984.5968 R H 567 576 PSM GEALSALDSK 2872 sp|O75396|SC22B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8221.8 112.0943 2 989.5018 989.5029 R A 160 170 PSM NGDGTIDFR 2873 sp|P62760|VISL1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8491.7 119.423 2 993.4602 993.4516 K E 75 84 PSM DIDIHEVR 2874 sp|Q00839|HNRPU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8272.6 113.4847 2 995.5006 995.5036 K I 353 361 PSM YALTGDEVK 2875 sp|P62701|RS4X_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8170.8 110.7093 2 994.4962 994.4971 K K 54 63 PSM RVNAIEEVNNNVK 2876 sp|Q9UJY5-6|GGA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8158.8 110.3821 3 1497.7852 1497.7899 K L 231 244 PSM NQGIEEALK 2877 sp|P18206|VINC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8179.8 110.9548 2 1000.5176 1000.5189 K N 220 229 PSM YDDMAAAMK 2878 sp|P31946-2|1433B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8223.6 112.1453 2 1014.4136 1014.4150 R A 19 28 PSM GLVSSDELAK 2879 sp|Q13813|SPTN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8457.8 118.4958 2 1017.5320 1017.5342 R D 1360 1370 PSM ELSDLESAR 2880 sp|P27708|PYR1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8285.6 113.8361 2 1018.4990 1018.4931 R Q 1067 1076 PSM DLPEHAVLK 2881 sp|Q00839|HNRPU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8126.9 109.5126 2 1020.5576 1020.5604 K M 627 636 PSM TAVCDIPPR 2882 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 4-UNIMOD:4 ms_run[1]:scan=1.1.8241.8 112.6407 2 1027.5008 1027.5121 K G 351 360 PSM DINAYNCEEPTEK 2883 sp|P30041|PRDX6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 7-UNIMOD:4 ms_run[1]:scan=1.1.8156.8 110.3278 3 1581.6580 1581.6617 K L 85 98 PSM GHQQLYWSHPR 2884 sp|P62273-2|RS29_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8201.2 111.5428 4 1407.6765 1407.6796 M K 2 13 PSM DSEEAEIIR 2885 sp|P09874|PARP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8361.9 115.8945 2 1060.5024 1060.5036 R K 807 816 PSM AEPVEVVAPR 2886 sp|P09874|PARP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8252.8 112.9429 2 1065.5818 1065.5818 K G 487 497 PSM SIGTANRPMGAGEALR 2887 sp|Q12906-7|ILF3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1000663, ProteinPilot, ] 20 ms_run[1]:scan=1.1.8311.8 114.5375 3 1599.8229706434902 1599.81512336463 K R 258 274 PSM RVATPVDWK 2888 sp|P30041|PRDX6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8467.2 118.7605 3 1070.5849 1070.5873 K D 174 183 PSM ILGATIENSR 2889 sp|P08727|K1C19_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8465.8 118.7158 2 1072.5862 1072.5876 K I 141 151 PSM KFYEQFSK 2890 sp|P07900-2|HS90A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8272.8 113.4881 2 1075.5342 1075.5338 K N 558 566 PSM LLSESAQPLK 2891 sp|Q9H3N1|TMX1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8337.2 115.23 3 1084.6093 1084.6128 K K 224 234 PSM AYTNFDAER 2892 sp|P07355-2|ANXA2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8131.10 109.6506 2 1085.4780 1085.4778 K D 47 56 PSM AQEPESGLSEETQVK 2893 sp|P78527|PRKDC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8287.10 113.8967 3 1630.7761 1630.7686 R C 4091 4106 PSM AEEDEILNR 2894 sp|P27824-2|CALX_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8337.8 115.24 2 1087.5146 1087.5145 K S 609 618 PSM VHIEIGPDGR 2895 sp|P31943|HNRH1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8462.3 118.625 3 1091.5711 1091.5724 R V 317 327 PSM DGGVQACFSR 2896 sp|P08754|GNAI3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 7-UNIMOD:4 ms_run[1]:scan=1.1.8207.10 111.7179 2 1095.4764 1095.4768 R S 133 143 PSM LQEQVTDLR 2897 sp|P12270|TPR_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8455.9 118.4427 2 1100.5814 1100.5826 K S 700 709 PSM LLCGGGIAADR 2898 sp|P05091-2|ALDH2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 3-UNIMOD:4 ms_run[1]:scan=1.1.8384.8 116.5236 2 1101.5580 1101.5601 K G 337 348 PSM SPDSDVAATLK 2899 sp|O60841|IF2P_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8343.8 115.4026 2 1102.5494 1102.5506 K K 767 778 PSM PGLVDSNPAPPESQEK 2900 sp|Q14061|COX17_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8279.9 113.6792 3 1663.8046 1663.8053 M K 2 18 PSM ALAAAGYDVEK 2901 sp|P10412|H14_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8467.7 118.7688 2 1106.5600 1106.5608 K N 65 76 PSM LTLQHVNSNQCLDK 2902 sp|Q10472|GALT1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 11-UNIMOD:4 ms_run[1]:scan=1.1.8421.7 117.5152 3 1668.8176 1668.8253 K A 513 527 PSM LEQEIATYR 2903 sp|P08727|K1C19_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8482.9 119.1817 2 1121.5684 1121.5717 R S 373 382 PSM LSPQAVNSIAK 2904 sp|P30626-2|SORCN_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8469.7 118.8236 2 1126.6330 1126.6346 R R 121 132 PSM KPGDLSDELR 2905 sp|Q13435|SF3B2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8165.4 110.566 3 1128.5752 1128.5775 K I 605 615 PSM EDLQELNDR 2906 sp|P02545-2|LMNA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8151.9 110.1938 2 1130.5198 1130.5204 K L 33 42 PSM ELISDNQYR 2907 sp|P25205-2|MCM3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8351.8 115.6202 2 1136.5440 1136.5462 R L 83 92 PSM LITGASDSELR 2908 sp|Q9UNX4|WDR3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8383.10 116.4995 2 1160.6028 1160.6037 R V 206 217 PSM GEFVTTVQQR 2909 sp|P40925-3|MDHC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8178.10 110.9309 2 1163.5936 1163.5935 K G 239 249 PSM LENEIQTYR 2910 sp|P13645|K1C10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8360.8 115.8655 2 1164.5768 1164.5775 R S 442 451 PSM KGEFETGFEK 2911 sp|Q8IYD1|ERF3B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8312.2 114.5546 3 1170.5524 1170.5557 R G 316 326 PSM LTSLNEEYTK 2912 sp|P43246-2|MSH2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8273.11 113.5203 2 1196.5902 1196.5925 K N 490 500 PSM LVVDSHVQYR 2913 sp|Q6P2Q9|PRP8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8234.3 112.4406 3 1214.6365 1214.6408 K L 556 566 PSM LVVDSHVQYR 2914 sp|Q6P2Q9|PRP8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8241.3 112.6324 3 1214.6365 1214.6408 K L 556 566 PSM LVVDSHVQYR 2915 sp|Q6P2Q9|PRP8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8236.3 112.4955 3 1214.6365 1214.6408 K L 556 566 PSM LVVDSHVQYR 2916 sp|Q6P2Q9|PRP8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8238.6 112.5551 3 1214.6365 1214.6408 K L 556 566 PSM LVVDSHVQYR 2917 sp|Q6P2Q9|PRP8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8239.5 112.5809 3 1214.6365 1214.6408 K L 556 566 PSM LVVDSHVQYR 2918 sp|Q6P2Q9|PRP8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8235.4 112.4695 3 1214.6365 1214.6408 K L 556 566 PSM LFVSGACDASAK 2919 sp|P62873-2|GBB1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 7-UNIMOD:4 ms_run[1]:scan=1.1.8229.7 112.3108 2 1224.5792 1224.5809 R L 198 210 PSM AYGENIGYSEK 2920 sp|P05026-2|AT1B1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8169.10 110.6852 2 1229.5570 1229.5564 K D 278 289 PSM DQVANSAFVER 2921 sp|P07900-2|HS90A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8492.9 119.4537 2 1234.5922 1234.5942 K L 622 633 PSM GPDNSMGFGAER 2922 sp|O75534-2|CSDE1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8497.11 119.5933 2 1236.5166 1236.5193 R K 747 759 PSM KPLLESGTLGTK 2923 sp|P22314|UBA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8468.7 118.7962 2 1242.7158 1242.7183 R G 593 605 PSM NSEPEEVIPSR 2924 sp|P54577|SYYC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8203.11 111.6115 2 1255.6050 1255.6044 K L 357 368 PSM VLGTEAVQDPTK 2925 sp|O43395|PRPF3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8120.8 109.3472 2 1256.6584 1256.6612 R V 484 496 PSM DISTNYYASQK 2926 sp|P14625|ENPL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8486.11 119.2938 2 1288.5902 1288.5935 K K 672 683 PSM ESLTEAEVATEK 2927 sp|P18858-2|DNLI1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8436.11 117.9272 2 1305.6268 1305.6300 K E 162 174 PSM ELEAELEDERK 2928 sp|P35580-3|MYH10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8459.11 118.5558 2 1359.6512 1359.6517 R Q 1621 1632 PSM NGNQAFNEDNLK 2929 sp|Q9Y2Q5-2|LTOR2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8135.9 109.7578 2 1362.6158 1362.6164 R F 59 71 PSM SEQSVAQLEEEK 2930 sp|Q07866-10|KLC1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8324.8 114.8889 2 1375.6484 1375.6467 K K 134 146 PSM GCPEDAAVCAVDK 2931 sp|P11717|MPRI_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 2-UNIMOD:4,9-UNIMOD:4 ms_run[1]:scan=1.1.8496.11 119.566 2 1390.5834 1390.5857 R N 530 543 PSM NLSSDEATNPISR 2932 sp|Q7Z417|NUFP2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8345.11 115.462 2 1402.6672 1402.6688 K V 110 123 PSM LNEQVTQEQPLK 2933 sp|Q14690|RRP5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8317.10 114.703 2 1425.7472 1425.7463 K D 123 135 PSM LDYGQHVVAGTPGR 2934 sp|P38919|IF4A3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8494.11 119.5116 2 1468.7378 1468.7423 K V 153 167 PSM DVASTAGEEGDTSLR 2935 sp|Q8ND24|RN214_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8180.11 110.9871 2 1506.6806 1506.6798 K E 111 126 PSM DDDIEEGDLPEHK 2936 sp|Q14696|MESD_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8331.11 115.0836 2 1510.6438 1510.6423 K R 73 86 PSM TYDPSGDSTLPTCSK 2937 sp|Q9Y2X3|NOP58_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 13-UNIMOD:4 ms_run[1]:scan=1.1.8368.9 116.0859 3 1627.7056 1627.7036 K K 427 442 PSM FNQTYQLAHGTAEEK 2938 sp|Q14166|TTL12_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8270.10 113.4373 3 1735.8148 1735.8165 K M 173 188 PSM EDLNCQEEEDPMNK 2939 sp|O75821|EIF3G_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 5-UNIMOD:4 ms_run[1]:scan=1.1.8394.10 116.7991 2 1749.6844 1749.6821 K L 135 149 PSM KHQALQAEIAGHEPR 2940 sp|Q13813|SPTN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7633.5 96.1569 4 1683.8781 1683.8805 K I 825 840 PSM IFAQDGEGQR 2941 sp|O75369-2|FLNB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6813.4 74.13285 3 1119.5332 1119.5309 K I 682 692 PSM QGNLSSQVPLK 2942 sp|P78527|PRKDC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8462.8 118.6333 2 1169.6386 1169.6404 K R 3148 3159 PSM ESDLNGAQIK 2943 sp|P20700|LMNB1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6869.11 75.65195 2 1073.5306 1073.5353 K L 125 135 PSM LREYEAALNSK 2944 sp|P20700|LMNB1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7855.6 102.1781 3 1292.6683 1292.6724 K D 135 146 PSM AAILETAPK 2945 sp|Q9P2E9|RRBP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7527.6 93.27965 2 912.5264 912.5280 K E 167 176 PSM QVQPEGPYR 2946 sp|P49327|FAS_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6869.11 75.65195 2 1072.5284 1072.5302 R V 2295 2304 PSM DPSASPGDAGEQAIR 2947 sp|P18206|VINC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7628.9 96.02645 3 1469.6692 1469.6746 R Q 286 301 PSM QEYDESGPSIVHRK 2948 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7204.5 84.62258 4 1643.7897 1643.7903 K C 360 374 PSM DNSTMGYMAAK 2949 sp|P07900-2|HS90A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8227.9 112.2595 2 1187.4918 1187.4951 R K 743 754 PSM DIQEESTFSSR 2950 sp|P42704|LPPRC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8403.6 117.0305 3 1297.5796 1297.5786 K K 67 78 PSM ETAENYLGHTAK 2951 sp|P38646|GRP75_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7595.7 95.1382 3 1332.6271 1332.6310 K N 176 188 PSM SPPPGMGLNQNR 2952 sp|P23246|SFPQ_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7624.4 95.90865 3 1266.6244 1266.6139 R G 33 45 PSM VRELISDNQYR 2953 sp|P25205-2|MCM3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8280.5 113.6996 3 1391.7154 1391.7157 K L 81 92 PSM IAQITGPPDR 2954 sp|Q96AE4-2|FUBP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7801.9 100.7115 2 1066.5742 1066.5771 R C 321 331 PSM HGVESTLER 2955 sp|Q04637-9|IF4G1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6354.2 61.6376 3 1026.5092 1026.5094 R S 1288 1297 PSM PAAVVLQTK 2956 sp|Q14697|GANAB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7242.4 85.65252 2 925.5576 925.5597 K G 900 909 PSM SSQSSSQQFSGIGR 2957 sp|Q92841-1|DDX17_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7933.6 104.3187 3 1454.6710 1454.6750 R S 592 606 PSM GIVEFSGKPAAR 2958 sp|Q15233-2|NONO_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8401.11 116.9862 2 1230.6704 1230.6721 K K 102 114 PSM TKFETEQALR 2959 sp|P08727|K1C19_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7430.4 90.67207 3 1221.6370 1221.6353 R L 167 177 PSM GEEGHDPKEPEQLR 2960 sp|P51991|ROA3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6427.4 63.58842 4 1619.7541 1619.7539 R K 22 36 PSM VVGDVAYDEAK 2961 sp|P11586|C1TC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7800.9 100.6843 2 1164.5632 1164.5663 K E 252 263 PSM RGPAEESSSWR 2962 sp|Q14152-2|EIF3A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6869.7 75.64529 3 1260.5827 1260.5847 R D 1216 1227 PSM RGPAEESSSWR 2963 sp|Q14152-2|EIF3A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6888.6 76.16319 3 1260.5971 1260.5847 R D 1216 1227 PSM IDVGEAEPR 2964 sp|P54577|SYYC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7570.7 94.45637 2 984.4862 984.4876 K T 392 401 PSM VDNDENEHQLSLR 2965 sp|P06748-2|NPM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7824.8 101.3358 3 1567.7191 1567.7226 K T 33 46 PSM TSTSQAVFR 2966 sp|P14868|SYDC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7055.9 80.63308 2 995.5044 995.5036 R L 189 198 PSM LVEVNGENVEK 2967 sp|O14745|NHRF1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7776.3 100.034 3 1228.6264 1228.6299 R E 59 70 PSM TAVCDIPPR 2968 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 4-UNIMOD:4 ms_run[1]:scan=1.1.7938.9 104.4607 2 1027.5126 1027.5121 K G 351 360 PSM TAVCDIPPR 2969 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 4-UNIMOD:4 ms_run[1]:scan=1.1.8199.8 111.499 2 1027.5156 1027.5121 K G 351 360 PSM TAVCDIPPR 2970 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 4-UNIMOD:4 ms_run[1]:scan=1.1.7548.8 93.85513 2 1027.5184 1027.5121 K G 351 360 PSM SGVSLAALKK 2971 sp|P10412|H14_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8413.2 117.2906 3 972.5953 972.5968 R A 55 65 PSM QASVADYEETVKK 2972 sp|P49419-2|AL7A1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8357.5 115.7787 3 1466.7241 1466.7253 R A 54 67 PSM KQPPVSPGTALVGSQK 2973 sp|P17096|HMGA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8045.10 107.3833 3 1592.8888 1592.8886 R E 31 47 PSM KDDEVQVVR 2974 sp|P61254|RL26_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6377.3 62.2598 3 1086.5659 1086.5669 R G 51 60 PSM KDDEVQVVR 2975 sp|P61254|RL26_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6373.2 62.15277 3 1086.5659 1086.5669 R G 51 60 PSM KDDEVQVVR 2976 sp|P61254|RL26_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6374.3 62.18077 3 1086.5659 1086.5669 R G 51 60 PSM SETAPAETATPAPVEK 2977 sp|P16401|H15_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7177.8 83.90172 3 1597.7845 1597.7835 M S 2 18 PSM QLQAETEPIVK 2978 sp|P60228|EIF3E_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8375.9 116.2781 2 1254.6814 1254.6819 K M 83 94 PSM EVVEEAENGR 2979 sp|P06454-2|PTMA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6443.4 64.01875 3 1130.5219 1130.5204 K D 22 32 PSM AAAAAAALQAK 2980 sp|P36578|RL4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6634.8 69.23537 2 955.5450 955.5450 K S 354 365 PSM AAAAAAALQAK 2981 sp|P36578|RL4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6635.7 69.26105 2 955.5450 955.5450 K S 354 365 PSM DGMDNQGGYGSVGR 2982 sp|P31942-2|HNRH3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7729.7 98.78067 3 1411.5772 1411.5787 R M 273 287 PSM FKQESTVATER 2983 sp|Q9H307|PININ_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6243.5 58.59897 3 1294.6543 1294.6517 K Q 156 167 PSM VAAMSVAQR 2984 sp|O43143|DHX15_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6784.8 73.34377 2 931.4902 931.4909 R V 196 205 PSM ALQQEQEIEQR 2985 sp|Q86YP4-2|P66A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7453.3 91.2655 3 1370.6770 1370.6790 K L 465 476 PSM LSLHEEEGSSGSEQK 2986 sp|Q12955|ANK3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6765.11 72.82822 3 1615.7374 1615.7325 R Q 4341 4356 PSM TIAQGNLSNTDVQAAK 2987 sp|P22695|QCR2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8314.8 114.6188 3 1629.8290 1629.8322 K N 360 376 PSM IRDEMVATEQER 2988 sp|P16615-4|AT2A2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7210.6 84.78705 3 1475.7025 1475.7038 K T 208 220 PSM FSEGTSADREIQR 2989 sp|P62333|PRS10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7163.8 83.5399 3 1494.7051 1494.7063 R T 243 256 PSM YGDGGSSFQSTTGHCVHMR 2990 sp|P55795|HNRH2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 15-UNIMOD:4 ms_run[1]:scan=1.1.8386.6 116.5751 4 2082.8433 2082.8636 R G 276 295 PSM KNIILEEGK 2991 sp|P23528|COF1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7271.8 86.4546 2 1042.6018 1042.6022 K E 45 54 PSM YRPGTVALR 2992 sp|Q71DI3|H32_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7436.4 90.8265 3 1031.5873 1031.5876 R E 42 51 PSM NNTQVLINCR 2993 sp|P62316|SMD2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 9-UNIMOD:4 ms_run[1]:scan=1.1.8017.10 106.6202 2 1230.6132 1230.6139 K N 38 48 PSM SNLNSLDEQEGVK 2994 sp|O75223|GGCT_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8333.6 115.1294 3 1431.6832 1431.6841 K S 89 102 PSM IGNCPFSQR 2995 sp|O00299|CLIC1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 4-UNIMOD:4 ms_run[1]:scan=1.1.7760.8 99.6252 2 1077.5010 1077.5026 K L 21 30 PSM LQQTTQLIK 2996 sp|Q9NUQ3-2|TXLNG_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7948.8 104.7324 2 1071.6284 1071.6288 K E 176 185 PSM VFSQTTICR 2997 sp|Q01860|PO5F1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 8-UNIMOD:4 ms_run[1]:scan=1.1.8040.10 107.2473 2 1110.5482 1110.5492 K F 178 187 PSM SAVTTVVNPK 2998 sp|P05556|ITB1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7027.7 79.87209 2 1014.5638 1014.5710 K Y 785 795 PSM SSGGREDLESSGLQR 2999 sp|Q9UK76-2|JUPI1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7232.2 85.37583 4 1576.7437 1576.7441 K R 70 85 PSM FTQQDIDEAK 3000 sp|Q5JRX3-2|PREP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7783.8 100.2249 2 1193.5514 1193.5564 K L 948 958 PSM HFVALSTNTTK 3001 sp|P06744-2|G6PI_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7426.5 90.5711 3 1217.6398 1217.6404 K V 253 264 PSM GLCGAIHSSIAK 3002 sp|P36542-2|ATPG_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 3-UNIMOD:4 ms_run[1]:scan=1.1.8265.5 113.2931 3 1212.6412 1212.6285 R Q 101 113 PSM DDQLLDDGK 3003 sp|Q15370-2|ELOB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7723.9 98.61988 2 1017.4608 1017.4615 K T 47 56 PSM EAYVNANQAR 3004 sp|Q9BTE3-2|MCMBP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6442.9 63.99967 2 1134.5382 1134.5417 K V 143 153 PSM ALGLDSANEK 3005 sp|Q13451|FKBP5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7533.7 93.44444 2 1016.5148 1016.5138 K G 343 353 PSM RELHGQNPVVTPCNK 3006 sp|Q16630-2|CPSF6_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 13-UNIMOD:4 ms_run[1]:scan=1.1.6515.7 65.97507 4 1747.8805 1747.8788 K Q 147 162 PSM LGAEVYHTLK 3007 sp|P09104-2|ENOG_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8376.3 116.2954 3 1129.6096 1129.6131 R G 141 151 PSM VQTAVTMGK 3008 sp|Q7LBR1|CHM1B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6651.6 69.69556 2 933.4960 933.4954 R V 79 88 PSM VLTVINQTQK 3009 sp|P42766|RL35_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8052.8 107.5679 2 1142.6622 1142.6659 R E 57 67 PSM VLTVINQTQK 3010 sp|P42766|RL35_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8053.10 107.5982 2 1142.6622 1142.6659 R E 57 67 PSM NRQEYDALAK 3011 sp|Q6I9Y2|THOC7_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6839.7 74.82533 3 1206.6004 1206.5993 K V 115 125 PSM QLVHSFTEGR 3012 sp|Q5ZPR3-3|CD276_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7969.4 105.302 3 1172.5867 1172.5938 K D 292 302 PSM IYEDGDDDMK 3013 sp|Q9HB71|CYBP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6958.9 78.02003 2 1199.4674 1199.4652 K R 198 208 PSM QKTEDEVLTSK 3014 sp|Q9BQ61|TRIR_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6470.5 64.74506 3 1276.6486 1276.6510 K G 136 147 PSM SSSTFSGIK 3015 sp|Q8N3U4-2|STAG2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7306.9 87.41708 2 912.4526 912.4553 R E 941 950 PSM HTDTDVLEACSK 3016 sp|Q8N3U4-2|STAG2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 10-UNIMOD:4 ms_run[1]:scan=1.1.7319.6 87.76736 3 1374.6100 1374.6086 K T 623 635 PSM VEVNTNSGEIIHK 3017 sp|Q8WWQ0|PHIP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7952.3 104.8342 3 1438.7395 1438.7416 K K 1645 1658 PSM KQEELVQQVR 3018 sp|O95983-2|MBD3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6887.5 76.13472 3 1255.6840 1255.6884 R K 195 205 PSM EQILGDEAR 3019 sp|Q13724|MOGS_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7548.8 93.85513 2 1029.5108 1029.5091 R A 487 496 PSM EGLDDQGLTK 3020 sp|Q9UKA9-2|PTBP2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7835.9 101.6363 2 1074.5338 1074.5193 R D 420 430 PSM YRDPTTVTTLR 3021 sp|P63151-2|2ABA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8388.4 116.6267 3 1321.6966 1321.6990 R V 153 164 PSM SAGEEEDGPVLTDEQK 3022 sp|Q66PJ3-2|AR6P4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7926.11 104.1356 2 1702.7534 1702.7533 R S 324 340 PSM NAAEELKPR 3023 sp|P78406|RAE1L_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6375.3 62.2071 3 1026.5440 1026.5458 R N 357 366 PSM SQAPGQPGASQWGSR 3024 sp|Q96EP5-2|DAZP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7809.6 100.9245 3 1512.7183 1512.7070 K V 195 210 PSM VGSVEEFQGQER 3025 sp|Q9HCE1|MOV10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8229.10 112.3158 2 1363.6346 1363.6368 K S 862 874 PSM CHPQTIAVVQTR 3026 sp|P23378|GCSP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 1-UNIMOD:4 ms_run[1]:scan=1.1.7402.7 89.95367 3 1408.7260 1408.7245 R A 225 237 PSM QAQREDALELTEK 3027 sp|P78316|NOP14_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8247.6 112.8022 3 1529.7565 1529.7685 R L 208 221 PSM HQIVEVAGDDK 3028 sp|Q07960|RHG01_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6775.5 73.09195 3 1209.6001 1209.5990 R Y 70 81 PSM PYTLEEQK 3029 sp|P54709|AT1B3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7277.10 86.62382 2 1006.4966 1006.4971 K N 116 124 PSM ASVHTLSGHTNAVATVR 3030 sp|O43660-2|PLRG1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7188.5 84.18748 4 1719.8997 1719.9016 K C 312 329 PSM GAVHQLCQSLAGK 3031 sp|P09417-2|DHPR_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 7-UNIMOD:4 ms_run[1]:scan=1.1.8452.3 118.3505 3 1367.6995 1367.6980 K N 124 137 PSM AEAAVVAVAEK 3032 sp|Q8IZQ5|SELH_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7651.9 96.65465 2 1056.5800 1056.5815 K R 10 21 PSM HHVLGTITTDK 3033 sp|Q5JPE7-2|NOMO2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.6816.5 74.21595 3 1220.6512 1220.6514 R M 666 677 PSM VACAEEWQESR 3034 sp|O75663-2|TIPRL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 3-UNIMOD:4 ms_run[1]:scan=1.1.8229.10 112.3158 2 1363.5770 1363.5826 K T 85 96 PSM KDIMSPIMVGLK 3035 sp|Q14BN4-8|SLMAP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8406.4 117.1066 3 1330.7095 1330.7352 R A 250 262 PSM SRSVASPSCLR 3036 sp|Q9BYV9|BACH2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 9-UNIMOD:4 ms_run[1]:scan=1.1.8443.3 118.1041 3 1218.6175 1218.6139 R S 332 343 PSM EAWEQQQGAVAK 3037 sp|Q86U38|NOP9_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.7594.11 95.11797 2 1343.6460 1343.6470 R R 614 626 PSM VLQHYQESDKGEELGPGNVQK 3038 sp|Q9Y6C9|MTCH2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 20 ms_run[1]:scan=1.1.8181.10 111.0127 4 2354.1501 2354.1502 K E 91 112 PSM YICENQDSISSK 3039 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20 3-UNIMOD:4 ms_run[1]:scan=1.1.7668.11 97.12296 2 1443.618047 1442.634759 K L 287 299 PSM YICENQDSISSK 3040 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20 3-UNIMOD:4 ms_run[1]:scan=1.1.7665.7 97.03403 3 1443.621371 1442.634759 K L 287 299 PSM CCAAADPHECYAK 3041 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 20 1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.7827.6 101.4136 3 1534.5596 1534.5634 K V 384 397 PSM TVLDQQQTPSR 3042 sp|P42704|LPPRC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.6808.10 74.00595 2 1272.645647 1271.646979 K L 1129 1140 PSM LGAGEGGEASVSPEK 3043 sp|Q13428|TCOF_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.6919.11 76.97805 2 1387.645847 1386.662688 K T 1367 1382 PSM LNGGLGTSMGCK 3044 sp|Q16851|UGPA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20 11-UNIMOD:4 ms_run[1]:scan=1.1.8434.9 117.8695 2 1194.538647 1193.553278 K G 113 125 PSM DAVTYTEHAK 3045 sp|P62805|H4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.6402.4 62.91688 3 1134.538271 1133.535303 R R 69 79 PSM DAVTYTEHAK 3046 sp|P62805|H4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.6382.6 62.39643 3 1134.538271 1133.535303 R R 69 79 PSM AQEEAERLEADR 3047 sp|P15311|EZRI_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.7021.4 79.7095 3 1416.672371 1415.664085 R M 382 394 PSM QSVENDIHGLR 3048 sp|P05783|K1C18_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.8487.10 119.3194 2 1267.624047 1266.631663 R K 176 187 PSM GDREQLLQR 3049 sp|Q04917|1433F_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 20 1-UNIMOD:1 ms_run[1]:scan=1.1.8164.11 110.5504 2 1155.5981 1155.5991 M A 2 11 PSM QQTLEAEEAK 3050 sp|Q16643|DREB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 20 1-UNIMOD:28 ms_run[1]:scan=1.1.7673.9 97.25742 2 1129.5282 1128.5292 K R 239 249 PSM MENSQLCK 3051 sp|Q13151|ROA0_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 20 1-UNIMOD:1,7-UNIMOD:4 ms_run[1]:scan=1.1.8109.9 109.0498 2 1051.4482 1050.4472 - L 1 9 PSM QASEGPLK 3052 sp|P04406|G3P_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 20 1-UNIMOD:28 ms_run[1]:scan=1.1.7101.5 81.86563 2 811.4062 811.4071 K G 264 272 PSM QALHSGQNQLK 3053 sp|P54886|P5CS_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 20 1-UNIMOD:28 ms_run[1]:scan=1.1.6796.11 73.6785 2 1205.6132 1205.6148 R E 139 150 PSM KVTEELLTDNR 3054 sp|Q9UHB9|SRP68_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.8254.6 112.9944 3 1317.674471 1316.693595 K Y 112 123 PSM ALLQQQPEDDSK 3055 sp|Q9UHB9|SRP68_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.7367.11 89.05791 2 1371.670847 1370.667774 R R 405 417 PSM QAGEVTYADAHK 3056 sp|Q13247|SRSF6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 20 1-UNIMOD:28 ms_run[1]:scan=1.1.7726.10 98.70365 2 1271.5751 1271.5777 R E 132 144 PSM HSGPNSADSANDGFVR 3057 sp|P52597|HNRPF_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.7303.10 87.33673 3 1630.694471 1629.713161 K L 99 115 PSM SDKPDMAEIEK 3058 sp|P62328|TYB4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 20 1-UNIMOD:1 ms_run[1]:scan=1.1.6063.10 53.68512 2 1303.5948 1303.5961 M F 2 13 PSM SDKPDMAEIEK 3059 sp|P62328|TYB4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 20 1-UNIMOD:1,6-UNIMOD:35 ms_run[1]:scan=1.1.6675.6 70.3525 3 1319.5859 1319.5910 M F 2 13 PSM AHQTGIHATEELK 3060 sp|Q6IBS0|TWF2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 20 1-UNIMOD:1 ms_run[1]:scan=1.1.7551.7 93.93552 3 1475.7334 1475.7363 M E 2 15 PSM QEVISTSSK 3061 sp|P63244|RACK1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 20 1-UNIMOD:28 ms_run[1]:scan=1.1.7254.6 85.98441 2 960.4750 960.4759 K A 272 281 PSM NVELVEGEEGR 3062 sp|P52789|HXK2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.8256.11 113.0576 2 1230.576447 1229.588795 R M 692 703 PSM SSAEVIAQAR 3063 sp|Q16555|DPYL2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.6850.2 75.11643 3 1029.538271 1030.540723 K K 259 269 PSM FGQVYTEAK 3064 sp|P46977|STT3A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.7780.9 100.1479 2 1042.508847 1041.513111 R R 647 656 PSM ATETVELHK 3065 sp|P82979|SARNP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 20 1-UNIMOD:1 ms_run[1]:scan=1.1.7809.10 100.9312 2 1068.5427 1068.5446 M L 2 11 PSM AAPSDGFKPR 3066 sp|Q92979|NEP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 20 1-UNIMOD:1 ms_run[1]:scan=1.1.7736.8 98.97373 2 1087.5482 1086.5452 M E 2 12 PSM LCYVALDFEQEMAMVASSSSLEK 3067 sp|P0CG39|POTEJ_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20 2-UNIMOD:4 ms_run[1]:scan=1.1.1671.2 11.79965 3 2606.183171 2607.190663 K S 879 902 PSM QVHPDTGISSK 3068 sp|Q96A08|H2B1A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.6081.8 54.16697 2 1166.575247 1167.588401 K A 49 60 PSM GRPLAEESEQER 3069 sp|Q8N357|S35F6_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.6201.5 57.43328 3 1398.672371 1399.669171 R L 347 359 PSM IHMGSCAENTAK 3070 sp|P24752|THIL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20 6-UNIMOD:4 ms_run[1]:scan=1.1.6205.8 57.54932 3 1319.594171 1317.580556 K K 191 203 PSM TLGETSANAETEQNK 3071 sp|Q5UIP0|RIF1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.6462.8 64.5423 3 1590.725471 1591.732559 K K 1489 1504 PSM TASQGQWGR 3072 sp|Q9UBM7|DHCR7_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.6507.6 65.75298 2 991.461047 989.467892 R A 23 32 PSM EPSEVPTPK 3073 sp|P17096|HMGA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.6600.8 68.3131 2 983.497647 982.497127 K R 47 56 PSM EPSEVPTPK 3074 sp|P17096|HMGA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.6676.9 70.38496 2 983.499047 982.497127 K R 47 56 PSM KYEEIDNAPEER 3075 sp|P49411|EFTU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.7163.8 83.5399 3 1493.694371 1491.684152 K A 91 103 PSM VREEEIEVDSR 3076 sp|Q14978|NOLC1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.7314.5 87.62894 3 1358.636471 1359.663023 R V 628 639 PSM NRQEYEDIAVK 3077 sp|O15294|OGT1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.7917.3 103.8752 3 1362.671771 1363.673193 K L 972 983 PSM FFVSSSQGR 3078 sp|P35613|BASI_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.8086.7 108.4426 2 1012.477847 1013.493044 R S 274 283 PSM VDQIIMAK 3079 sp|P50990|TCPQ_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.8161.5 110.4587 2 917.504047 916.505189 R P 521 529 PSM TPVEPEVAIHR 3080 sp|P60866|RS20_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.8315.2 114.6357 3 1245.663371 1246.666986 K I 9 20 PSM EGVLYVGSK 3081 sp|P37840|SYUA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.8430.5 117.7544 2 949.494647 950.507297 K T 35 44 PSM ALAAAGYDVEK 3082 sp|Q02539|H11_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.8433.8 117.8408 2 1105.548647 1106.560789 K N 68 79 PSM SVDPDSPAEASGLR 3083 sp|O14745|NHRF1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.8452.10 118.3621 2 1398.657247 1399.657937 R A 181 195 PSM EEILSVAK 3084 sp|Q9NRZ9|HELLS_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.8502.3 119.7162 2 888.500647 887.496398 K K 145 153 PSM KLTVNPGTK 3085 sp|P09874|PARP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6119.3 55.17159 3 956.5657 956.5655 K S 654 663 PSM HSLSGRPLK 3086 sp|P52272|HNRPM_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.5964.5 50.95997 3 993.5734 993.5719 K V 135 144 PSM EESGKPGAHVTVK 3087 sp|P22626-2|ROA2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.5875.4 48.52055 4 1337.7005 1337.6939 R K 88 101 PSM EFNAEVHRK 3088 sp|P46777|RL5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6097.5 54.5732 3 1128.5677 1128.5676 K H 189 198 PSM ACFHCETCK 3089 sp|Q14847-2|LASP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 2-UNIMOD:4,5-UNIMOD:4,8-UNIMOD:4 ms_run[1]:scan=1.1.6059.4 53.56588 3 1211.4541 1211.4522 K M 28 37 PSM VHGPGIQSGTTNKPNK 3090 sp|P21333-2|FLNA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.5986.7 51.55375 4 1633.8557 1633.8536 R F 1360 1376 PSM VKVEEEEEEK 3091 sp|Q9Y2X3|NOP58_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6019.7 52.46665 3 1246.5916 1246.5928 K V 466 476 PSM HLQLAIR 3092 sp|P16104|H2AX_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.1677.4 11.9581 2 849.5178 849.5184 R N 83 90 PSM GRDVIAQSQSGTGK 3093 sp|P38919|IF4A3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6066.6 53.75993 3 1402.7164 1402.7165 K T 75 89 PSM EDAANNYAR 3094 sp|P68366-2|TBA4A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6064.8 53.70908 2 1022.4414 1022.4417 K G 82 91 PSM HGATHVFASK 3095 sp|O60264|SMCA5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.5970.10 51.13433 2 1053.5356 1053.5356 R E 656 666 PSM HECGAAFTSK 3096 sp|Q13619-2|CUL4A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 3-UNIMOD:4 ms_run[1]:scan=1.1.6109.10 54.9073 2 1106.4834 1106.4815 K L 381 391 PSM IGKPHTVPCK 3097 sp|P15880|RS2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 9-UNIMOD:4 ms_run[1]:scan=1.1.5901.3 49.22893 3 1135.6213 1135.6172 K V 174 184 PSM HYEGSTVPEK 3098 sp|P00738|HPT_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6002.10 51.99985 2 1145.5342 1145.5353 R K 312 322 PSM HQGVMVGMGQK 3099 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 8-UNIMOD:35 ms_run[1]:scan=1.1.6067.4 53.7838 3 1186.5571 1186.5587 R D 40 51 PSM EDGNEEDKENQGDETQGQQPPQR 3100 sp|P67809|YBOX1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6069.11 53.84995 4 2627.0953 2627.0968 R R 257 280 PSM RPLEDGDQPDAK 3101 sp|Q96AE4-2|FUBP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6101.11 54.69 2 1339.6382 1339.6368 K K 65 77 PSM VQQSSESSTSSPSQHEATPGAR 3102 sp|O75152|ZC11A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6006.11 52.11225 3 2257.0147 2257.0207 R R 485 507 PSM HLQLAIRNDEELNK 3103 sp|P16104|H2AX_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.2019.2 14.51308 3 1691.8897 1691.8954 R L 83 97 PSM KFLDAGHK 3104 sp|P30101|PDIA3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6167.2 56.48682 3 914.4898 914.4974 K L 289 297 PSM YHNVGLSK 3105 sp|Q14103-3|HNRPD_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6283.2 59.699 3 916.4749 916.4767 K C 244 252 PSM TVHSVINR 3106 sp|Q10472|GALT1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6195.2 57.26159 3 924.5047 924.5141 R S 135 143 PSM TIAPQNAPR 3107 sp|Q9NYF8-2|BCLF1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6275.2 59.47763 3 966.5188 966.5247 K D 302 311 PSM KLAPEYEK 3108 sp|P13667|PDIA4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6281.2 59.6436 3 976.5247 976.5229 K A 211 219 PSM DLRPVDNR 3109 sp|P42285|MTREX_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6301.2 60.19573 3 983.5177 983.5148 K Q 749 757 PSM KIQEESLR 3110 sp|B5ME19|EIFCL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6309.3 60.41573 3 1001.5516 1001.5505 R T 783 791 PSM RPFDPNDR 3111 sp|Q16629-4|SRSF7_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6479.2 64.97957 3 1015.4827 1015.4835 R C 98 106 PSM RVEEELEK 3112 sp|Q9NWB6|ARGL1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6234.2 58.34373 3 1030.5310 1030.5294 K R 141 149 PSM RVEEELEK 3113 sp|Q9NWB6|ARGL1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6236.5 58.40445 3 1030.5310 1030.5294 K R 141 149 PSM RVEEELEK 3114 sp|Q9NWB6|ARGL1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6235.4 58.37482 3 1030.5310 1030.5294 K R 141 149 PSM THLSLSHNPEQK 3115 sp|P11586|C1TC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6514.2 65.93915 4 1389.6985 1389.7001 K G 867 879 PSM IRQLEEEK 3116 sp|P35580-3|MYH10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6181.4 56.8769 3 1043.5630 1043.5611 R N 1359 1367 PSM RAYDIAGSTK 3117 sp|P11388|TOP2A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1000663, ProteinPilot, ] 19 ms_run[1]:scan=1.1.6507.4 65.74965 3 1080.5547706434902 1080.55637241748 R D 242 252 PSM RVAAMSVAQR 3118 sp|O43143|DHX15_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6515.3 65.9684 3 1087.5886 1087.5920 R V 195 205 PSM ATNVTYQAHHVSR 3119 sp|O43252|PAPS1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6164.5 56.40918 4 1482.7369 1482.7328 R N 25 38 PSM YHTVNGHNCEVR 3120 sp|P09651-2|ROA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 9-UNIMOD:4 ms_run[1]:scan=1.1.6145.3 55.88178 4 1484.6545 1484.6579 K K 167 179 PSM SLHSATTIGNK 3121 sp|P51610-2|HCFC1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6174.5 56.6852 3 1127.5927 1127.5935 R M 256 267 PSM AYSEAHEISK 3122 sp|P61981|1433G_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6182.2 56.90137 3 1133.5393 1133.5353 K E 153 163 PSM RYDDPEVQK 3123 sp|P38646|GRP75_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6225.2 58.0939 3 1148.5477 1148.5462 R D 127 136 PSM GKPTEASIEAR 3124 sp|Q9NVU7-2|SDA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6263.6 59.1521 3 1157.5840 1157.6040 R V 356 367 PSM KGPGLAVQSGDK 3125 sp|Q96PK6|RBM14_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6263.5 59.15043 3 1155.6235 1155.6248 K T 153 165 PSM DNHVVAAGGVEK 3126 sp|Q15274|NADC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6253.8 58.87962 3 1194.5989 1194.5993 K A 172 184 PSM TVSLGAGAK 3127 sp|P06748-2|NPM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6457.2 64.39954 2 802.4530 802.4549 R D 46 55 PSM VAPHALSEEEK 3128 sp|Q9UI26-2|IPO11_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6303.4 60.25323 3 1208.6023 1208.6037 R T 117 128 PSM ITTGAQDDLRK 3129 sp|Q9Y4W6|AFG32_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6353.4 61.61357 3 1216.6411 1216.6412 R V 642 653 PSM SVSGTDVQEECREK 3130 sp|P49321|NASP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 11-UNIMOD:4 ms_run[1]:scan=1.1.6252.7 58.85057 4 1622.7217 1622.7206 K G 244 258 PSM VGGTSDVEVNEK 3131 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6492.4 65.3387 3 1232.5876 1232.5885 K K 406 418 PSM RTAQEVETYR 3132 sp|P17844-2|DDX5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6466.4 64.641 3 1251.6205 1251.6207 R R 68 78 PSM KEVVEEAENGR 3133 sp|P06454-2|PTMA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6177.9 56.77488 3 1258.6174 1258.6153 K D 21 32 PSM NCHLNENIEK 3134 sp|Q13907|IDI1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 2-UNIMOD:4 ms_run[1]:scan=1.1.6466.5 64.64267 3 1269.5770 1269.5771 K G 38 48 PSM QVQQHQGNLDASGPAR 3135 sp|Q96SQ9-2|CP2S1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6233.7 58.3242 4 1704.8333 1704.8292 R D 251 267 PSM GGVVNAAKEEHETDEK 3136 sp|O15042-2|SR140_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6163.6 56.3832 4 1711.8017 1711.8013 R R 138 154 PSM ESQKVELSESR 3137 sp|P25205-2|MCM3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6362.6 61.86435 3 1290.6313 1290.6415 K L 778 789 PSM TDAAVEMK 3138 sp|Q16643-3|DREB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6306.8 60.34158 2 863.4074 863.4059 K R 166 174 PSM LSSAMSAAK 3139 sp|P40925-3|MDHC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6211.9 57.71798 2 864.4360 864.4375 K A 258 267 PSM ALVADSHPESER 3140 sp|Q01082-3|SPTB2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6377.6 62.2648 3 1309.6258 1309.6262 R I 1644 1656 PSM TQNVLGEK 3141 sp|P23396-2|RS3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6502.6 65.61563 2 887.4706 887.4712 R G 55 63 PSM GSSNSYAIK 3142 sp|P46782|RS5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6444.9 64.05452 2 925.4510 925.4505 K K 183 192 PSM QRPGQQVATCVR 3143 sp|O75534-2|CSDE1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 10-UNIMOD:4 ms_run[1]:scan=1.1.6302.7 60.23122 3 1398.7135 1398.7150 K L 466 478 PSM LQAAYAGDK 3144 sp|Q01082-3|SPTB2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6373.5 62.15777 2 935.4720 935.4712 R A 1857 1866 PSM AAQEEYVK 3145 sp|P04075-2|ALDOA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6275.5 59.48263 2 936.4538 936.4552 K R 377 385 PSM AYGGSMCAK 3146 sp|P49207|RL34_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 7-UNIMOD:4 ms_run[1]:scan=1.1.6255.10 58.93803 2 943.3890 943.3892 R C 77 86 PSM ESEPQAAAEPAEAK 3147 sp|P80723|BASP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6429.7 63.64547 3 1426.6522 1426.6575 K E 39 53 PSM HVVQIVEK 3148 sp|O95104-2|SFR15_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6496.7 65.45312 2 950.5544 950.5549 K F 42 50 PSM MGGEEKPIGAGEEK 3149 sp|P26639-2|SYTC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6297.5 60.0909 3 1430.6779 1430.6711 K Q 13 27 PSM VADNSFDAK 3150 sp|Q14978-2|NOLC1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6471.7 64.7742 2 965.4434 965.4454 R R 649 658 PSM HQPTAIIAK 3151 sp|P29401-2|TKT_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6334.10 61.10592 2 977.5656 977.5658 K T 241 250 PSM EGGDGEEQDVGDAGR 3152 sp|Q8N1G4|LRC47_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6269.5 59.31637 3 1489.5925 1489.5917 R L 292 307 PSM QIDNPDYK 3153 sp|P27797|CALR_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6497.7 65.48038 2 991.4610 991.4611 R G 279 287 PSM YYGGGSEGGR 3154 sp|P14866|HNRPL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6125.10 55.34912 2 1001.4218 1001.4203 R A 47 57 PSM VTEGGEPYR 3155 sp|Q14697|GANAB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6339.10 61.24112 2 1006.4734 1006.4720 K L 270 279 PSM LGEGEGSMTK 3156 sp|Q9UNH7|SNX6_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6297.8 60.0959 2 1007.4572 1007.4594 K E 110 120 PSM HGVIVAADSR 3157 sp|P28074|PSB5_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6301.3 60.1974 3 1023.5461 1023.5461 R A 69 79 PSM HQQLLEEK 3158 sp|P35580-3|MYH10_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6418.11 63.36475 2 1023.5366 1023.5349 K N 903 911 PSM HQQLLEEK 3159 sp|P35580-3|MYH10_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6399.7 62.8424 2 1023.5366 1023.5349 K N 903 911 PSM DPAGEAVDPR 3160 sp|Q9NUD5|ZCHC3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6516.9 66.00585 2 1025.4768 1025.4778 R K 103 113 PSM YKEETIEK 3161 sp|P61254|RL26_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6128.3 55.42027 3 1038.5245 1038.5233 K M 135 143 PSM KQQQLSALK 3162 sp|P35580-3|MYH10_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6391.4 62.62842 3 1042.6150 1042.6135 K V 830 839 PSM DANGNSFATR 3163 sp|P62701|RS4X_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6455.9 64.35623 2 1051.4680 1051.4683 K L 212 222 PSM NCSSPEFSK 3164 sp|Q99829|CPNE1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 2-UNIMOD:4 ms_run[1]:scan=1.1.6436.9 63.83525 2 1054.4380 1054.4389 R T 52 61 PSM ANPFGGASHAK 3165 sp|P62266|RS23_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6407.2 63.04918 3 1055.5165 1055.5148 K G 38 49 PSM VLADPSDDTK 3166 sp|Q15149|PLEC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6429.9 63.6488 2 1059.5084 1059.5084 R G 2979 2989 PSM VEEATVEER 3167 sp|Q14244-7|MAP7_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6250.8 58.79722 2 1060.5046 1060.5036 K T 429 438 PSM NTCTSVYTK 3168 sp|P78527|PRKDC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 3-UNIMOD:4 ms_run[1]:scan=1.1.6250.9 58.79888 2 1072.4886 1072.4859 K D 109 118 PSM VSQGSKDPAEGDGAQPEETPR 3169 sp|Q14697|GANAB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6400.8 62.87045 4 2153.9817 2153.9825 R D 186 207 PSM IREEYPDR 3170 sp|Q9BVA1|TBB2B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6341.2 61.28198 3 1076.5282 1076.5250 K I 155 163 PSM VNPQISDEKDEDEK 3171 sp|P26358|DNMT1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6338.9 61.21237 3 1644.7507 1644.7478 K E 307 321 PSM SQESGYYDR 3172 sp|P43243|MATR3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6502.10 65.6223 2 1103.4510 1103.4519 R M 208 217 PSM ENASQCFEK 3173 sp|Q6PD62|CTR9_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 6-UNIMOD:4 ms_run[1]:scan=1.1.6485.9 65.15527 2 1111.4612 1111.4604 K V 358 367 PSM VLVEQQQDR 3174 sp|Q5TDH0-3|DDI2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6362.9 61.86935 2 1113.5776 1113.5778 R A 174 183 PSM RHLTGEFEK 3175 sp|P62826|RAN_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6380.11 62.35207 2 1115.5716 1115.5723 K K 29 38 PSM RLEEPEEPK 3176 sp|O75822-2|EIF3J_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6477.2 64.92505 3 1125.5644 1125.5666 K V 98 107 PSM NQGGYGGSSSSSSYGSGR 3177 sp|P09651-2|ROA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6411.8 63.16833 3 1693.6918 1693.6928 R R 301 319 PSM ISAEGGEQVER 3178 sp|Q9BQE5|APOL2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6462.10 64.54563 2 1173.5576 1173.5626 R V 249 260 PSM APLQQCAEDR 3179 sp|Q15003-2|CND2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 6-UNIMOD:4 ms_run[1]:scan=1.1.6402.11 62.92855 2 1186.5404 1186.5401 K Q 168 178 PSM VSDGGSSSTDFK 3180 sp|Q7Z6Z7-2|HUWE1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6344.10 61.37687 2 1185.5158 1185.5150 K M 3543 3555 PSM HQGVMVGMGQK 3181 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 5-UNIMOD:35 ms_run[1]:scan=1.1.6336.4 61.1498 3 1186.5607 1186.5587 R D 40 51 PSM HQGVMVGMGQK 3182 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 5-UNIMOD:35 ms_run[1]:scan=1.1.6330.6 60.9919 3 1186.5607 1186.5587 R D 40 51 PSM LSSTQQSLAEK 3183 sp|Q8IUD2|RB6I2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6440.9 63.94488 2 1190.6136 1190.6143 K E 895 906 PSM VAVTEGCQPSR 3184 sp|O75369-2|FLNB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 7-UNIMOD:4 ms_run[1]:scan=1.1.6286.11 59.79688 2 1202.5724 1202.5714 K V 1320 1331 PSM QEMQEVQSSR 3185 sp|P22626-2|ROA2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6225.10 58.10723 2 1220.5442 1220.5455 R S 179 189 PSM QEMQEVQSSR 3186 sp|P22626-2|ROA2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6206.11 57.58227 2 1220.5442 1220.5455 R S 179 189 PSM GNWEQPQNQNQTQHK 3187 sp|Q14157-1|UBP2L_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6485.11 65.1586 3 1835.8243 1835.8299 R Q 12 27 PSM FSSSSGYGGGSSR 3188 sp|P35527|K1C9_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6399.10 62.8474 2 1234.5254 1234.5215 R V 47 60 PSM NTDVAQSPEAPK 3189 sp|Q9P2E9|RRBP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6343.10 61.34963 2 1255.6038 1255.6044 R Q 609 621 PSM LSNTGEYESQR 3190 sp|Q8N490-2|PNKD_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6445.10 64.0837 2 1282.5770 1282.5789 R F 113 124 PSM RQITQNTDYR 3191 sp|Q92896|GSLG1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6259.7 59.04323 3 1293.6412 1293.6425 K L 924 934 PSM ELRENTQTTIK 3192 sp|P61978|HNRPK_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6352.11 61.59777 2 1331.7050 1331.7045 K L 169 180 PSM DKEQELSEEDK 3193 sp|Q13200|PSMD2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6182.11 56.91637 2 1348.6002 1348.5994 K Q 40 51 PSM LDNTNEYNSNDGK 3194 sp|Q5T7N2|LITD1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6179.11 56.83328 2 1482.6228 1482.6223 K K 146 159 PSM TTASEPVEQSEATSK 3195 sp|Q15007|FL2D_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6262.11 59.13287 2 1563.7290 1563.7264 R D 254 269 PSM QNQTTSAVSTPASSETSK 3196 sp|P49792|RBP2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6396.11 62.77033 2 1822.8584 1822.8545 K A 1635 1653 PSM SKFEDMAK 3197 sp|P26583|HMGB2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6745.2 72.26808 3 954.4501 954.4480 K S 58 66 PSM LKPLGEAER 3198 sp|Q9BYT8|NEUL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6587.3 67.94685 3 1011.5716 1011.5713 K E 326 335 PSM SGHFEQAIK 3199 sp|Q01082-3|SPTB2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6553.2 67.01092 3 1015.5070 1015.5087 R E 678 687 PSM LLGVHTQTR 3200 sp|Q92925-2|SMRD2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6886.4 76.10612 3 1023.5836 1023.5825 R A 299 308 PSM IVAVTGAEAQK 3201 sp|P49588|SYAC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6811.4 74.07816 3 1085.6074 1085.6081 R A 752 763 PSM LKEELEEAR 3202 sp|Q04637-9|IF4G1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6764.4 72.78931 3 1115.5825 1115.5822 R D 887 896 PSM KGESGQSWPR 3203 sp|Q15185-3|TEBP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6586.5 67.9226 3 1130.5462 1130.5469 R L 79 89 PSM AGIIASAR 3204 sp|P13639|EF2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6699.4 71.00698 2 757.4446 757.4446 K A 43 51 PSM AGIIASAR 3205 sp|P13639|EF2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6680.3 70.48468 2 757.4446 757.4446 K A 43 51 PSM LTQDQDVDVK 3206 sp|P30153|2AAA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6595.2 68.16595 3 1159.5700 1159.5721 K Y 567 577 PSM IAVVGEGR 3207 sp|O75083|WDR1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6815.5 74.18895 2 799.4528 799.4552 R E 117 125 PSM ALQASALK 3208 sp|P04075-2|ALDOA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6841.4 74.87452 2 800.4742 800.4756 R A 359 367 PSM LTVAENEAETK 3209 sp|P07814|SYEP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6816.3 74.21262 3 1203.5917 1203.5983 K L 1390 1401 PSM THEAQIQEMR 3210 sp|P35579|MYH9_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6627.4 69.03687 3 1241.5828 1241.5822 K Q 1182 1192 PSM HVTSEQEWDK 3211 sp|P37268|FDFT_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6678.6 70.43483 3 1257.5641 1257.5626 K Y 161 171 PSM GGPGGELPR 3212 sp|Q04637-9|IF4G1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6805.4 73.91357 2 838.4286 838.4297 R G 693 702 PSM AIQGGTSHHLGQNFSK 3213 sp|P07814|SYEP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6869.7 75.64529 4 1680.8317 1680.8332 R M 1235 1251 PSM TAVAPIER 3214 sp|P12236|ADT3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6687.5 70.67976 2 855.4800 855.4814 K V 24 32 PSM VISELNGK 3215 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6829.8 74.56308 2 858.4806 858.4811 K N 42 50 PSM TGSAVAPVHPPNR 3216 sp|Q8IZL8|PELP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6673.6 70.29768 3 1301.6809 1301.6840 R S 49 62 PSM IEAIEGSR 3217 sp|P51784|UBP11_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6581.7 67.78815 2 873.4558 873.4556 R E 578 586 PSM QILSADDK 3218 sp|Q9Y3F4-2|STRAP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6630.5 69.12086 2 888.4560 888.4552 K T 170 178 PSM NVLCSACSGQGGK 3219 sp|O60884|DNJA2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 4-UNIMOD:4,7-UNIMOD:4 ms_run[1]:scan=1.1.6720.8 71.58904 3 1336.5883 1336.5864 K S 140 153 PSM ADYEIASK 3220 sp|Q9Y383-3|LC7L2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6864.4 75.50308 2 895.4256 895.4287 R E 66 74 PSM LAQLEEAK 3221 sp|P24539|AT5F1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6871.7 75.70018 2 900.4894 900.4916 K Q 132 140 PSM IEEELGSK 3222 sp|P06733|ENOA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6548.7 66.88177 2 903.4530 903.4549 R A 413 421 PSM SLESINSR 3223 sp|P62888|RL30_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6809.9 74.03178 2 904.4612 904.4614 K L 10 18 PSM ILTGTDAPK 3224 sp|P51532-2|SMCA4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6627.7 69.04187 2 914.5078 914.5073 K A 627 636 PSM VGTLVGEDK 3225 sp|Q9UI09-2|NDUAC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6727.9 71.78329 2 916.4872 916.4866 K Y 35 44 PSM LEQSTIVK 3226 sp|Q02790|FKBP4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6708.8 71.26037 2 916.5230 916.5229 K E 267 275 PSM TCDLVGEK 3227 sp|P20645|MPRD_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 2-UNIMOD:4 ms_run[1]:scan=1.1.6630.7 69.1242 2 920.4336 920.4273 K G 31 39 PSM SGSMDPSGAHPSVR 3228 sp|Q07666|KHDR1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6583.5 67.8399 3 1383.6208 1383.6201 R Q 18 32 PSM FNYSGSGGR 3229 sp|Q12906-7|ILF3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6706.5 71.20042 2 943.4102 943.4148 K S 811 820 PSM SAVEDEGLK 3230 sp|P0DMV8-2|HS71A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6578.9 67.70887 2 946.4606 946.4607 K G 496 505 PSM KNDIYGED 3231 sp|P50395|GDIB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6677.6 70.40742 2 952.4148 952.4138 K - 438 446 PSM ELAQQIQK 3232 sp|P60842-2|IF4A1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6582.7 67.81568 2 956.5282 956.5291 R V 111 119 PSM AFREEAIK 3233 sp|P13010|XRCC5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6736.2 72.0197 3 962.5180 962.5185 R F 641 649 PSM AQCPIVER 3234 sp|P46782|RS5_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 3-UNIMOD:4 ms_run[1]:scan=1.1.6645.9 69.53705 2 971.4878 971.4858 K L 64 72 PSM LLEGEEER 3235 sp|P20700|LMNB1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6687.7 70.6831 2 973.4710 973.4716 K L 380 388 PSM EYTAAVEAK 3236 sp|Q99623|PHB2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6544.10 66.77672 2 980.4794 980.4814 R Q 192 201 PSM EPSEVPTPK 3237 sp|P17096|HMGA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6714.7 71.42302 2 982.4958 982.4971 K R 47 56 PSM EPSEVPTPK 3238 sp|P17096|HMGA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6695.9 70.90552 2 982.4958 982.4971 K R 47 56 PSM QDQVCIAR 3239 sp|Q8IYD1|ERF3B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 5-UNIMOD:4 ms_run[1]:scan=1.1.6787.10 73.42945 2 988.4750 988.4760 K L 578 586 PSM VSSDVIDQK 3240 sp|Q9Y262|EIF3L_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6691.11 70.79915 2 989.4896 989.5029 R V 79 88 PSM GSGTAEVELK 3241 sp|P14618-2|KPYM_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6907.7 76.65974 2 989.5030 989.5029 K K 126 136 PSM VLEAAAQAAR 3242 sp|Q9NPD3|EXOS4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6779.10 73.20995 2 998.5480 998.5509 R D 213 223 PSM ALDCSSSIR 3243 sp|O94776|MTA2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 4-UNIMOD:4 ms_run[1]:scan=1.1.6730.9 71.86587 2 1007.4704 1007.4706 R Q 206 215 PSM TSMTEEYR 3244 sp|Q92945|FUBP2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6863.9 75.48383 2 1015.4282 1015.4280 R V 143 151 PSM GCLVTASADK 3245 sp|Q13610|PWP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 2-UNIMOD:4 ms_run[1]:scan=1.1.6644.10 69.5115 2 1020.4908 1020.4910 K Y 399 409 PSM SSAEVIAQAR 3246 sp|Q16555|DPYL2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 19 ms_run[1]:scan=1.1.6865.8 75.53715 2 1030.5361 1030.5402 K K 259 269 PSM FLNAENAQK 3247 sp|P43487-2|RANG_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6892.10 76.276 2 1033.5178 1033.5192 R F 142 151 PSM TKFENLCK 3248 sp|P07900-2|HS90A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 7-UNIMOD:4 ms_run[1]:scan=1.1.6841.10 74.88451 2 1038.5152 1038.5168 K I 688 696 PSM IAPPETPDSK 3249 sp|Q9NZI8|IF2B1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6891.9 76.24793 2 1053.5336 1053.5342 K V 441 451 PSM LAGENMTGAAK 3250 sp|O95831|AIFM1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6619.10 68.82735 2 1061.5178 1061.5175 R P 464 475 PSM QFIAAQGSSR 3251 sp|P07814|SYEP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6873.10 75.76005 2 1063.5406 1063.5410 K S 473 483 PSM HIHITQATETTTTR 3252 sp|Q14677-2|EPN4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6629.10 69.10177 3 1608.8191 1608.8220 K H 243 257 PSM LTIAEERDK 3253 sp|P62701|RS4X_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6558.10 67.16174 2 1073.5688 1073.5717 R R 246 255 PSM LAGESESNLR 3254 sp|P55072|TERA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6650.10 69.67496 2 1074.5312 1074.5305 K K 278 288 PSM IQEAGTEVVK 3255 sp|P40926-2|MDHM_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6713.10 71.40065 2 1072.5756 1072.5764 R A 188 198 PSM TENDHINLK 3256 sp|P55854-2|SUMO3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6546.3 66.82001 3 1082.5354 1082.5356 K V 12 21 PSM VDASACGMER 3257 sp|O95671-2|ASML_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 6-UNIMOD:4 ms_run[1]:scan=1.1.6531.10 66.41973 2 1094.4498 1094.4485 K L 312 322 PSM ADILEDKDGK 3258 sp|P52272|HNRPM_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6702.10 71.09937 2 1102.5460 1102.5506 R S 233 243 PSM LQDASAEVER 3259 sp|Q10589-2|BST2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6614.10 68.69445 2 1116.5416 1116.5411 K L 115 125 PSM ENQWCEEK 3260 sp|P63208|SKP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 5-UNIMOD:4 ms_run[1]:scan=1.1.6880.11 75.95387 2 1121.4432 1121.4447 K - 156 164 PSM QTFENQVNR 3261 sp|P24928|RPB1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6802.10 73.84143 2 1134.5378 1134.5418 R I 735 744 PSM MDETDASSAVK 3262 sp|Q13148|TADBP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6607.11 68.50982 2 1152.4966 1152.4969 K V 85 96 PSM SHEGETAYIR 3263 sp|Q07955|SRSF1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6631.10 69.15663 2 1161.5432 1161.5414 R V 182 192 PSM SHEGETSYIR 3264 sp|Q13242|SRSF9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6539.3 66.62785 3 1177.5358 1177.5363 R V 172 182 PSM DGGFCEVCKK 3265 sp|P07602-2|SAP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 5-UNIMOD:4,8-UNIMOD:4 ms_run[1]:scan=1.1.6784.11 73.34877 2 1198.5158 1198.5111 K L 407 417 PSM QVENAGAIGPSR 3266 sp|Q9UHD8|SEPT9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6745.11 72.28308 2 1197.6084 1197.6102 K F 118 130 PSM QVENAGAIGPSR 3267 sp|Q9UHD8|SEPT9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6744.11 72.25555 2 1197.6084 1197.6102 K F 118 130 PSM YLQDNPASGEK 3268 sp|Q16850-2|CP51A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6694.11 70.88147 2 1220.5674 1220.5673 R F 327 338 PSM DICACAATGTGK 3269 sp|Q96GQ7|DDX27_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 3-UNIMOD:4,5-UNIMOD:4 ms_run[1]:scan=1.1.6816.11 74.22595 2 1223.5280 1223.5275 K T 257 269 PSM TFVSGACDASSK 3270 sp|Q9HAV0|GBB4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 7-UNIMOD:4 ms_run[1]:scan=1.1.6863.11 75.48717 2 1228.5386 1228.5394 R L 198 210 PSM TYGEPESAGPSR 3271 sp|P50402|EMD_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6556.11 67.10838 2 1249.5558 1249.5575 R A 104 116 PSM ESQTQDNITVR 3272 sp|Q92900-2|RENT1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6774.11 73.07446 2 1289.6194 1289.6212 K W 322 333 PSM SPGSPVGEGTGSPPK 3273 sp|P35611-2|ADDA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6569.10 67.46352 2 1352.6592 1352.6572 R W 355 370 PSM EDGSGDRGDGPFR 3274 sp|P13010|XRCC5_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6821.9 74.35595 3 1363.5733 1363.5753 K L 172 185 PSM SGDETPGSEVPGDK 3275 sp|Q1KMD3|HNRL2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6616.11 68.74883 2 1373.5958 1373.5947 R A 161 175 PSM FSPGAPGGSGSQPNQK 3276 sp|Q15942|ZYX_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6641.11 69.43163 2 1514.7054 1514.7114 K L 280 296 PSM RLQTQVFK 3277 sp|P46781|RS9_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7282.2 86.74838 3 1018.5913 1018.5924 R L 109 117 PSM LAQALHEMR 3278 sp|P20700|LMNB1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7087.2 81.47945 3 1067.5540 1067.5546 K E 242 251 PSM DKDPPIPVAK 3279 sp|P13667|PDIA4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7131.3 82.66933 3 1078.6018 1078.6022 K I 110 120 PSM GSEHQAIVQHLEK 3280 sp|Q14690|RRP5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7058.7 80.71111 4 1474.7497 1474.7528 K S 925 938 PSM VHELNEEIGK 3281 sp|Q9Y383-3|LC7L2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7157.3 83.37552 3 1166.5939 1166.5931 R L 123 133 PSM HQGVMVGMGQK 3282 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6981.3 78.6354 3 1170.5842 1170.5638 R D 40 51 PSM AVAILCNHQR 3283 sp|P11387|TOP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 6-UNIMOD:4 ms_run[1]:scan=1.1.7150.4 83.1883 3 1180.6135 1180.6135 R A 625 635 PSM AIEALSGK 3284 sp|O00425|IF2B3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7000.5 79.15826 2 787.4434 787.4439 K I 53 61 PSM EDRYEEEIK 3285 sp|P09493-3|TPM1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7121.6 82.40687 3 1209.5506 1209.5513 K V 218 227 PSM SVSLVGEDERK 3286 sp|Q96GQ7|DDX27_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6973.5 78.41965 3 1217.6233 1217.6252 R M 563 574 PSM HVGDLGNVTADK 3287 sp|P00441|SODC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7272.3 86.47377 3 1224.6082 1224.6099 R D 81 93 PSM VGFAEAAR 3288 sp|P07339|CATD_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7278.4 86.64143 2 819.4214 819.4239 R L 404 412 PSM STESLQANVQR 3289 sp|P26373|RL13_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6987.6 78.80485 3 1231.6153 1231.6157 K L 106 117 PSM AHQITDESLESTRR 3290 sp|O00161-2|SNP23_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7087.5 81.48445 4 1641.7977 1641.8070 R I 13 27 PSM AYGPGLEK 3291 sp|O75369-2|FLNB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6989.6 78.85957 2 833.4264 833.4283 R S 650 658 PSM VGEVIVTK 3292 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7065.6 80.89619 2 843.5070 843.5066 K D 345 353 PSM AVVVVDDR 3293 sp|Q8WXF1|PSPC1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6990.6 78.88689 2 871.4770 871.4763 K G 185 193 PSM PFGNSISR 3294 sp|Q14739|LBR_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7196.6 84.40635 2 876.4458 876.4454 K Y 124 132 PSM SSELQAIK 3295 sp|Q9UKM9-2|RALY_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7196.5 84.40469 2 874.4726 874.4760 K T 168 176 PSM AKLEEQAQQIR 3296 sp|P02649|APOE_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7035.6 80.08408 3 1312.7089 1312.7099 R L 259 270 PSM VLDSGAPIK 3297 sp|P06576|ATPB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7287.8 86.89581 2 898.5118 898.5124 K I 125 134 PSM KESEAVEWQQK 3298 sp|P26038|MOES_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7178.5 83.92265 3 1360.6615 1360.6623 K A 438 449 PSM VARPLPAEEPER 3299 sp|P26358|DNMT1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6967.5 78.25562 3 1362.7240 1362.7255 R A 213 225 PSM TDEGIAYR 3300 sp|P32119|PRDX2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7038.5 80.16364 2 923.4344 923.4348 K G 120 128 PSM IDDVVNTR 3301 sp|P50991|TCPD_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7000.10 79.1666 2 930.4788 930.4771 K - 532 540 PSM VSQVIMEK 3302 sp|O75475|PSIP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7069.7 81.00405 2 932.4992 932.5001 K S 408 416 PSM RAGELTEDEVER 3303 sp|P62269|RS18_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7130.5 82.64592 3 1402.6699 1402.6688 K V 55 67 PSM EIAENALGK 3304 sp|P31942-2|HNRH3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7259.8 86.12483 2 943.4980 943.4974 K H 68 77 PSM EGSLVINSK 3305 sp|Q9Y5B9|SP16H_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7166.9 83.61903 2 945.5134 945.5131 R N 358 367 PSM VTTVTEIGK 3306 sp|P53621-2|COPA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7223.6 85.13744 2 946.5326 946.5335 R D 1212 1221 PSM MGPGAASGGERPNLK 3307 sp|Q9H0U4|RAB1B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7003.5 79.23825 3 1440.7117 1440.7143 R I 173 188 PSM ANGMELDGR 3308 sp|P62995-3|TRA2B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7112.8 82.16953 2 961.4358 961.4287 R R 79 88 PSM ADMETLQR 3309 sp|P26639-2|SYTC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7166.11 83.62237 2 962.4488 962.4491 K I 322 330 PSM CAMTALSSK 3310 sp|Q99832-3|TCPH_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 1-UNIMOD:4 ms_run[1]:scan=1.1.7122.7 82.43518 2 967.4470 967.4467 K L 114 123 PSM ELAEAVAGGR 3311 sp|Q9UBT2|SAE2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7235.7 85.46606 2 971.5010 971.5036 R V 10 20 PSM LEGVDEATR 3312 sp|P22570-3|ADRO_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6961.7 78.09695 2 988.4824 988.4825 R A 376 385 PSM LQSIGTENTEENR 3313 sp|P04075-2|ALDOA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7098.10 81.79224 3 1489.7029 1489.7008 R R 98 111 PSM ILQEGVDPK 3314 sp|P40939|ECHA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7052.8 80.5496 2 997.5434 997.5444 R K 561 570 PSM TVPVEAVTSK 3315 sp|Q14247|SRC8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7261.8 86.17948 2 1029.5696 1029.5706 K T 337 347 PSM ELLSAEENK 3316 sp|Q9NWH9|SLTM_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7228.8 85.27683 2 1031.5138 1031.5135 K R 141 150 PSM TTYGGAAAAVR 3317 sp|P49790-2|NU153_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6947.8 77.72248 2 1036.5274 1036.5302 K Q 264 275 PSM VIVGGSSEYK 3318 sp|Q14683|SMC1A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7056.7 80.65691 2 1037.5374 1037.5393 R I 97 107 PSM ENPYYDSR 3319 sp|Q00610-2|CLH1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6980.9 78.61795 2 1042.4346 1042.4356 R V 896 904 PSM IYGESADAVK 3320 sp|P51114|FXR1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7151.9 83.2241 2 1051.5188 1051.5186 R K 264 274 PSM YGQNGDFTR 3321 sp|O76094|SRP72_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7009.11 79.40645 2 1056.4646 1056.4625 R A 21 30 PSM DYGNSPLHR 3322 sp|P26599-2|PTBP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6938.4 77.47272 3 1057.4929 1057.4941 K F 448 457 PSM CVVVGDGAVGK 3323 sp|P60953|CDC42_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 1-UNIMOD:4 ms_run[1]:scan=1.1.7290.8 86.97807 2 1059.5376 1059.5383 K T 6 17 PSM QVSDDLTER 3324 sp|P35232|PHB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7117.11 82.30842 2 1061.4982 1061.4989 R A 149 158 PSM NMMAACDPR 3325 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 6-UNIMOD:4 ms_run[1]:scan=1.1.7196.8 84.40968 2 1064.4198 1064.4201 K H 298 307 PSM DPSQQELPR 3326 sp|P49327|FAS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7086.10 81.46543 2 1068.5208 1068.5200 R L 1172 1181 PSM ENAEQGEVDMESHR 3327 sp|P14209-3|CD99_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7101.11 81.87563 3 1629.6760 1629.6689 K N 141 155 PSM NELQQTINK 3328 sp|O14777|NDC80_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7247.10 85.79929 2 1086.5652 1086.5669 R L 374 383 PSM LTAEEMDER 3329 sp|P46940|IQGA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7239.9 85.5788 2 1092.4822 1092.4757 R R 26 35 PSM QEYDESGPSIVHRK 3330 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7241.10 85.63515 3 1643.7910 1643.7903 K C 360 374 PSM NMMAACDPR 3331 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 2-UNIMOD:35,3-UNIMOD:35,6-UNIMOD:4 ms_run[1]:scan=1.1.7198.10 84.46747 2 1096.4094 1096.4100 K H 298 307 PSM VEDFTQNPR 3332 sp|Q8IY37|DHX37_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7191.9 84.27552 2 1104.5226 1104.5200 R L 413 422 PSM TTVVYPATEK 3333 sp|Q96C86|DCPS_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7243.10 85.6899 2 1107.5804 1107.5812 K H 129 139 PSM RGLQATQLAR 3334 sp|Q8NFU3-2|TSTD1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6964.3 78.17104 3 1112.6413 1112.6414 K S 43 53 PSM NYTDNELEK 3335 sp|P00367|DHE3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7189.9 84.22131 2 1124.4984 1124.4986 K I 192 201 PSM ALELDSNNEK 3336 sp|Q02790|FKBP4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7219.10 85.03606 2 1131.5414 1131.5407 K G 345 355 PSM AVAILCNHQR 3337 sp|P11387|TOP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 6-UNIMOD:4 ms_run[1]:scan=1.1.7136.11 82.8174 2 1180.6140 1180.6135 R A 625 635 PSM HQGVMVGMGQK 3338 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 8-UNIMOD:35 ms_run[1]:scan=1.1.6927.4 77.17715 3 1186.5595 1186.5587 R D 40 51 PSM GRPYDYNGPR 3339 sp|P13667|PDIA4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7233.10 85.41642 2 1193.5586 1193.5578 K E 261 271 PSM NLQEGQVTDPR 3340 sp|Q92600-2|CNOT9_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7254.10 85.99108 2 1255.6156 1255.6157 K G 314 325 PSM DCPLNAEAASSK 3341 sp|Q10567-2|AP1B1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 2-UNIMOD:4 ms_run[1]:scan=1.1.7014.11 79.53788 2 1261.5628 1261.5608 R L 858 870 PSM NMSVIAHVDHGK 3342 sp|P13639|EF2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7228.10 85.28017 2 1306.6374 1306.6452 R S 21 33 PSM MDSTANEVEAVK 3343 sp|P07237|PDIA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 1-UNIMOD:35 ms_run[1]:scan=1.1.7103.10 81.92834 2 1308.5906 1308.5867 K V 425 437 PSM DEFTNTCPSDK 3344 sp|Q9Y696|CLIC4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 7-UNIMOD:4 ms_run[1]:scan=1.1.7091.11 81.60347 2 1312.5254 1312.5242 R E 228 239 PSM DVEGSTSPQIGDK 3345 sp|O75534-2|CSDE1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7052.10 80.55293 2 1331.6226 1331.6205 K V 445 458 PSM TIEAEAAHGTVTR 3346 sp|P48735|IDHP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6958.11 78.02337 2 1354.6814 1354.6841 K H 341 354 PSM HEQNIDCGGGYVK 3347 sp|P27797|CALR_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 7-UNIMOD:4 ms_run[1]:scan=1.1.7017.7 79.60982 3 1475.6473 1475.6463 K L 99 112 PSM ADTTSTVTPVPGQEK 3348 sp|Q9H9B1|EHMT1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7131.11 82.68266 2 1529.7548 1529.7573 K G 645 660 PSM LFQECCPHSTDR 3349 sp|P61978|HNRPK_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 5-UNIMOD:4,6-UNIMOD:4 ms_run[1]:scan=1.1.7281.9 86.73248 3 1548.6439 1548.6450 K V 180 192 PSM YHPGYFGK 3350 sp|P46776|RL27A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7695.2 97.84502 3 967.4539 967.4552 K V 48 56 PSM REQEVNILK 3351 sp|P35579|MYH9_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7599.3 95.23817 3 1127.6248 1127.6298 K K 1165 1174 PSM FEAFEHENK 3352 sp|Q9UBQ0-2|VPS29_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7426.3 90.56776 3 1149.5089 1149.5091 K F 123 132 PSM LEHEVDLCR 3353 sp|Q7Z6Z7-2|HUWE1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 8-UNIMOD:4 ms_run[1]:scan=1.1.7538.2 93.57211 3 1169.5483 1169.5499 R K 460 469 PSM PIHQGPDAAVTGHIR 3354 sp|P53618|COPB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7463.5 91.53522 4 1567.8209 1567.8219 K I 914 929 PSM LACDVDQVTR 3355 sp|P78527|PRKDC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 3-UNIMOD:4 ms_run[1]:scan=1.1.7641.3 96.37223 3 1175.5588 1175.5605 R Q 972 982 PSM RAAVLLEQER 3356 sp|Q13435|SF3B2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7487.3 92.18559 3 1183.6651 1183.6673 K Q 183 193 PSM QGGLGPIR 3357 sp|Q13162|PRDX4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7547.5 93.82278 2 796.4512 796.4555 R I 166 174 PSM ILTTASSHEFEHTK 3358 sp|Q16851|UGPA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7503.4 92.62352 4 1599.7837 1599.7893 K K 39 53 PSM LNEQQSVLQR 3359 sp|Q14683|SMC1A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7663.3 96.97253 3 1213.6354 1213.6415 K I 1010 1020 PSM ILSGVVTK 3360 sp|P62280|RS11_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7573.6 94.53692 2 815.5112 815.5117 R M 72 80 PSM VEIIANDQGNR 3361 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7442.6 90.98457 3 1227.6205 1227.6207 R I 26 37 PSM DHPLPEVAHVK 3362 sp|P13073|COX41_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7542.7 93.68964 3 1240.6531 1240.6564 R H 43 54 PSM TNQELQEINR 3363 sp|P07355-2|ANXA2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7672.6 97.22478 3 1243.6159 1243.6156 R V 154 164 PSM AVTEVLAR 3364 sp|Q99961-3|SH3G1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7678.4 97.3862 2 857.4968 857.4971 K T 46 54 PSM ELNITAAK 3365 sp|P62081|RS7_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7578.4 94.67068 2 858.4804 858.4810 R E 42 50 PSM ICAVGITK 3366 sp|P55060-3|XPO2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 2-UNIMOD:4 ms_run[1]:scan=1.1.7503.6 92.62685 2 860.4784 860.4790 K L 841 849 PSM DREEALHQFR 3367 sp|O00571-2|DDX3X_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7543.6 93.71525 3 1299.6274 1299.6320 R S 463 473 PSM GYDDRDYYSR 3368 sp|P62995-3|TRA2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7636.5 96.23885 3 1308.5338 1308.5371 R S 129 139 PSM ASLCISTK 3369 sp|P09874|PARP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 4-UNIMOD:4 ms_run[1]:scan=1.1.7406.6 90.05466 2 878.4526 878.4531 K K 426 434 PSM GNLGAGNGNLQGPR 3370 sp|P43243|MATR3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7358.7 88.81215 3 1323.6832 1323.6644 R H 374 388 PSM SQLLGSAHEVQR 3371 sp|Q13813|SPTN1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7340.8 88.33643 3 1323.6832 1323.6895 R F 1226 1238 PSM EALLQASR 3372 sp|P26038|MOES_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7330.3 88.06163 2 886.4840 886.4872 K D 401 409 PSM AVVIVDDR 3373 sp|P23246|SFPQ_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7656.4 96.78267 2 885.4900 885.4920 R G 400 408 PSM EFSGNPIK 3374 sp|P35637-2|FUS_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7649.5 96.59338 2 890.4482 890.4498 K V 357 365 PSM FADGEVVR 3375 sp|Q14739|LBR_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7451.6 91.2182 2 891.4424 891.4450 K G 6 14 PSM QTATQLLK 3376 sp|P62424|RL7A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7559.7 94.15463 2 901.5220 901.5233 R L 90 98 PSM QTATQLLK 3377 sp|P62424|RL7A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7539.6 93.60609 2 901.5220 901.5233 R L 90 98 PSM QTATQLLK 3378 sp|P62424|RL7A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7558.5 94.12382 2 901.5220 901.5233 R L 90 98 PSM QLQLEAEEQRK 3379 sp|Q8N1G4|LRC47_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7523.5 93.16908 3 1370.7124 1370.7153 R Q 415 426 PSM QHEADADLINAGK 3380 sp|P55809|SCOT1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7570.6 94.4547 3 1380.6667 1380.6633 R E 356 369 PSM SDPVVSYR 3381 sp|P13639|EF2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7387.5 89.56815 2 921.4550 921.4556 K E 573 581 PSM SEGELLER 3382 sp|A1X283|SPD2B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7685.6 97.58006 2 931.4742 931.4610 K E 532 540 PSM EVVQNFAK 3383 sp|Q14019|COTL1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7449.4 91.16278 2 933.4902 933.4920 K E 103 111 PSM DPVSIEER 3384 sp|P55884-2|EIF3B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7438.7 90.88312 2 943.4588 943.4611 K A 325 333 PSM TIDDLEDK 3385 sp|P06753-2|TPM3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7376.8 89.29155 2 947.4444 947.4447 K L 216 224 PSM AVVVCPKDEDYK 3386 sp|Q00839|HNRPU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 5-UNIMOD:4 ms_run[1]:scan=1.1.7497.6 92.4639 3 1421.6839 1421.6861 K Q 603 615 PSM SIDDLEEK 3387 sp|P09493-3|TPM1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7603.8 95.35247 2 947.4440 947.4447 K V 252 260 PSM AVVVCPKDEDYK 3388 sp|Q00839|HNRPU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 5-UNIMOD:4 ms_run[1]:scan=1.1.7478.2 91.93768 3 1421.6839 1421.6861 K Q 603 615 PSM AQADLALEK 3389 sp|Q14980|NUMA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7531.7 93.38993 2 957.4968 957.5131 R A 1016 1025 PSM ALELENDR 3390 sp|Q03252|LMNB2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7645.8 96.48959 2 958.4702 958.4719 R L 66 74 PSM TIDDLEEK 3391 sp|P67936|TPM4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7381.9 89.42178 2 961.4600 961.4604 K L 216 224 PSM ELSAALQDK 3392 sp|Q14980|NUMA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7587.7 94.9215 2 973.5018 973.5080 K K 365 374 PSM KVVVYLQK 3393 sp|P53634|CATC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7445.7 91.06387 2 975.6108 975.6117 K L 63 71 PSM IDVGEAEPR 3394 sp|P54577|SYYC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7551.7 93.93552 2 984.4862 984.4876 K T 392 401 PSM DSQICELK 3395 sp|P55145|MANF_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 5-UNIMOD:4 ms_run[1]:scan=1.1.7557.9 94.10303 2 991.4610 991.4644 K Y 113 121 PSM QAGPASVPLR 3396 sp|P30101|PDIA3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7650.7 96.624 2 994.5534 994.5560 K T 131 141 PSM DYDDMSPR 3397 sp|P61978|HNRPK_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7422.7 90.47198 2 997.3810 997.3811 R R 279 287 PSM ALADTENLR 3398 sp|Q9HAV7|GRPE1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7670.8 97.17297 2 1001.5112 1001.5141 R Q 81 90 PSM AYDLAGSCR 3399 sp|Q02880-2|TOP2B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 8-UNIMOD:4 ms_run[1]:scan=1.1.7416.7 90.31838 2 1011.4418 1011.4444 R G 259 268 PSM DSSDPNELYVNHK 3400 sp|O15160-2|RPAC1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7659.6 96.86805 3 1516.6768 1516.6794 K V 155 168 PSM ESSSIYISK 3401 sp|O60701|UGDH_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7367.8 89.05292 2 1012.5072 1012.5077 R Y 347 356 PSM LLQTSNITK 3402 sp|Q13153-2|PAK1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7533.7 93.44444 2 1016.5854 1016.5866 R S 106 115 PSM SLQSVAEER 3403 sp|P61313|RL15_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7577.10 94.6534 2 1017.5058 1017.5091 R A 97 106 PSM GETQGLLTAK 3404 sp|Q8IX01-3|SUGP2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7704.10 98.10247 2 1016.5394 1016.5502 K G 229 239 PSM TLLEAENSR 3405 sp|P48681|NEST_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7482.9 92.0587 2 1031.5218 1031.5247 R L 304 313 PSM YRPGTVALR 3406 sp|Q71DI3|H32_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7329.4 88.03637 3 1031.5873 1031.5876 R E 42 51 PSM GLESTTLADK 3407 sp|P21291|CSRP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7643.9 96.43681 2 1033.5272 1033.5291 K D 152 162 PSM SVTEQGAELSNEER 3408 sp|P63104|1433Z_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7710.8 98.26315 3 1547.7037 1547.7063 K N 28 42 PSM YRPGTVALR 3409 sp|Q71DI3|H32_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7325.9 87.93615 2 1031.5864 1031.5876 R E 42 51 PSM LFEQNVQR 3410 sp|P61081|UBC12_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7668.6 97.11463 2 1032.5310 1032.5352 R S 159 167 PSM EGDLIAAQAR 3411 sp|P02545-2|LMNA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7707.8 98.18127 2 1042.5378 1042.5407 K L 124 134 PSM SEVATLTAAGK 3412 sp|P36542-2|ATPG_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7715.10 98.40303 2 1046.5580 1046.5608 K E 116 127 PSM YGSIVDDER 3413 sp|Q13576|IQGA2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7642.8 96.40775 2 1052.4778 1052.4774 R L 14 23 PSM NDNDTFTVK 3414 sp|P21333-2|FLNA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7487.7 92.19225 2 1052.4736 1052.4775 R Y 829 838 PSM VVLIGGKPDR 3415 sp|P61978|HNRPK_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7325.3 87.92615 3 1052.6329 1052.6342 R V 192 202 PSM TGYGGGFNER 3416 sp|O95218-2|ZRAB2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7572.7 94.51117 2 1056.4626 1056.4625 R E 100 110 PSM GEEILSGAQR 3417 sp|P14868|SYDC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7569.8 94.4306 2 1058.5350 1058.5356 R I 422 432 PSM QPDSGISSIR 3418 sp|P04843|RPN1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7588.7 94.94885 2 1058.5350 1058.5356 R S 269 279 PSM LLACGDVEGK 3419 sp|Q69YN2|C19L1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 4-UNIMOD:4 ms_run[1]:scan=1.1.7556.9 94.07571 2 1060.5172 1060.5223 R F 8 18 PSM LGEYEDVSR 3420 sp|Q99426|TBCB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7615.8 95.67146 2 1066.4902 1066.4931 R V 95 104 PSM LGTQTFCSR 3421 sp|Q9BSJ8-2|ESYT1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 7-UNIMOD:4 ms_run[1]:scan=1.1.7629.6 96.04898 2 1068.5006 1068.5022 R V 364 373 PSM IATGQIAGVDK 3422 sp|Q9HC35-2|EMAL4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7697.7 97.90743 2 1071.5912 1071.5924 R D 266 277 PSM AAPGAEFAPNK 3423 sp|Q15233-2|NONO_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7568.9 94.40473 2 1071.5416 1071.5349 R R 368 379 PSM IMATPEQVGK 3424 sp|P12956-2|XRCC6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7477.9 91.9222 2 1072.5550 1072.5587 K M 411 421 PSM DVDEAYMNK 3425 sp|P05787-2|K2C8_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7625.8 95.94265 2 1083.4524 1083.4543 K V 227 236 PSM LQGQLEQGDDTAAER 3426 sp|Q8NE71-2|ABCF1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7326.7 87.96014 3 1629.7687 1629.7594 R L 359 374 PSM SLETENAGLR 3427 sp|P02545-2|LMNA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7544.9 93.74762 2 1088.5424 1088.5462 R L 51 61 PSM FNEGVSNAVR 3428 sp|Q8WVB6-2|CTF18_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7501.9 92.57757 2 1091.5338 1091.5360 R R 985 995 PSM NTSAAIQAYR 3429 sp|Q9UJX2-3|CDC23_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7492.10 92.33418 2 1093.5480 1093.5516 K H 262 272 PSM INQLYEQAK 3430 sp|Q96AC1-2|FERM2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7498.10 92.49776 2 1105.5700 1105.5767 R W 291 300 PSM AIEPNDYTGK 3431 sp|O75223|GGCT_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7335.10 88.20717 2 1106.5246 1106.5244 K V 162 172 PSM DANNGNLQLR 3432 sp|P05455|LA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7496.9 92.44172 2 1113.5498 1113.5527 K N 288 298 PSM PAVVETVTTAK 3433 sp|P56192|SYMC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7570.10 94.46136 2 1114.6212 1114.6234 K P 828 839 PSM LASAAYPDPSK 3434 sp|P54577|SYYC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7411.10 90.1923 2 1118.5552 1118.5608 K Q 336 347 PSM GMGPGTPAGYGR 3435 sp|P23246|SFPQ_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7635.11 96.22148 2 1119.5116 1119.5131 R G 682 694 PSM ALANSLACQGK 3436 sp|P04075-2|ALDOA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 8-UNIMOD:4 ms_run[1]:scan=1.1.7337.10 88.26037 2 1131.5702 1131.5706 R Y 386 397 PSM ALANSLACQGK 3437 sp|P04075-2|ALDOA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 8-UNIMOD:4 ms_run[1]:scan=1.1.7341.11 88.36784 2 1131.5702 1131.5706 R Y 386 397 PSM YDERPGPSPLPHR 3438 sp|P08621|RU17_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7455.4 91.31962 4 1519.7505 1519.7532 R D 219 232 PSM VEVEEDGQLK 3439 sp|O75190-3|DNJB6_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7579.11 94.70975 2 1144.5572 1144.5612 R S 216 226 PSM EVANSTANLVK 3440 sp|Q9Y490|TLN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7357.10 88.79053 2 1144.6072 1144.6088 K T 1531 1542 PSM GTPQQIDYAR 3441 sp|Q96AE4-2|FUBP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7473.7 91.80994 2 1147.5582 1147.5622 R Q 430 440 PSM NTTGVTEEALK 3442 sp|Q13813|SPTN1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7398.5 89.8547 2 1161.5852 1161.5877 R E 2316 2327 PSM RAADEVLAEAK 3443 sp|Q6P1J9|CDC73_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7632.10 96.13792 2 1171.6180 1171.6197 K K 126 137 PSM DYLEDQQGGR 3444 sp|P37268|FDFT_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7394.11 89.75618 2 1179.5162 1179.5156 R E 219 229 PSM IKEENFVSPK 3445 sp|O00425|IF2B3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7571.10 94.48878 2 1189.6328 1189.6343 K E 474 484 PSM SGTVDPQELQK 3446 sp|P30626-2|SORCN_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7351.8 88.62791 2 1200.5964 1200.5986 R A 102 113 PSM ASDPGLPAEEPK 3447 sp|P27708|PYR1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7614.10 95.64809 2 1209.5834 1209.5877 R E 1858 1870 PSM AYTGFSSNSER 3448 sp|O15355|PPM1G_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7344.10 88.44563 2 1217.5300 1217.5313 K G 210 221 PSM LRDTEEMLSK 3449 sp|Q9H444|CHM4B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7533.2 93.4361 3 1220.6062 1220.6071 R K 29 39 PSM HSLNSSSASTTEPDFQK 3450 sp|P42704|LPPRC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7607.10 95.46178 3 1834.8322 1834.8333 K D 1021 1038 PSM NIPEDNADMAR 3451 sp|P31939-2|PUR9_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7448.10 91.14671 2 1244.5452 1244.5455 R L 79 90 PSM SLLEGEGSSGGGGR 3452 sp|P13645|K1C10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7363.11 88.95145 2 1261.5882 1261.5899 R G 451 465 PSM TIIQNPTDQQK 3453 sp|Q9UQ80|PA2G4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7504.11 92.66222 2 1284.6654 1284.6674 K K 200 211 PSM ITAMDTEDQGVK 3454 sp|Q9H6Z4-2|RANB3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7503.11 92.63519 2 1306.6074 1306.6075 R V 470 482 PSM FQASQGENLEGK 3455 sp|Q7Z3K3-2|POGZ_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7419.5 90.39864 2 1306.6122 1306.6153 R Y 957 969 PSM LRPESALAQAQK 3456 sp|O94826|TOM70_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7545.10 93.77652 2 1310.7300 1310.7306 R C 430 442 PSM VQENSAYICSR 3457 sp|Q9Y3T9|NOC2L_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 9-UNIMOD:4 ms_run[1]:scan=1.1.7331.10 88.10023 2 1325.6030 1325.6034 K R 577 588 PSM EQSGPSPLEETR 3458 sp|Q9NY26-2|S39A1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7473.11 91.8166 2 1328.6190 1328.6208 K A 33 45 PSM NNASTDYDLSDK 3459 sp|P39023|RL3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7500.11 92.55376 2 1341.5662 1341.5684 K S 301 313 PSM EAECKIAEAEAK 3460 sp|Q9NZ09-2|UBAP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 4-UNIMOD:4 ms_run[1]:scan=1.1.7624.5 95.91032 3 1347.6118 1347.6340 R V 78 90 PSM EEAGGEAAAAAAAER 3461 sp|O14497|ARI1A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7657.11 96.82165 2 1372.6200 1372.6218 R G 33 48 PSM QSVENDIHGLRK 3462 sp|P05783|K1C18_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7592.11 95.06406 2 1394.7222 1394.7266 R V 176 188 PSM AEEDTQFNYHR 3463 sp|Q14683|SMC1A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7601.8 95.29957 3 1408.5976 1408.6007 K K 178 189 PSM ALYEHLTAK 3464 sp|P42704|LPPRC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7976.2 105.4895 3 1044.5584 1044.5604 K N 1339 1348 PSM TALIHDGLAR 3465 sp|P25398|RS12_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8008.3 106.3622 3 1065.5908 1065.5931 K G 24 34 PSM DHNIPGELER 3466 sp|P35580-3|MYH10_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8065.2 107.8946 3 1178.5678 1178.5680 K Q 207 217 PSM DHNIPGELER 3467 sp|P35580-3|MYH10_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8050.3 107.5059 3 1178.5678 1178.5680 K Q 207 217 PSM VTVAGLAGK 3468 sp|Q99497|PARK7_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8083.5 108.3611 2 814.4892 814.4913 K D 33 42 PSM HRPELIDYGK 3469 sp|P12814-2|ACTN1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7884.3 102.9703 3 1226.6359 1226.6407 R L 186 196 PSM HRPELIDYGK 3470 sp|P12814-2|ACTN1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7903.4 103.4934 3 1226.6359 1226.6407 R L 186 196 PSM IGVLDEGK 3471 sp|P46781|RS9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7944.5 104.618 2 829.4530 829.4545 R M 84 92 PSM ASALACLK 3472 sp|P10515|ODP2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 6-UNIMOD:4 ms_run[1]:scan=1.1.7988.3 105.8178 2 832.4450 832.4476 K V 483 491 PSM GTVIIIANHGDR 3473 sp|Q16851|UGPA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8056.3 107.6638 3 1264.6864 1264.6888 K I 474 486 PSM ATFDAISK 3474 sp|P15880|RS2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7914.7 103.7999 2 851.4372 851.4389 K T 239 247 PSM CLADAVVK 3475 sp|Q5TGZ0-2|MIC10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 1-UNIMOD:4 ms_run[1]:scan=1.1.7998.5 106.0929 2 874.4552 874.4582 R I 13 21 PSM SSVINSIR 3476 sp|Q5T7N2|LITD1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7900.6 103.4144 2 874.4846 874.4872 R E 619 627 PSM LGAPALTSR 3477 sp|P34897-2|GLYM_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7998.6 106.0946 2 884.5020 884.5080 R Q 416 425 PSM LRQENIELGEK 3478 sp|Q9NUQ3-2|TXLNG_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7862.5 102.3682 3 1327.7068 1327.7095 K L 133 144 PSM NLDGISHAPNAVK 3479 sp|Q92820|GGH_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7900.8 103.4177 3 1334.6911 1334.6942 K T 254 267 PSM LSPDAIPGK 3480 sp|P49327|FAS_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7725.5 98.66801 2 896.4948 896.4967 K W 1583 1592 PSM FCLDNGAK 3481 sp|P00558-2|PGK1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 2-UNIMOD:4 ms_run[1]:scan=1.1.7842.5 101.8208 2 923.4156 923.4171 K S 21 29 PSM IFEPPPPK 3482 sp|O43143|DHX15_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7919.5 103.9335 2 923.5106 923.5116 R K 400 408 PSM LCTVATLR 3483 sp|P02768|ALBU_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 2-UNIMOD:4 ms_run[1]:scan=1.1.8022.6 106.7512 2 932.5104 932.5113 K E 98 106 PSM VPPPPPIAR 3484 sp|P07910-2|HNRPC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7754.5 99.46201 2 942.5630 942.5651 R A 130 139 PSM SDLTVDAVK 3485 sp|Q5JTH9-2|RRP12_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7938.7 104.4574 2 946.4944 946.4971 R L 49 58 PSM EASFDGISK 3486 sp|P12955-2|PEPD_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8079.6 108.2602 2 952.4474 952.4502 R F 160 169 PSM FGSGMNMGR 3487 sp|P52272|HNRPM_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8019.6 106.6686 2 955.3986 955.4004 R I 363 372 PSM NTDVVATLK 3488 sp|Q7Z4V5-3|HDGR2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8080.3 108.2875 2 959.5258 959.5288 K K 516 525 PSM SIEVIENR 3489 sp|P49321|NASP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7971.5 105.3583 2 958.5066 958.5083 K M 610 618 PSM NTDVVATLK 3490 sp|Q7Z4V5-3|HDGR2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8073.5 108.1049 2 959.5258 959.5288 K K 516 525 PSM LGYTPVCR 3491 sp|Q15102|PA1B3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 7-UNIMOD:4 ms_run[1]:scan=1.1.7939.8 104.4865 2 964.4802 964.4800 R A 199 207 PSM GGGQIIPTAR 3492 sp|P13639|EF2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7767.8 99.80722 2 968.5380 968.5403 R R 717 727 PSM VAVVNQIAR 3493 sp|Q01082-3|SPTB2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7952.4 104.8358 2 968.5750 968.5767 R Q 892 901 PSM ILESVAEGR 3494 sp|Q9UJV9|DDX41_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7752.6 99.40894 2 972.5402 972.5240 K A 116 125 PSM SEGFDTYR 3495 sp|P12004|PCNA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7977.8 105.5267 2 973.4140 973.4141 R C 54 62 PSM SEGFDTYR 3496 sp|P12004|PCNA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7996.7 106.0418 2 973.4116 973.4141 R C 54 62 PSM QMVETELK 3497 sp|P62258|1433E_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7726.6 98.69698 2 976.4904 976.4899 R L 87 95 PSM QYVYNVAK 3498 sp|P26440|IVD_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7773.6 99.96059 2 983.4912 983.5076 R A 341 349 PSM SGTSEFLNK 3499 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7746.7 99.24592 2 981.4746 981.4767 K M 169 178 PSM AIYQATYR 3500 sp|P28074|PSB5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7859.8 102.2909 2 984.5008 984.5029 R D 218 226 PSM LQELEGAVK 3501 sp|P35580-3|MYH10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7978.9 105.5556 2 985.5422 985.5444 K S 1822 1831 PSM YADEEIPR 3502 sp|O75369-2|FLNB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7788.5 100.3522 2 991.4706 991.4610 K S 1497 1505 PSM YENEVALR 3503 sp|P13645|K1C10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7750.9 99.35893 2 992.4904 992.4927 K Q 238 246 PSM FIASTGMDR 3504 sp|Q9UMS4|PRP19_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7918.6 103.9077 2 996.4684 996.4699 K S 489 498 PSM IISQVVDPK 3505 sp|Q8NFC6|BD1L1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7904.5 103.5225 2 997.5786 997.5808 R I 134 143 PSM FSEGEATLR 3506 sp|P47897-2|SYQ_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7945.9 104.6518 2 1008.4862 1008.4876 K M 384 393 PSM ELQCLTPR 3507 sp|Q08945|SSRP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 4-UNIMOD:4 ms_run[1]:scan=1.1.8046.11 107.4121 2 1015.5118 1015.5121 R G 204 212 PSM GVLLTDGSEK 3508 sp|P51532-2|SMCA4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7813.6 101.0336 2 1017.5312 1017.5342 K D 1015 1025 PSM TAVCDIPPR 3509 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 4-UNIMOD:4 ms_run[1]:scan=1.1.8014.7 106.5332 2 1027.5248 1027.5121 K G 351 360 PSM GEGDLSQLSK 3510 sp|Q9P013|CWC15_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7872.6 102.6451 2 1032.5016 1032.5087 K Q 19 29 PSM ALYEHLTAK 3511 sp|P42704|LPPRC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7995.2 106.0062 3 1044.5584 1044.5604 K N 1339 1348 PSM AELDDTPMR 3512 sp|P23246|SFPQ_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7881.9 102.8978 2 1046.4656 1046.4702 K G 350 359 PSM VGSDQCLLR 3513 sp|P78310|CXAR_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 6-UNIMOD:4 ms_run[1]:scan=1.1.7978.10 105.5573 2 1046.5164 1046.5179 R L 218 227 PSM EQELTQAIK 3514 sp|Q9H501|ESF1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7853.6 102.1233 2 1058.5556 1058.5608 K K 801 810 PSM KQPPVSPGTALVGSQK 3515 sp|P17096|HMGA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8098.8 108.7552 3 1592.8846 1592.8886 R E 31 47 PSM FESPEVAER 3516 sp|P52272|HNRPM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7874.8 102.7037 2 1062.4946 1062.4982 K A 699 708 PSM FESPEVAER 3517 sp|P52272|HNRPM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7893.5 103.2205 2 1062.4946 1062.4982 K A 699 708 PSM FESPEVAER 3518 sp|P52272|HNRPM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7912.6 103.7434 2 1062.4952 1062.4982 K A 699 708 PSM FEDSPSYVK 3519 sp|O60264|SMCA5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7926.7 104.1289 2 1070.4894 1070.4920 R W 168 177 PSM SVEAAAELSAK 3520 sp|P20962|PTMS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7739.10 99.05927 2 1074.5522 1074.5557 K D 5 16 PSM ELAEQELEK 3521 sp|Q15149|PLEC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7868.10 102.5415 2 1087.5354 1087.5397 R Q 1825 1834 PSM AIEEQMVAAK 3522 sp|Q9H0A0|NAT10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7857.11 102.2413 2 1088.5492 1088.5536 K D 913 923 PSM EIVVGSNMDK 3523 sp|Q9UQ88-2|CD11A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7893.6 103.2222 2 1090.5286 1090.5329 R I 487 497 PSM VETTEDLVAK 3524 sp|P38117|ETFB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7795.8 100.5469 2 1103.5680 1103.5710 K L 239 249 PSM GTEVQVDDIK 3525 sp|Q9Y230-2|RUVB2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8045.11 107.385 2 1102.5494 1102.5506 K R 373 383 PSM DAISGIGTDEK 3526 sp|P08133-2|ANXA6_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8047.9 107.4359 2 1104.5272 1104.5299 K C 71 82 PSM YDDMAACMK 3527 sp|P63104|1433Z_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 7-UNIMOD:4 ms_run[1]:scan=1.1.8076.10 108.19 2 1103.4060 1103.4086 R S 19 28 PSM VCNLIDSGTK 3528 sp|Q02252-2|MMSA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 2-UNIMOD:4 ms_run[1]:scan=1.1.7895.8 103.2804 2 1105.5366 1105.5438 R E 354 364 PSM VFSQTTICR 3529 sp|Q01860|PO5F1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 8-UNIMOD:4 ms_run[1]:scan=1.1.8059.10 107.7531 2 1110.5482 1110.5492 K F 178 187 PSM VTVVDVNESR 3530 sp|O60701|UGDH_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7785.8 100.2773 2 1116.5738 1116.5775 R I 32 42 PSM VEYSEEELK 3531 sp|P12956-2|XRCC6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8104.10 108.9168 2 1124.5228 1124.5237 K T 516 525 PSM YDDMAACMK 3532 sp|P63104|1433Z_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 4-UNIMOD:35,7-UNIMOD:4,8-UNIMOD:35 ms_run[1]:scan=1.1.8067.9 107.9576 2 1135.3980 1135.3984 R S 19 28 PSM YDDMAACMK 3533 sp|P63104|1433Z_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 4-UNIMOD:35,7-UNIMOD:4,8-UNIMOD:35 ms_run[1]:scan=1.1.8066.8 107.932 2 1135.3980 1135.3984 R S 19 28 PSM IGAEVYHNLK 3534 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7962.3 105.1086 3 1142.6074 1142.6084 R N 184 194 PSM EYVESQLQR 3535 sp|Q8NBS9|TXND5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8005.11 106.2933 2 1150.5596 1150.5618 R T 288 297 PSM TGDVEDSTVLK 3536 sp|Q9UNN5-2|FAF1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7797.10 100.6044 2 1162.5668 1162.5718 K S 147 158 PSM LEEQDEFEK 3537 sp|Q9NTJ5-2|SAC1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7760.9 99.62687 2 1165.5128 1165.5139 K I 363 372 PSM NSATSADEQPHIGNYR 3538 sp|Q7KZI7-11|MARK2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7895.9 103.2821 3 1758.7867 1758.7921 R L 39 55 PSM ISANENSLAVR 3539 sp|Q9UHB6-4|LIMA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8060.11 107.7805 2 1172.6290 1172.6149 K S 325 336 PSM DSEEIDDVTR 3540 sp|Q9Y388|RBMX2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7896.10 103.3112 2 1177.5072 1177.5099 K Q 120 130 PSM IQETQAELPR 3541 sp|Q14566|MCM6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7921.10 103.9968 2 1183.6172 1183.6197 R G 208 218 PSM LNMTPEEAER 3542 sp|P60228|EIF3E_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8031.9 107.0027 2 1188.5436 1188.5444 K W 360 370 PSM DVEEGDEKFE 3543 sp|Q9Y3A5|SBDS_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8004.9 106.2629 2 1195.4880 1195.4881 K - 241 251 PSM EISPGSGPGEIR 3544 sp|O43491-4|E41L2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7865.11 102.4606 2 1197.5938 1197.5990 K K 643 655 PSM EATDAIGHLDR 3545 sp|Q12906-7|ILF3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7990.4 105.8738 3 1196.5786 1196.5786 K Q 298 309 PSM QELSHALYQHDAACR 3546 sp|Q9UMS4|PRP19_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 14-UNIMOD:4 ms_run[1]:scan=1.1.7939.10 104.4899 3 1797.8221 1797.8216 R V 101 116 PSM AESEEGPDVLR 3547 sp|Q15437|SC23B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8020.8 106.6994 2 1200.5626 1200.5622 R W 536 547 PSM ESGSTLDLSGSR 3548 sp|Q9ULU4-13|PKCB1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7867.10 102.514 2 1207.5642 1207.5681 K E 1090 1102 PSM EFFNGKEPSR 3549 sp|P11021|BIP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7887.5 103.0558 3 1209.5746 1209.5778 K G 377 387 PSM NDQCYEDIR 3550 sp|Q9BR76|COR1B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 4-UNIMOD:4 ms_run[1]:scan=1.1.7797.11 100.6061 2 1211.4838 1211.4877 K V 22 31 PSM DGQVINETSQHHDDLE 3551 sp|P08670|VIME_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7984.9 105.7189 3 1835.7937 1835.7922 R - 451 467 PSM QQEYEEQFK 3552 sp|Q9GZU8|PIP30_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7884.11 102.9837 2 1227.5418 1227.5408 K F 66 75 PSM ILQDSLGGNCR 3553 sp|P33176|KINH_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 10-UNIMOD:4 ms_run[1]:scan=1.1.8058.9 107.7258 2 1231.5998 1231.5979 R T 285 296 PSM GTVEGFEPADNK 3554 sp|P37108|SRP14_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8077.11 108.2174 2 1262.5770 1262.5779 K C 44 56 PSM TAYSGGAEDLER 3555 sp|Q9Y388|RBMX2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7822.10 101.2848 2 1267.5706 1267.5680 R E 229 241 PSM SEPIPESNDGPVK 3556 sp|P30101|PDIA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7743.11 99.17036 2 1367.6556 1367.6569 K V 367 380 PSM TLVPGPPGSSRPVK 3557 sp|Q14318-2|FKBP8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7939.6 104.4832 3 1390.7902 1390.7933 K G 106 120 PSM GTGEAEEEYVGPR 3558 sp|Q13895|BYST_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8082.11 108.3455 2 1392.6148 1392.6157 R L 41 54 PSM VEEEEERNQILQNEK 3559 sp|P35580-3|MYH10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8106.11 108.9721 2 1885.9030 1885.9017 R K 952 967 PSM MLHDYIGDK 3560 sp|P55786-2|PSA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8200.2 111.5159 3 1090.5112 1090.5117 R D 367 376 PSM VLVTTNVCAR 3561 sp|Q9NUU7|DD19A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 8-UNIMOD:4 ms_run[1]:scan=1.1.8146.3 110.0476 3 1131.6034 1131.6070 K G 385 395 PSM GGDLMAYDRR 3562 sp|P61978|HNRPK_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8150.3 110.1566 3 1152.5332 1152.5346 R G 317 327 PSM GGDLMAYDRR 3563 sp|P61978|HNRPK_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8149.3 110.1293 3 1152.5332 1152.5346 R G 317 327 PSM GGDLMAYDRR 3564 sp|P61978|HNRPK_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8146.5 110.0509 3 1152.5332 1152.5346 R G 317 327 PSM GGDLMAYDRR 3565 sp|P61978|HNRPK_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8147.3 110.0748 3 1152.5332 1152.5346 R G 317 327 PSM GEFVTTVQQR 3566 sp|P40925-3|MDHC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8162.5 110.4859 3 1163.5915 1163.5935 K G 239 249 PSM KGEFETGFEK 3567 sp|Q8IYD1|ERF3B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8290.3 113.9656 3 1170.5545 1170.5557 R G 316 326 PSM RGLAVNMVDSK 3568 sp|Q9NUU7|DD19A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8208.3 111.7332 3 1188.6265 1188.6285 K H 435 446 PSM VIGELVGHTER 3569 sp|Q8TEQ6|GEMI5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8128.3 109.5571 3 1208.6491 1208.6513 R V 56 67 PSM HIYYITGETK 3570 sp|P07900-2|HS90A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8458.4 118.5167 3 1223.6176 1223.6186 K D 612 622 PSM HIYYITGETK 3571 sp|P07900-2|HS90A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8469.3 118.8169 3 1223.6176 1223.6186 K D 612 622 PSM ALGAEIVR 3572 sp|P0DN79|CBSL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8282.7 113.7569 2 827.4856 827.4865 R T 183 191 PSM APIIAVTR 3573 sp|P14618-2|KPYM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8334.5 115.1548 2 839.5216 839.5229 R N 448 456 PSM APIIAVTR 3574 sp|P14618-2|KPYM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8353.4 115.6681 2 839.5216 839.5229 R N 448 456 PSM APIIAVTR 3575 sp|P14618-2|KPYM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8372.3 116.1854 2 839.5216 839.5229 R N 448 456 PSM SPSTLLPK 3576 sp|P27816-6|MAP4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8130.3 109.6115 2 841.4884 841.4909 R K 825 833 PSM LAISEDHVASVK 3577 sp|Q9HC35-2|EMAL4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8329.4 115.0176 3 1267.6750 1267.6772 R K 52 64 PSM HLQLAIR 3578 sp|P16104|H2AX_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8366.4 116.0226 2 849.5176 849.5184 R N 83 90 PSM HLQLAIR 3579 sp|P16104|H2AX_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8404.4 117.0536 2 849.5176 849.5184 R N 83 90 PSM HLQLAIR 3580 sp|P16104|H2AX_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8309.4 114.4769 2 849.5170 849.5184 R N 83 90 PSM HLQLAIR 3581 sp|P16104|H2AX_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8290.5 113.9689 2 849.5174 849.5184 R N 83 90 PSM HLQLAIR 3582 sp|P16104|H2AX_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8347.3 115.503 2 849.5174 849.5184 R N 83 90 PSM HLQLAIR 3583 sp|P16104|H2AX_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8366.5 116.0243 2 849.5176 849.5184 R N 83 90 PSM HLQLAIR 3584 sp|P16104|H2AX_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8328.4 114.9906 2 849.5176 849.5184 R N 83 90 PSM HLQLAIR 3585 sp|P16104|H2AX_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8385.5 116.546 2 849.5176 849.5184 R N 83 90 PSM NFGSYVTHETK 3586 sp|P63167|DYL1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8164.4 110.5387 3 1281.5968 1281.5990 R H 61 72 PSM VHQLYETIQR 3587 sp|Q13561-2|DCTN2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8391.4 116.7083 3 1285.6735 1285.6779 K W 314 324 PSM QLIVGVNK 3588 sp|Q5VTE0|EF1A3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8133.4 109.6952 2 869.5322 869.5334 K M 147 155 PSM QLIVGVNK 3589 sp|Q5VTE0|EF1A3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8152.4 110.2125 2 869.5322 869.5334 K M 147 155 PSM GTVQGQLQGPISK 3590 sp|P07311|ACYP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8250.5 112.8831 3 1311.7144 1311.7147 R V 46 59 PSM CHVQTIQLCR 3591 sp|O00541-2|PESC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 1-UNIMOD:4,9-UNIMOD:4 ms_run[1]:scan=1.1.8149.5 110.1326 3 1313.6299 1313.6333 K R 153 163 PSM LCDSYEIRPGK 3592 sp|O43390-2|HNRPR_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 2-UNIMOD:4 ms_run[1]:scan=1.1.8171.5 110.7315 3 1336.6426 1336.6445 K H 225 236 PSM QEISAAFK 3593 sp|P08758|ANXA5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8249.5 112.8556 2 892.4622 892.4654 R T 51 59 PSM TFEGIDPK 3594 sp|P50395|GDIB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8442.6 118.0818 2 905.4472 905.4494 R K 157 165 PSM QTVAVGVIK 3595 sp|Q5VTE0|EF1A3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8230.5 112.3346 2 913.5578 913.5597 R A 431 440 PSM TTLTAAITK 3596 sp|P49411|EFTU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8167.4 110.6206 2 918.5378 918.5386 K I 71 80 PSM RIVEGILK 3597 sp|Q15370-2|ELOB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8244.2 112.7132 3 926.5879 926.5913 K R 29 37 PSM ELAVQIQK 3598 sp|P38919|IF4A3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8237.4 112.5244 2 927.5354 927.5389 R G 117 125 PSM TVSPALISR 3599 sp|Q86VP6|CAND1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8493.7 119.4776 2 942.5478 942.5498 K F 374 383 PSM IIALDGDTK 3600 sp|P29401-2|TKT_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8449.6 118.2734 2 944.5158 944.5179 R N 343 352 PSM IIALDGDTK 3601 sp|P29401-2|TKT_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8430.4 117.7527 2 944.5158 944.5179 R N 343 352 PSM LGPLVEQGR 3602 sp|P02649|APOE_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8210.8 111.7958 2 967.5428 967.5451 R V 199 208 PSM APDVTTLPR 3603 sp|Q92542-2|NICA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8452.5 118.3538 2 968.5202 968.5291 K N 295 304 PSM VIGSELVQK 3604 sp|P35998|PRS7_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8458.5 118.5183 2 971.5630 971.5651 R Y 240 249 PSM SGVSLAALKK 3605 sp|P10412|H14_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8420.7 117.4881 2 972.5950 972.5968 R A 55 65 PSM SYCAEIAHNVSSK 3606 sp|P62910|RL32_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 3-UNIMOD:4 ms_run[1]:scan=1.1.8424.8 117.5975 3 1464.6622 1464.6667 K N 94 107 PSM MTPSYEIR 3607 sp|Q08211|DHX9_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8506.6 119.8304 2 995.4702 995.4746 K A 17 25 PSM NQGIEEALK 3608 sp|P18206|VINC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8198.8 111.472 2 1000.5176 1000.5189 K N 220 229 PSM VPVDEFDGK 3609 sp|Q92499-3|DDX1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8395.7 116.8208 2 1004.4806 1004.4815 K V 551 560 PSM QEYDESGPSIVHR 3610 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8186.7 111.1442 3 1515.6934 1515.6954 K K 360 373 PSM ALDEYYDK 3611 sp|P38606|VATA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8408.6 117.1631 2 1015.4490 1015.4498 R H 460 468 PSM EQAELTGLR 3612 sp|Q96HS1-2|PGAM5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8335.7 115.185 2 1015.5286 1015.5298 R L 126 135 PSM DLPEHAVLK 3613 sp|Q00839|HNRPU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8122.2 109.3917 3 1020.5575 1020.5604 K M 627 636 PSM GTGIVSAPVPK 3614 sp|P15880|RS2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8311.7 114.5358 2 1024.5886 1024.5917 R K 201 212 PSM TAVCDIPPR 3615 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 4-UNIMOD:4 ms_run[1]:scan=1.1.8222.10 112.1247 2 1027.5038 1027.5121 K G 351 360 PSM AREQAEAEVASLNR 3616 sp|P06753-2|TPM3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8182.9 111.0383 3 1542.7702 1542.7750 R R 41 55 PSM GVTIPYRPK 3617 sp|Q15366-2|PCBP2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8483.2 119.1972 3 1029.5935 1029.5971 K P 177 186 PSM LDGNQDLIR 3618 sp|P48735|IDHP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8327.8 114.9703 2 1042.5398 1042.5407 K F 385 394 PSM GEHSIVYLK 3619 sp|Q02790|FKBP4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8132.3 109.6662 3 1044.5566 1044.5604 K P 214 223 PSM TYLPSQVSR 3620 sp|P35606|COPB2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8381.6 116.4378 2 1049.5502 1049.5506 R V 760 769 PSM VHIDIGADGR 3621 sp|P31942-2|HNRH3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8219.7 112.0383 2 1051.5388 1051.5411 R A 208 218 PSM NFGDQPDIR 3622 sp|Q15393|SF3B3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8457.9 118.4975 2 1060.4934 1060.4938 K C 260 269 PSM NFGDQPDIR 3623 sp|Q15393|SF3B3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8419.8 117.4627 2 1060.4934 1060.4938 K C 260 269 PSM LLDVVHPAAK 3624 sp|Q99832-3|TCPH_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8383.2 116.4861 3 1061.6212 1061.6233 K T 24 34 PSM NPVMELNEK 3625 sp|Q12906-7|ILF3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8427.7 117.6766 2 1072.5214 1072.5223 K R 531 540 PSM TLSDYNIQK 3626 sp|P62979|RS27A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8289.7 113.9454 2 1080.5418 1080.5451 R E 55 64 PSM DQEFTVDTR 3627 sp|O75369-2|FLNB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8479.9 119.1 2 1109.4968 1109.4989 K G 961 970 PSM NQLCDLETK 3628 sp|P26358|DNMT1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 4-UNIMOD:4 ms_run[1]:scan=1.1.8249.10 112.864 2 1119.5202 1119.5230 K L 59 68 PSM LSPQAVNSIAK 3629 sp|P30626-2|SORCN_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8450.10 118.3074 2 1126.6292 1126.6346 R R 121 132 PSM LSANQQNILK 3630 sp|P57088|TMM33_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8233.8 112.4216 2 1127.6280 1127.6298 K F 149 159 PSM ADTLTPEECQQFKK 3631 sp|Q16181-2|SEPT7_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 9-UNIMOD:4 ms_run[1]:scan=1.1.8253.10 112.9737 3 1693.8010 1693.7981 K Q 195 209 PSM SADGSAPAGEGEGVTLQR 3632 sp|Q01650|LAT1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8179.11 110.9598 3 1700.7940 1700.7966 K N 31 49 PSM VYVGNLGTGAGK 3633 sp|Q16629-4|SRSF7_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8395.10 116.8258 2 1134.6032 1134.6033 K G 13 25 PSM VVPGYGHAVLR 3634 sp|O75390|CISY_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8439.3 117.9952 3 1166.6527 1166.6560 R K 341 352 PSM ELQQQLVDAK 3635 sp|Q9NUQ3-2|TXLNG_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8356.9 115.7581 2 1170.6250 1170.6244 K L 166 176 PSM SSIAGSSTWER 3636 sp|Q99808|S29A1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8469.8 118.8252 2 1179.5534 1179.5520 K Y 316 327 PSM LLSCSADGTLR 3637 sp|O43815-2|STRN_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 4-UNIMOD:4 ms_run[1]:scan=1.1.8491.8 119.4247 2 1191.5906 1191.5918 R L 535 546 PSM FAAATGATPIAGR 3638 sp|P08865|RSSA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8363.10 115.9508 2 1202.6394 1202.6408 K F 90 103 PSM EVPAVPETLKK 3639 sp|P18124|RL7_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8442.3 118.0768 3 1209.6937 1209.6969 K K 10 21 PSM ALVDGPCTQVR 3640 sp|P50914|RL14_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 7-UNIMOD:4 ms_run[1]:scan=1.1.8398.2 116.8922 3 1214.6068 1214.6078 R R 36 47 PSM QETSSLACGLR 3641 sp|Q9Y6D6|BIG1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 8-UNIMOD:4 ms_run[1]:scan=1.1.8339.10 115.2973 2 1220.5850 1220.5819 K I 1722 1733 PSM GVVEVTHDLQK 3642 sp|P50454|SERPH_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8286.4 113.8597 3 1223.6488 1223.6510 K H 309 320 PSM HGGVIHIYVDK 3643 sp|Q14498-2|RBM39_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8307.2 114.4198 3 1236.6595 1236.6615 K N 451 462 PSM CNTDDTIGDLK 3644 sp|Q9BZL1|UBL5_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 1-UNIMOD:4 ms_run[1]:scan=1.1.8398.10 116.9055 2 1250.5474 1250.5449 K K 18 29 PSM CNTDDTIGDLK 3645 sp|Q9BZL1|UBL5_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 1-UNIMOD:4 ms_run[1]:scan=1.1.8417.10 117.4119 2 1250.5474 1250.5449 K K 18 29 PSM NFGSYVTHETK 3646 sp|P63167|DYL1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8175.8 110.8458 2 1281.5976 1281.5990 R H 61 72 PSM EFTESQLQEGK 3647 sp|Q01995|TAGL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8382.11 116.4736 2 1294.6032 1294.6041 R H 162 173 PSM ITDSAGHILYSK 3648 sp|P49755|TMEDA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8236.10 112.5072 2 1303.6754 1303.6772 K E 76 88 PSM GLSEDTTEETLK 3649 sp|P19338|NUCL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8372.10 116.1971 2 1321.6250 1321.6249 K E 578 590 PSM SSTETCYSAIPK 3650 sp|O75369-2|FLNB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 6-UNIMOD:4 ms_run[1]:scan=1.1.8287.11 113.8983 2 1342.6056 1342.6075 R A 2472 2484 PSM SSTETCYSAIPK 3651 sp|O75369-2|FLNB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 6-UNIMOD:4 ms_run[1]:scan=1.1.8268.11 113.3847 2 1342.6056 1342.6075 R A 2472 2484 PSM SPEVLSGGEDGAVR 3652 sp|Q86W42-2|THOC6_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8333.11 115.1377 2 1371.6620 1371.6630 R L 156 170 PSM LNQPPEDGISSVK 3653 sp|O43684-2|BUB3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8362.10 115.9234 2 1382.7040 1382.7041 K F 9 22 PSM SRAEAESMYQIK 3654 sp|P05787-2|K2C8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8127.9 109.5397 2 1411.6750 1411.6765 R Y 302 314 PSM LASGVEGSDIPDDGK 3655 sp|O95747|OXSR1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8353.11 115.6797 2 1458.6830 1458.6838 K L 503 518 PSM EQAEAEVASLNRR 3656 sp|P06753-2|TPM3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8307.4 114.4231 3 1471.7344 1471.7379 R I 43 56 PSM AQEPESGLSEETQVK 3657 sp|P78527|PRKDC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8328.10 115.0006 2 1630.7714 1630.7686 R C 4091 4106 PSM DHNIPGELER 3658 sp|P35580-3|MYH10_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8021.3 106.7187 3 1178.5660 1178.5680 K Q 207 217 PSM LTVLSEER 3659 sp|Q13813|SPTN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8285.4 113.8328 2 945.5110 945.5131 K A 442 450 PSM CCAAADPHECYAK 3660 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.6340.5 61.25993 4 1551.5917 1551.5905 K V 384 397 PSM GEQVSQNGLPAEQGSPR 3661 sp|Q01082-3|SPTB2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7709.11 98.24088 3 1752.8737 1752.8391 K M 2111 2128 PSM IEYNDQNDGSCDVK 3662 sp|O75369-2|FLNB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 11-UNIMOD:4 ms_run[1]:scan=1.1.7089.11 81.54893 3 1655.6716 1655.6733 K Y 594 608 PSM DAALATALGDKK 3663 sp|P20700|LMNB1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8460.9 118.58 2 1172.6384 1172.6401 K S 146 158 PSM VSVHVIEGDHR 3664 sp|P49327|FAS_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6969.7 78.31365 3 1246.6414 1246.6418 K T 2472 2483 PSM RQQEQQVPILEK 3665 sp|P49327|FAS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8402.7 117.0058 3 1494.8122 1494.8154 R F 1105 1117 PSM HQGVMVGMGQK 3666 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 5-UNIMOD:35,8-UNIMOD:35 ms_run[1]:scan=1.1.6922.4 77.04495 3 1202.5534 1202.5536 R D 40 51 PSM LGIHEDSQNR 3667 sp|P07900-2|HS90A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6261.10 59.1036 2 1167.5650 1167.5632 K K 569 579 PSM RDPHLACVAYER 3668 sp|Q00610-2|CLH1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 7-UNIMOD:4 ms_run[1]:scan=1.1.7854.7 102.1523 3 1485.7111 1485.7147 K G 912 924 PSM VEIIANDQGNR 3669 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7734.5 98.9141 3 1227.6202 1227.6207 R I 26 37 PSM TAIHEVMEQGR 3670 sp|P25205-2|MCM3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7595.6 95.13654 3 1269.6100 1269.6136 R V 465 476 PSM TSSSRAVVVK 3671 sp|P05787-2|K2C8_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6886.5 76.10778 3 1032.5875 1032.5928 R K 483 493 PSM TKTEISEMNR 3672 sp|P05787-2|K2C8_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6472.5 64.79688 3 1207.5862 1207.5867 R N 331 341 PSM VLEDSDLK 3673 sp|P11021|BIP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7214.9 84.89982 2 917.4710 917.4706 K K 345 353 PSM EGALCEENMR 3674 sp|P13639|EF2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 5-UNIMOD:4,9-UNIMOD:35 ms_run[1]:scan=1.1.7427.7 90.60342 2 1223.4832 1223.4910 K G 689 699 PSM AAECNIVVTQPR 3675 sp|Q08211|DHX9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 4-UNIMOD:4 ms_run[1]:scan=1.1.8241.5 112.6357 3 1356.6808 1356.6820 R R 435 447 PSM DRDYSDHPSGGSYR 3676 sp|P38159-2|RBMX_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6374.6 62.18577 4 1610.6741 1610.6710 R D 256 270 PSM IQFKPDDGTTPER 3677 sp|Q96AE4-2|FUBP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8084.7 108.3904 3 1502.7319 1502.7365 R I 308 321 PSM GPAGLGPR 3678 sp|Q04637-9|IF4G1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6489.3 65.255 2 723.4006 723.4028 R R 702 710 PSM AQMVQEDLEK 3679 sp|P26038|MOES_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7957.11 104.9846 2 1189.5636 1189.5649 K T 449 459 PSM LTDCVVMR 3680 sp|P22626-2|ROA2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 4-UNIMOD:4 ms_run[1]:scan=1.1.8317.7 114.698 2 992.4762 992.4783 K D 35 43 PSM EGSASTEVLR 3681 sp|O75643|U520_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6799.10 73.75916 2 1047.5262 1047.5196 R T 754 764 PSM IQETQAELPR 3682 sp|Q14566|MCM6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7898.2 103.3527 3 1183.6144 1183.6197 R G 208 218 PSM VLRDNIQGITK 3683 sp|P62805|H4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8287.4 113.8867 3 1255.7218 1255.7248 K P 22 33 PSM LATNTSAPDLK 3684 sp|P27816-6|MAP4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7490.2 92.26624 3 1129.5814 1129.5979 R N 923 934 PSM EDTEEYNLR 3685 sp|P51991|ROA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7768.10 99.83649 2 1167.5032 1167.5044 K D 135 144 PSM FVTSNTQELGK 3686 sp|Q9BXP5-2|SRRT_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7806.5 100.841 3 1222.6162 1222.6194 K D 700 711 PSM QKPCDLPLR 3687 sp|O00425|IF2B3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 4-UNIMOD:4 ms_run[1]:scan=1.1.7433.3 90.74767 3 1125.5938 1125.5965 K L 191 200 PSM KHEAFESDLAAHQDR 3688 sp|O43707|ACTN4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7369.7 89.10477 4 1752.8161 1752.8179 K V 455 470 PSM YDDMATCMK 3689 sp|P27348|1433T_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 7-UNIMOD:4 ms_run[1]:scan=1.1.7867.9 102.5123 2 1133.4180 1133.4191 R A 19 28 PSM HPDADSLYVEK 3690 sp|P54577|SYYC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7986.5 105.7667 3 1272.5968 1272.5986 K I 381 392 PSM DGEQHEDLNEVAK 3691 sp|O95831|AIFM1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6923.10 77.08131 3 1482.6556 1482.6586 K L 594 607 PSM VDDSSEDKTEFTVK 3692 sp|P49588|SYAC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7930.8 104.2399 3 1598.7280 1598.7312 K N 551 565 PSM VDNDENEHQLSLR 3693 sp|P06748-2|NPM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7911.4 103.7126 3 1567.7188 1567.7226 K T 33 46 PSM VDNDENEHQLSLR 3694 sp|P06748-2|NPM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7862.8 102.3732 3 1567.7290 1567.7226 K T 33 46 PSM GEEILSGAQR 3695 sp|P14868|SYDC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7569.4 94.42393 3 1058.5375 1058.5356 R I 422 432 PSM RGGPNYQEGLR 3696 sp|P53396|ACLY_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6910.5 76.73393 3 1245.6199 1245.6214 R V 379 390 PSM HSEAFEALQQK 3697 sp|Q07065|CKAP4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8166.6 110.5966 3 1286.6239 1286.6255 R S 395 406 PSM RNDHDDDEDEEVISK 3698 sp|Q12789-3|TF3C1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6487.5 65.2033 4 1814.7529 1814.7555 K T 341 356 PSM TAVCDIPPR 3699 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 4-UNIMOD:4 ms_run[1]:scan=1.1.8159.8 110.4096 2 1027.5010 1027.5121 K G 351 360 PSM TAVCDIPPR 3700 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 4-UNIMOD:4 ms_run[1]:scan=1.1.8178.8 110.9276 2 1027.5010 1027.5121 K G 351 360 PSM LTAQFVAR 3701 sp|Q15459|SF3A1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8462.4 118.6266 2 904.5094 904.5130 K N 169 177 PSM GLVPEDDTK 3702 sp|Q15459|SF3A1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7356.7 88.75895 2 972.4770 972.4764 K E 534 543 PSM ESVFTVEGGHR 3703 sp|Q99623|PHB2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8319.11 114.7586 2 1216.5840 1216.5837 R A 38 49 PSM TFTEMDSHEEK 3704 sp|P48444|COPD_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6968.5 78.28302 3 1352.5543 1352.5554 R V 132 143 PSM TSSAQVEGGVHSLHSYEK 3705 sp|P12268|IMDH2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8308.6 114.4534 4 1914.9085 1914.9072 R R 494 512 PSM IGAEVYHNLK 3706 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8008.11 106.3755 2 1142.6074 1142.6084 R N 184 194 PSM EGEDSSVIHYDDK 3707 sp|Q14839-2|CHD4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7854.8 102.154 3 1492.6273 1492.6318 K A 1240 1253 PSM AGDLLEDSPK 3708 sp|P51858|HDGF_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8408.7 117.1647 2 1043.5124 1043.5135 R R 158 168 PSM VYDESIQLDHK 3709 sp|Q07954|LRP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8491.6 119.4214 3 1345.6522 1345.6514 K G 1835 1846 PSM NLDEQLSAPK 3710 sp|A5YKK6-2|CNOT1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8431.7 117.7848 2 1113.5632 1113.5666 K K 1306 1316 PSM ASGVEGADVVK 3711 sp|P19367-4|HXK1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6865.8 75.53715 2 1030.5366 1030.5295 K L 165 176 PSM HIDLVEGDEGR 3712 sp|P19367-4|HXK1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7965.10 105.2025 2 1238.5880 1238.5891 R M 232 243 PSM LPLVTPHTQCR 3713 sp|P62191|PRS4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 10-UNIMOD:4 ms_run[1]:scan=1.1.8130.7 109.6182 3 1320.6946 1320.6972 K L 49 60 PSM QVHPDTGISSK 3714 sp|Q99880|H2B1L_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6165.5 56.4367 3 1167.5773 1167.5884 K A 48 59 PSM APVPGTPDSLSSGSSR 3715 sp|Q9UJZ1-2|STML2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8313.7 114.5902 3 1513.7332 1513.7373 K D 277 293 PSM MAGDPVANVR 3716 sp|P30153|2AAA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7719.10 98.51252 2 1028.5064 1028.5073 R F 528 538 PSM VLSGTIHAGQPVK 3717 sp|Q15029-2|U5S1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7336.6 88.22718 3 1305.7396 1305.7405 R V 461 474 PSM AAAAAAALQAK 3718 sp|P36578|RL4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6631.8 69.1533 2 955.5450 955.5450 K S 354 365 PSM AAAAAAALQAK 3719 sp|P36578|RL4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6632.8 69.18065 2 955.5450 955.5450 K S 354 365 PSM AAAAAAALQAK 3720 sp|P36578|RL4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6636.6 69.28682 2 955.5450 955.5450 K S 354 365 PSM SGQGAFGNMCR 3721 sp|P36578|RL4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 10-UNIMOD:4 ms_run[1]:scan=1.1.7967.7 105.2522 3 1183.4836 1183.4863 R G 87 98 PSM VGQASEIAR 3722 sp|Q99459|CDC5L_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6244.7 58.63008 2 929.4932 929.4930 K Q 313 322 PSM TREEIQEVR 3723 sp|P08559-2|ODPA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6375.10 62.21877 2 1158.5986 1158.5993 R S 310 319 PSM EGQGEGETQEAAAATAAAR 3724 sp|P58107|EPIPL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8157.10 110.3583 3 1816.8226 1816.8187 R R 3681 3700 PSM RPEIVVATPGR 3725 sp|Q9GZR7|DDX24_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8022.4 106.7479 3 1193.6845 1193.6880 R L 437 448 PSM EVQLGVADK 3726 sp|Q9Y388|RBMX2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7680.6 97.44403 2 957.5112 957.5131 R V 17 26 PSM DEFTNTCPSDK 3727 sp|Q9Y696|CLIC4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 7-UNIMOD:4 ms_run[1]:scan=1.1.7088.5 81.51165 3 1312.5241 1312.5242 R E 228 239 PSM RAAAEVNQDYGLDPK 3728 sp|P07954-2|FUMH_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8344.8 115.4298 3 1645.8028 1645.8060 K I 58 73 PSM CYEMASHLR 3729 sp|P07737|PROF1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 1-UNIMOD:4 ms_run[1]:scan=1.1.7800.9 100.6843 2 1165.4976 1165.5008 K R 128 137 PSM CYEMASHLR 3730 sp|P07737|PROF1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 1-UNIMOD:4 ms_run[1]:scan=1.1.7819.9 101.2016 2 1165.4976 1165.5008 K R 128 137 PSM ETSMVHELNR 3731 sp|P61619|S61A1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7473.4 91.80493 3 1214.5678 1214.5713 R Y 406 416 PSM TEQLGLTR 3732 sp|Q9GZL7|WDR12_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7601.7 95.2979 2 916.4808 916.4978 K T 240 248 PSM NPSDSAVHSPFTK 3733 sp|Q14157-1|UBP2L_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8383.5 116.4911 3 1385.6545 1385.6575 K R 408 421 PSM ETANAIVSQQTPQR 3734 sp|P40938-2|RFC3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7759.7 99.59758 3 1541.7775 1541.7798 R L 257 271 PSM VGQAVALR 3735 sp|Q13363-2|CTBP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6850.7 75.12476 2 812.4880 812.4868 R A 174 182 PSM TLVPGPPGSSRPVK 3736 sp|Q14318-2|FKBP8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7977.7 105.5251 3 1390.7914 1390.7933 K G 106 120 PSM LLADQAEAR 3737 sp|P84098|RL19_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6780.2 73.22398 3 985.5184 985.5192 K R 154 163 PSM GAGWTGHVAGTR 3738 sp|Q15274|NADC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7246.6 85.76524 3 1168.5706 1168.5738 R K 127 139 PSM KVDVDEYDENK 3739 sp|O15511-2|ARPC5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7041.7 80.24813 3 1352.6107 1352.6096 R F 13 24 PSM IEALQNHENESVYK 3740 sp|P52292|IMA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8198.5 111.467 4 1672.8005 1672.8056 K A 473 487 PSM SLKDEDVLQK 3741 sp|Q9NZ01|TECR_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7714.5 98.36742 3 1173.6205 1173.6241 K L 58 68 PSM TTSAGTGGMWR 3742 sp|P60468|SC61B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8093.7 108.6234 2 1123.5084 1123.5081 R F 47 58 PSM GTSISTKPPLTK 3743 sp|P35249-2|RFC4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7166.5 83.61237 3 1228.7014 1228.7027 K D 7 19 PSM VANVADVVSK 3744 sp|Q14562|DHX8_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8006.9 106.3174 2 1000.5508 1000.5553 R G 306 316 PSM PSMTLEPNK 3745 sp|Q5ZPR3-3|CD276_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7667.7 97.08891 2 1015.4994 1015.5008 K D 145 154 PSM RPTAAELLR 3746 sp|O95747|OXSR1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8170.2 110.6993 3 1025.5972 1025.5981 K H 279 288 PSM NLETPLCK 3747 sp|P54819-2|KAD2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 7-UNIMOD:4 ms_run[1]:scan=1.1.8439.8 118.0035 2 973.4878 973.4902 K N 86 94 PSM GQTHTLEDFQR 3748 sp|Q99714-2|HCD2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8201.6 111.5494 3 1330.6252 1330.6266 K V 106 117 PSM ALPTSKPEGSLHSSPVGPSSSK 3749 sp|Q9UPT8|ZC3H4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7856.11 102.2139 4 2149.1009 2149.1015 R G 895 917 PSM YTSQIVGR 3750 sp|Q9UNS2-2|CSN3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6871.9 75.70351 2 922.4856 922.4872 K F 224 232 PSM YRDPTTVTTLR 3751 sp|P63151-2|2ABA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8393.5 116.764 3 1321.6966 1321.6990 R V 153 164 PSM EAELLTSAEK 3752 sp|O60566-3|BUB1B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8163.7 110.5164 2 1089.5528 1089.5553 R R 443 453 PSM ESSATDEAWR 3753 sp|Q12769|NU160_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7526.7 93.25412 2 1150.4896 1150.4891 K L 1281 1291 PSM SDPYHATSGALSPAK 3754 sp|P17302|CXA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7822.6 101.2781 3 1500.7138 1500.7209 K D 244 259 PSM SANIEAVDVAK 3755 sp|P23378|GCSP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8276.10 113.5998 2 1115.5960 1115.5822 K R 873 884 PSM RPGAVATGDIGR 3756 sp|P09001|RM03_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6587.5 67.95018 3 1168.6357 1168.6313 R V 239 251 PSM PAPPKPEPK 3757 sp|Q15651-2|HMGN3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.5859.2 48.08437 3 959.5450 959.5440 K P 34 43 PSM ESVVDYCNR 3758 sp|Q99442|SEC62_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 7-UNIMOD:4 ms_run[1]:scan=1.1.7629.8 96.05231 2 1140.4850 1140.4870 R L 76 85 PSM LHDSLAIER 3759 sp|Q15005|SPCS2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7790.11 100.4165 2 1052.5546 1052.5614 R K 215 224 PSM TAEEENPEHVEIQK 3760 sp|O00566|MPP10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7458.9 91.40726 3 1651.7680 1651.7689 K M 485 499 PSM DHPLPEVAHVK 3761 sp|P13073|COX41_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.7568.3 94.39473 3 1240.6531 1240.6564 R H 43 54 PSM ECPAIDYTR 3762 sp|Q9Y3A3-3|PHOCN_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 2-UNIMOD:4 ms_run[1]:scan=1.1.8179.10 110.9582 2 1123.4954 1123.4968 K H 97 106 PSM KDACELIER 3763 sp|Q96EY4|TMA16_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 4-UNIMOD:4 ms_run[1]:scan=1.1.7684.2 97.54632 3 1132.5346 1132.5546 K Y 72 81 PSM EGQEIASVSDDHTCR 3764 sp|Q8NFH4|NUP37_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 14-UNIMOD:4 ms_run[1]:scan=1.1.7033.9 80.03493 3 1702.7233 1702.7217 K I 136 151 PSM LVDEEPQLTK 3765 sp|Q9UG63-2|ABCF2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8386.7 116.5768 2 1170.6136 1170.6132 K R 609 619 PSM NRESYEVSLTQK 3766 sp|Q9NX40|OCAD1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.8151.7 110.1904 3 1452.7156 1452.7208 K T 206 218 PSM CLCAIDIHNK 3767 sp|Q9UKR5|ERG28_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 1-UNIMOD:4,3-UNIMOD:4 ms_run[1]:scan=1.1.8403.4 117.0272 3 1242.5836 1242.5849 R T 65 75 PSM SKDGNGGGGGGGGK 3768 sp|O15266-2|SHOX_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 19 ms_run[1]:scan=1.1.6416.2 63.2953 3 1103.5099 1103.4956 K K 16 30 PSM CCAAADPHECYAK 3769 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.6590.8 68.03805 3 1552.572971 1551.590469 K V 384 397 PSM HQGVMVGMGQK 3770 sp|P62736|ACTA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.6927.9 77.18549 2 1171.564447 1170.563783 R D 42 53 PSM VFTTVGSAEK 3771 sp|P49327|FAS_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.7309.9 87.49903 2 1038.535047 1037.539326 R R 1695 1705 PSM ASNGDAWVEAHGK 3772 sp|P38646|GRP75_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.8171.6 110.7332 3 1341.593171 1340.610928 R L 147 160 PSM ASNGDAWVEAHGK 3773 sp|P38646|GRP75_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.8152.5 110.2142 3 1341.593171 1340.610928 R L 147 160 PSM FATHAAALSVR 3774 sp|P23246|SFPQ_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.8053.10 107.5982 2 1143.619047 1142.619642 R N 366 377 PSM VVLIGGKPDR 3775 sp|P61978|HNRPK_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.7344.3 88.43397 3 1053.635771 1052.634229 R V 192 202 PSM RISGLIYEETR 3776 sp|P62805|H4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.1769.2 12.8409 3 1336.715171 1335.714664 K G 46 57 PSM NHEEEISTLR 3777 sp|P08727|K1C19_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.7208.4 84.72958 3 1227.593771 1226.589129 K G 217 227 PSM ETMQSLNDR 3778 sp|P05783|K1C18_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.6868.11 75.62452 2 1093.507047 1092.486973 K L 82 91 PSM KLPEYNPR 3779 sp|Q9P258|RCC2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.7147.4 83.1061 3 1016.542571 1015.545080 K T 513 521 PSM CACASHVAK 3780 sp|Q16643|DREB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 19 1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:4 ms_run[1]:scan=1.1.6224.8 58.07625 2 985.4101 985.4104 K V 96 105 PSM VSGAGFSPSSK 3781 sp|Q9C0C2|TB182_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.6716.5 71.47448 2 1023.514047 1022.503275 R M 1132 1143 PSM GSVSNQQFAGGCAK 3782 sp|Q9H9Z2|LN28A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 19 1-UNIMOD:1,12-UNIMOD:4 ms_run[1]:scan=1.1.8102.5 108.8555 3 1451.6416 1451.6458 M A 2 16 PSM CYNCGGLDHHAK 3783 sp|Q9H9Z2|LN28A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 19 1-UNIMOD:385,1-UNIMOD:4,4-UNIMOD:4 ms_run[1]:scan=1.1.7697.4 97.90244 3 1414.5542 1413.5552 R E 139 151 PSM QHGDVVSAIR 3784 sp|O14745|NHRF1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 19 1-UNIMOD:28 ms_run[1]:scan=1.1.8352.9 115.6491 2 1063.5272 1063.5402 K A 211 221 PSM QVTDAETKPK 3785 sp|O43684|BUB3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 19 1-UNIMOD:28 ms_run[1]:scan=1.1.6232.9 58.29968 2 1098.5555 1098.5552 R S 315 325 PSM VDNDENEHQLSLR 3786 sp|P06748|NPM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.8092.7 108.5975 3 1568.702171 1567.722663 K T 33 46 PSM GLDNTEFQGK 3787 sp|Q9BQ04|RBM4B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.7886.9 103.035 2 1108.514647 1107.519653 R R 130 140 PSM QGANINEIR 3788 sp|Q15365|PCBP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.7292.7 87.03105 2 1015.518047 1013.525407 R Q 298 307 PSM EFTEAVEAK 3789 sp|P35232|PHB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.7585.10 94.87199 2 1023.493847 1022.492041 K Q 178 187 PSM HLVYESDQNK 3790 sp|O43852|CALU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.6367.6 62.00262 3 1234.604771 1231.583316 R D 272 282 PSM RLEELEAK 3791 sp|O60841|IF2P_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.6760.2 72.67748 3 986.531171 986.539660 K R 368 376 PSM QVHPDTGISSK 3792 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 19 1-UNIMOD:28 ms_run[1]:scan=1.1.6988.9 78.83723 2 1150.5623 1150.5613 K A 48 59 PSM SEQSICQAR 3793 sp|Q8N8S7|ENAH_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 19 1-UNIMOD:1,6-UNIMOD:4 ms_run[1]:scan=1.1.7248.11 85.82835 2 1119.4967 1119.4973 M A 2 11 PSM VHGSLGDTPR 3794 sp|Q96KQ7|EHMT2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.6152.4 56.07543 3 1038.520271 1037.525407 R S 37 47 PSM TAIEEVQAER 3795 sp|Q32P28|P3H1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.7843.10 101.8564 2 1145.579047 1144.572417 R K 570 580 PSM FALACNASDK 3796 sp|P35250|RFC2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 5-UNIMOD:4 ms_run[1]:scan=1.1.8059.9 107.7515 2 1097.505047 1095.501895 R I 167 177 PSM ALSDADVQK 3797 sp|P36543|VATE1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 19 1-UNIMOD:1 ms_run[1]:scan=1.1.8306.9 114.4044 2 987.4868 987.4868 M Q 2 11 PSM KAPPLVENEEAEPGR 3798 sp|O14908|GIPC1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 19 ms_run[1]:scan=1.1.7671.9 97.20229 3 1634.8163 1634.8259 K G 10 25 PSM STNIAAAASEPHS 3799 sp|Q7Z4H3|HDDC2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.7138.11 82.87183 2 1255.584847 1254.584044 R - 192 205 PSM TSEVIEDEK 3800 sp|Q9BV86|NTM1A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 19 1-UNIMOD:1 ms_run[1]:scan=1.1.8457.10 118.4991 2 1090.4973 1090.5025 M Q 2 11 PSM QFFETIFSK 3801 sp|P0DKV0|S31C1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 19 ms_run[1]:scan=1.1.7532.4 93.41219 3 1146.5622 1145.5752 K K 1021 1030 PSM TLAQFPETLLGDPEK 3802 sp|P22459|KCNA4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.7831.10 101.5289 3 1657.860071 1657.856303 K R 193 208 PSM QDLTTALGLVK 3803 sp|Q92974|ARHG2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 19 ms_run[1]:scan=1.1.7884.2 102.9687 3 1157.6422 1157.6652 R E 413 424 PSM TLGTPLCPR 3804 sp|Q8TBZ3|WDR20_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 19 7-UNIMOD:4 ms_run[1]:scan=1.1.8027.7 106.8904 2 1014.5412 1013.5322 K M 508 517 PSM REEGEAFAR 3805 sp|Q8WUD1|RAB2B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 19 ms_run[1]:scan=1.1.6316.4 60.61058 3 1064.5322 1063.5042 K E 131 140 PSM SQAGAQEAPIK 3806 sp|Q8IVN3|MSTN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 19 1-UNIMOD:1 ms_run[1]:scan=1.1.7981.3 105.6273 3 1141.5912 1140.5772 M K 2 13 PSM LCYVALDFEQEMAMVASSSSLEK 3807 sp|P0CG39|POTEJ_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 2-UNIMOD:4 ms_run[1]:scan=1.1.1650.2 11.28705 3 2606.183171 2607.190663 K S 879 902 PSM PAPPKPEPR 3808 sp|O00479|HMGN4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.5921.3 49.77703 3 987.552071 987.550165 K P 32 41 PSM ERPPEEVAAR 3809 sp|Q16891|MIC60_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.6215.5 57.82248 3 1151.573471 1152.588736 R L 196 206 PSM DAVTYTEHAK 3810 sp|P62805|H4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.6400.10 62.87378 2 1132.523847 1133.535303 R R 69 79 PSM GTVQALHATGAR 3811 sp|Q7Z4W1|DCXR_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.6456.5 64.37715 3 1179.624671 1180.631269 R V 22 34 PSM VAVAGCCHGELDK 3812 sp|Q9UK59|DBR1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 6-UNIMOD:4,7-UNIMOD:4 ms_run[1]:scan=1.1.6667.7 70.13468 3 1413.642971 1414.633320 R I 3 16 PSM GASQAGMTGYGR 3813 sp|Q01995|TAGL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.6770.10 72.96335 2 1154.514047 1154.513856 R P 184 196 PSM NIGVDNPAAK 3814 sp|P78371|TCPB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.6995.9 79.02882 2 996.525447 997.519259 K V 73 83 PSM KLPEYNPR 3815 sp|Q9P258|RCC2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.7143.2 82.99347 3 1014.534971 1015.545080 K T 513 521 PSM RMQSLSLNK 3816 sp|Q13442|HAP28_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.7279.3 86.66725 3 1074.585371 1075.580813 K - 173 182 PSM YTVENGYSTSAK 3817 sp|P28340|DPOD1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.7445.11 91.07053 2 1317.614647 1318.604111 K V 739 751 PSM AAYLSDPR 3818 sp|P78527|PRKDC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.7481.6 92.02638 2 892.444847 891.445031 K A 3826 3834 PSM LGTDEISPR 3819 sp|O00159|MYO1C_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.7612.9 95.59286 2 987.502447 986.503275 R V 901 910 PSM ETANAIVSQQTPQR 3820 sp|P40938|RFC3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.7763.10 99.70647 2 1540.774047 1541.779784 R L 257 271 PSM SVEAAAELSAK 3821 sp|P20962|PTMS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.7875.8 102.7315 2 1073.549647 1074.555704 K D 5 16 PSM NGELENIKPK 3822 sp|P68402|PA1B2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.7885.3 102.9977 3 1142.597771 1140.613888 K V 87 97 PSM TAVCDIPPR 3823 sp|Q13885|TBB2A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 4-UNIMOD:4 ms_run[1]:scan=1.1.8035.9 107.1102 2 1026.525247 1027.512065 K G 351 360 PSM QPTIFQNK 3824 sp|P62280|RS11_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.8084.6 108.3887 2 975.518447 974.518531 K K 13 21 PSM GHNQPCLLVGSGR 3825 sp|P27708|PYR1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 6-UNIMOD:4 ms_run[1]:scan=1.1.8089.5 108.5173 3 1392.687071 1393.688467 R C 275 288 PSM FFVSSSQGR 3826 sp|P35613|BASI_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.8091.10 108.5768 2 1014.491447 1013.493044 R S 274 283 PSM IMGPNYTPGK 3827 sp|P13639|EF2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.8106.9 108.9687 2 1075.538647 1076.532466 R K 429 439 PSM LPLVTPHTQCR 3828 sp|P62191|PRS4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 10-UNIMOD:4 ms_run[1]:scan=1.1.8107.5 108.9891 3 1319.687171 1320.697240 K L 49 60 PSM EDAVSFAEK 3829 sp|O43181|NDUS4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.8189.8 111.2279 2 995.459847 994.460741 K N 132 141 PSM DTSVEGSEMVPGK 3830 sp|P18754|RCC1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.8220.11 112.0721 2 1336.600647 1334.602396 R V 102 115 PSM NVELVEGEEGR 3831 sp|P52789|HXK2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.8257.9 113.0818 2 1228.578247 1229.588795 R M 692 703 PSM ALAAAGYDVEK 3832 sp|Q02539|H11_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.8508.10 119.8919 2 1108.550847 1106.560789 K N 68 79 PSM AGVLAGHDNR 3833 sp|P62873-2|GBB1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6037.3 52.95823 3 1008.5086 1008.5101 R V 305 315 PSM DRVHHEPQLSDK 3834 sp|O43852-2|CALU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6038.4 52.98767 4 1459.7157 1459.7168 K V 26 38 PSM SAAETVTK 3835 sp|P61604|CH10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.5772.3 45.96078 2 805.4166 805.4181 R G 21 29 PSM RITRPGNTDDPSGGNK 3836 sp|Q8WVV9-5|HNRLL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.5938.8 50.24968 4 1683.8305 1683.8289 K V 152 168 PSM KPSHTSAVSIAGK 3837 sp|Q9HC35-2|EMAL4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6058.7 53.54357 3 1281.7027 1281.7041 R E 92 105 PSM QGTEIDGR 3838 sp|P19338|NUCL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6039.10 53.02533 2 874.4128 874.4145 K S 450 458 PSM HVLTGSADNSCR 3839 sp|Q13347|EIF3I_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 11-UNIMOD:4 ms_run[1]:scan=1.1.5959.6 50.82403 3 1315.5955 1315.5939 K L 66 78 PSM AQPAQPADEPAEK 3840 sp|P25786-2|PSA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6047.7 53.24057 3 1350.6400 1350.6415 K A 250 263 PSM KFGNPGER 3841 sp|Q92841-1|DDX17_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6031.3 52.79215 3 903.4570 903.4563 K L 30 38 PSM VFLENVIR 3842 sp|P62805|H4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.1652.2 11.33022 2 988.5690 988.5706 K D 61 69 PSM FHHTIGGSR 3843 sp|P61313|RL15_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.5973.3 51.20538 3 1010.5066 1010.5046 K R 180 189 PSM RCQYVTEK 3844 sp|P04075-2|ALDOA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 2-UNIMOD:4 ms_run[1]:scan=1.1.5999.9 51.91543 2 1082.5186 1082.5179 K V 255 263 PSM KLNVTEQEK 3845 sp|P06733|ENOA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6062.9 53.65619 2 1087.5874 1087.5873 K I 81 90 PSM DAVTYTEHAK 3846 sp|P62805|H4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.1624.2 10.6657 3 1133.5342 1133.5353 R R 69 79 PSM ESYSIYVYK 3847 sp|P06899|H2B1J_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.1632.6 10.8456 2 1150.5540 1150.5546 K V 36 45 PSM LGQSESQGPPR 3848 sp|O00233-2|PSMD9_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6115.10 55.07295 2 1154.5682 1154.5680 K A 124 135 PSM YTQVGPDHNR 3849 sp|Q08211|DHX9_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6008.9 52.16447 2 1185.5526 1185.5527 K S 200 210 PSM ASGPPVSELITK 3850 sp|P10412|H14_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.1638.9 11.00858 2 1197.6568 1197.6605 K A 35 47 PSM RPDQQLQGEGK 3851 sp|Q8NC51-3|PAIRB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6003.7 52.0225 3 1254.6325 1254.6317 R I 112 123 PSM LGIHEDSQNRK 3852 sp|P07900-2|HS90A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6014.3 52.32127 4 1295.6621 1295.6582 K K 569 580 PSM EVAENQQNQSSDPEEEK 3853 sp|O43491-4|E41L2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6036.11 52.94387 3 1959.8272 1959.8293 K G 29 46 PSM HLTHAQSTLDAK 3854 sp|Q15125|EBP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6005.11 52.08452 2 1320.6778 1320.6786 K A 210 222 PSM RPLEDGDQPDAKK 3855 sp|Q96AE4-2|FUBP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.5904.10 49.32427 3 1467.7357 1467.7317 K V 65 78 PSM YHTVNGHNCEVR 3856 sp|P09651-2|ROA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 9-UNIMOD:4 ms_run[1]:scan=1.1.6050.9 53.32647 3 1484.6548 1484.6579 K K 167 179 PSM HVEASGGSGPGDSGPSDPR 3857 sp|Q9UPT8|ZC3H4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6075.10 54.01192 3 1764.7672 1764.7663 R L 873 892 PSM AICLDHAK 3858 sp|Q93008-1|USP9X_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 3-UNIMOD:4 ms_run[1]:scan=1.1.6486.2 65.17097 3 926.4625 926.4644 R L 1059 1067 PSM AISGVHTVR 3859 sp|P41091|IF2G_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6222.2 58.01083 3 938.5315 938.5298 K F 60 69 PSM IAVHCTVR 3860 sp|P62913-2|RL11_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 5-UNIMOD:4 ms_run[1]:scan=1.1.6255.4 58.92803 3 954.5071 954.5069 K G 67 75 PSM RGGADVNIR 3861 sp|P08621|RU17_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6183.3 56.9306 3 956.5171 956.5152 R H 201 210 PSM HQPTAIIAK 3862 sp|P29401-2|TKT_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6319.2 60.6905 3 977.5666 977.5658 K T 241 250 PSM IYHPNVDK 3863 sp|Q5JXB2|UE2NL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6443.3 64.01708 3 984.5011 984.5029 K L 76 84 PSM ITNQVHGLK 3864 sp|P51665|PSMD7_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6344.4 61.36687 3 1008.5719 1008.5716 R G 191 200 PSM KLQEQLEK 3865 sp|Q9P2E9|RRBP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6273.5 59.4273 3 1014.5707 1014.5709 K A 1390 1398 PSM KVVDYTTAK 3866 sp|P62820|RAB1A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6254.3 58.8988 3 1023.5680 1023.5601 K E 132 141 PSM DLENGSHIR 3867 sp|P25205-2|MCM3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6417.4 63.32592 3 1039.5052 1039.5047 R G 373 382 PSM ALTQTGGPHVK 3868 sp|P21333-2|FLNA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6165.4 56.43503 3 1107.6064 1107.6037 R A 1284 1295 PSM PHSVSLNDTETRK 3869 sp|Q9P0L0|VAPA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6292.3 59.94933 4 1482.7437 1482.7427 K L 162 175 PSM GSGTAEVELKK 3870 sp|P14618-2|KPYM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6312.3 60.49848 3 1117.6000 1117.5979 K G 126 137 PSM LYAVHQEGNK 3871 sp|P50990|TCPQ_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6282.6 59.67798 3 1157.5840 1157.5829 K N 467 477 PSM IYGESADAVKK 3872 sp|P51114|FXR1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6511.5 65.86142 3 1179.6136 1179.6135 R A 264 275 PSM LGGAGMER 3873 sp|P52272|HNRPM_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6254.5 58.90213 2 789.3802 789.3803 R M 411 419 PSM LQSEPESIRK 3874 sp|P09496-2|CLCA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6265.7 59.20907 3 1185.6361 1185.6353 R W 103 113 PSM TVSLGAGAK 3875 sp|P06748|NPM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.6446.4 64.10105 2 802.453047 802.454868 R D 46 55 PSM HLVYESDQNK 3876 sp|O43852-2|CALU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6367.5 62.00095 3 1231.5844 1231.5833 R D 272 282 PSM VGELCAGK 3877 sp|P18206|VINC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 5-UNIMOD:4 ms_run[1]:scan=1.1.6283.4 59.70233 2 832.4098 832.4113 K E 309 317 PSM APGFGDNR 3878 sp|P10809|CH60_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6490.4 65.28398 2 832.3828 832.3828 K K 302 310 PSM ESHTAVVYTEK 3879 sp|P51610-2|HCFC1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6427.5 63.59008 3 1262.6137 1262.6143 R D 201 212 PSM LADHFGGK 3880 sp|Q9Y383-3|LC7L2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6431.5 63.69468 2 843.4258 843.4239 R L 203 211 PSM AHVDEFK 3881 sp|Q16851|UGPA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6242.6 58.57283 2 844.4076 844.4079 K S 313 320 PSM YSHVQEVQER 3882 sp|Q93008-1|USP9X_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6202.6 57.46267 3 1273.6006 1273.6051 R L 648 658 PSM IGDEDVGR 3883 sp|P23284|PPIB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6273.7 59.43063 2 859.4024 859.4036 R V 52 60 PSM RQITQNTDYR 3884 sp|Q92896|GSLG1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6273.8 59.4323 3 1293.6412 1293.6425 K L 924 934 PSM SAVLQEAR 3885 sp|Q9UBF2-2|COPG2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6452.4 64.2656 2 872.4700 872.4716 K V 25 33 PSM TVCGVVSR 3886 sp|P19367-4|HXK1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 3-UNIMOD:4 ms_run[1]:scan=1.1.6399.5 62.83907 2 876.4460 876.4488 K R 809 817 PSM SDLYSSGR 3887 sp|P38159-2|RBMX_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6449.7 64.18826 2 883.4030 883.4035 R D 319 327 PSM SDLYSSGR 3888 sp|P38159-2|RBMX_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6468.2 64.68867 2 883.4030 883.4035 R D 319 327 PSM HPAKPDPSGECNPDLR 3889 sp|Q16576-2|RBBP7_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 11-UNIMOD:4 ms_run[1]:scan=1.1.6485.5 65.1486 4 1788.8185 1788.8213 K L 200 216 PSM RGGSGSHNWGTVK 3890 sp|Q8NC51-3|PAIRB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6336.7 61.1548 3 1341.6523 1341.6538 K D 216 229 PSM TIHAELSK 3891 sp|Q14318-2|FKBP8_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6294.2 60.00305 3 897.4921 897.4920 K L 342 350 PSM ATVTPSPVK 3892 sp|Q9H1E3-2|NUCKS_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6340.7 61.26327 2 898.5136 898.5124 K G 136 145 PSM YSEGYPGK 3893 sp|P34897-2|GLYM_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6480.6 65.0136 2 899.4016 899.4025 K R 96 104 PSM MGANNLER 3894 sp|P52272|HNRPM_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6509.8 65.81143 2 903.4218 903.4232 R M 558 566 PSM VGEFSGANK 3895 sp|P10599-2|THIO_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6393.6 62.6838 2 907.4396 907.4399 K E 66 75 PSM YQDTPGVK 3896 sp|P53396|ACLY_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6226.9 58.1333 2 906.4458 906.4447 R M 704 712 PSM GVVSGEVER 3897 sp|Q03701|CEBPZ_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6506.9 65.73045 2 930.4748 930.4771 K L 418 427 PSM LREDLER 3898 sp|P62269|RS18_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6417.2 63.32258 3 929.4943 929.4930 K L 107 114 PSM SSEPVQHEESIR 3899 sp|Q9UDY2-7|ZO2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6351.8 61.56533 3 1396.6615 1396.6582 R K 983 995 PSM LLEGEESR 3900 sp|P05787-2|K2C8_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6486.7 65.1793 2 931.4610 931.4610 K I 422 430 PSM NDYVAAER 3901 sp|Q99747|SNAG_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.6437.7 63.85933 2 936.433047 936.430110 R C 208 216 PSM GAGGFGGGGGTR 3902 sp|Q86V81|THOC4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6190.7 57.13102 2 949.4380 949.4366 R R 205 217 PSM AGQSAAGAAPGGGVDTR 3903 sp|P21333-2|FLNA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6279.8 59.59828 3 1441.6888 1441.6910 R D 8 25 PSM VTHLVANCTQGEK 3904 sp|Q9H8V3-4|ECT2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1000663, ProteinPilot, ] 18 8-UNIMOD:4 ms_run[1]:scan=1.1.6280.8 59.62605 3 1455.7170706434902 1455.7140126204602 K F 183 196 PSM QVFEGQNR 3905 sp|P49257|LMAN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6360.9 61.8141 2 976.4718 976.4726 R I 333 341 PSM KVAPAPAVVK 3906 sp|P62424|RL7A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6212.9 57.74578 2 978.6220 978.6226 K K 11 21 PSM IHNAENIQPGEQK 3907 sp|Q04637-9|IF4G1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6243.8 58.60397 3 1476.7327 1476.7321 K Y 588 601 PSM APCQAGDLR 3908 sp|P48431|SOX2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 3-UNIMOD:4 ms_run[1]:scan=1.1.6282.10 59.68465 2 986.4594 986.4604 R D 263 272 PSM KPHTLLQR 3909 sp|P49915|GUAA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6246.3 58.67855 3 991.5946 991.5927 K V 478 486 PSM NSTWSGESK 3910 sp|P19338|NUCL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6235.8 58.38148 2 994.4374 994.4356 K T 478 487 PSM VTEGGEPYR 3911 sp|Q14697|GANAB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6320.8 60.72828 2 1006.4734 1006.4720 K L 270 279 PSM SEGGLSAAPAR 3912 sp|Q7Z6K5-2|ARPIN_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6433.8 63.75267 2 1014.4974 1014.5094 K A 351 362 PSM GEGQLGPAER 3913 sp|P13639|EF2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6435.7 63.80462 2 1012.4938 1012.4938 K A 240 250 PSM TSEVNCYR 3914 sp|P62633-2|CNBP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 6-UNIMOD:4 ms_run[1]:scan=1.1.6283.9 59.71067 2 1027.4410 1027.4393 K C 146 154 PSM HSEAATAQREEWK 3915 sp|Q14103-3|HNRPD_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6517.10 66.03512 3 1541.7205 1541.7222 R M 86 99 PSM LGDSHDLQR 3916 sp|Q13813|SPTN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6225.8 58.1039 2 1039.5072 1039.5047 K F 1335 1344 PSM EVEEDEYK 3917 sp|P14625|ENPL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6352.9 61.59443 2 1039.4360 1039.4346 K A 349 357 PSM DANGNSFATR 3918 sp|P62701|RS4X_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6474.10 64.85795 2 1051.4680 1051.4683 K L 212 222 PSM IGAVNCGDDR 3919 sp|Q8IXB1-2|DJC10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 6-UNIMOD:4 ms_run[1]:scan=1.1.6253.10 58.88295 2 1075.4766 1075.4717 R M 181 191 PSM NSAQGNVYVK 3920 sp|Q14498-2|RBM39_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6376.10 62.24517 2 1078.5408 1078.5407 K C 462 472 PSM RAYDIAGSTK 3921 sp|P11388-4|TOP2A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6511.9 65.86808 2 1080.5544 1080.5564 R D 242 252 PSM KDDEVQVVR 3922 sp|P61254|RL26_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6363.10 61.8987 2 1086.5662 1086.5669 R G 51 60 PSM SAHAGTYEVR 3923 sp|P51571|SSRD_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6185.5 56.989 3 1089.5215 1089.5203 K F 96 106 PSM RLLSNEEEK 3924 sp|O14976|GAK_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6209.4 57.65392 3 1116.5827 1116.5775 K N 70 79 PSM AYSEAHEISK 3925 sp|P61981|1433G_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6171.10 56.61067 2 1133.5354 1133.5353 K E 153 163 PSM IQAGEVSQPSK 3926 sp|Q9BRP8-2|PYM1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6295.10 60.04407 2 1142.5928 1142.5931 R E 170 181 PSM YTAQVDAEEK 3927 sp|O75947|ATP5H_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6514.10 65.95248 2 1152.5304 1152.5299 K E 86 96 PSM RTDALTSSPGR 3928 sp|P49736|MCM2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6132.3 55.5307 3 1159.5970 1159.5945 R D 34 45 PSM TENNDHINLK 3929 sp|P61956-2|SUMO2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6503.4 65.6397 3 1196.5789 1196.5785 K V 12 22 PSM DSYVGDEAQSK 3930 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6491.11 65.32301 2 1197.5162 1197.5150 K R 51 62 PSM VLVQNAAGSQEK 3931 sp|Q9Y490|TLN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6398.10 62.8211 2 1242.6574 1242.6568 K L 2032 2044 PSM NRPPLPAGTNSK 3932 sp|P42166|LAP2A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6297.10 60.09923 2 1250.6728 1250.6731 R G 49 61 PSM ESHTAVVYTEK 3933 sp|P51610-2|HCFC1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6433.11 63.75767 2 1262.6110 1262.6143 R D 201 212 PSM QTTQDAPEEVR 3934 sp|Q9P013|CWC15_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6307.11 60.37393 2 1272.5934 1272.5946 R N 45 56 PSM QAGEVTYADAHK 3935 sp|Q13247|SRSF6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6340.11 61.26993 2 1288.6038 1288.6048 R G 132 144 PSM AEEEAATPGGGVER 3936 sp|Q9Y467|SALL2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6417.11 63.33758 2 1371.6284 1371.6266 K K 461 475 PSM RGGGDEESGEHTQVPADSPDSQEEQK 3937 sp|Q02952-2|AKA12_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6452.11 64.27727 4 2768.1789 2768.1758 K G 439 465 PSM KLEDQNEYESR 3938 sp|Q96SU4-2|OSBL9_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6418.10 63.36308 3 1409.6494 1409.6422 R S 643 654 PSM TPPSEEDSAEAER 3939 sp|O43765|SGTA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6212.11 57.74911 2 1416.6066 1416.6004 R L 81 94 PSM EELEQASQAHGAR 3940 sp|Q14980|NUMA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6233.9 58.32753 3 1424.6659 1424.6644 K L 483 496 PSM SCCSCCPVGCAK 3941 sp|Q8N339|MT1M_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 2-UNIMOD:4,3-UNIMOD:4,5-UNIMOD:4,6-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.6178.11 56.80575 2 1444.5036 1444.5026 K C 32 44 PSM CCAAADPHECYAK 3942 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.6340.10 61.26826 3 1551.5929 1551.5905 K V 384 397 PSM EGSQGELTPANSQSR 3943 sp|Q13098-5|CSN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6426.11 63.57415 2 1559.7174 1559.7176 R M 468 483 PSM SNPSAVAGNETPGASTK 3944 sp|Q9UDY2-7|ZO2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6515.11 65.98174 2 1586.7530 1586.7536 K G 1048 1065 PSM LQQQQRPEDAEDGAEGGGK 3945 sp|Q08J23-2|NSUN2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6174.9 56.69187 3 2011.9216 2011.9195 R R 10 29 PSM GGVVGIK 3946 sp|P04075-2|ALDOA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6597.2 68.22085 2 628.3898 628.3908 K V 156 163 PSM VVHIIQSR 3947 sp|Q58F21-5|BRDT_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6711.3 71.33427 3 950.5657 950.5661 R E 460 468 PSM EDSVKPGAHLTVK 3948 sp|P51991|ROA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6691.5 70.78915 4 1379.7417 1379.7409 R K 114 127 PSM TKFENLCK 3949 sp|P07900-2|HS90A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 7-UNIMOD:4 ms_run[1]:scan=1.1.6860.2 75.38987 3 1038.5155 1038.5168 K I 688 696 PSM KSDPVVSYR 3950 sp|P13639|EF2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6565.4 67.34377 3 1049.5495 1049.5506 K E 572 581 PSM RGAAGDWGER 3951 sp|Q14978-2|NOLC1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6697.5 70.95368 3 1073.5003 1073.5002 K A 658 668 PSM IHCLENVDK 3952 sp|Q01082-3|SPTB2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 3-UNIMOD:4 ms_run[1]:scan=1.1.6721.4 71.60986 3 1126.5436 1126.5441 R A 97 106 PSM SQIPLSK 3953 sp|P13010|XRCC5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6841.3 74.87285 2 771.4478 771.4490 K I 526 533 PSM LVGEIKEEEK 3954 sp|Q9Y2Z0-2|SGT1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6766.4 72.84385 3 1172.6272 1172.6288 K N 258 268 PSM PEINTNHLDK 3955 sp|Q13907|IDI1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6725.3 71.71817 3 1179.5860 1179.5884 M Q 2 12 PSM QQSELQSQVR 3956 sp|Q14847-2|LASP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6590.4 68.03138 3 1201.6039 1201.6051 K Y 76 86 PSM SVDETLR 3957 sp|Q13162|PRDX4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6532.5 66.4389 2 818.4138 818.4134 R L 224 231 PSM SIQSGPLK 3958 sp|Q16891-2|MIC60_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6668.4 70.15708 2 828.4692 828.4705 K I 103 111 PSM AEEILEK 3959 sp|P62913-2|RL11_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6852.6 75.17765 2 830.4378 830.4385 K G 78 85 PSM RGGPNYQEGLR 3960 sp|P53396|ACLY_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6890.4 76.21326 3 1245.6202 1245.6214 R V 379 390 PSM AMQGLTGR 3961 sp|P26368-2|U2AF2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6769.4 72.92602 2 832.4212 832.4225 K K 441 449 PSM IAASSSFR 3962 sp|Q99961-3|SH3G1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6776.8 73.12444 2 837.4340 837.4344 K S 219 227 PSM TALNHCNLCR 3963 sp|O60313|OPA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1000663, ProteinPilot, ] 18 6-UNIMOD:4,9-UNIMOD:4 ms_run[1]:scan=1.1.6552.5 66.98846 3 1257.5802706434902 1257.5706602248301 K R 848 858 PSM NCAAYLK 3964 sp|P35580-3|MYH10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 2-UNIMOD:4 ms_run[1]:scan=1.1.6757.4 72.6001 2 838.4002 838.4007 R L 843 850 PSM GGPGGELPR 3965 sp|Q04637-9|IF4G1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6810.6 74.05415 2 838.4286 838.4297 R G 693 702 PSM AGAVEQLR 3966 sp|P08240-2|SRPRA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6595.4 68.16928 2 842.4572 842.4610 R T 431 439 PSM RVTIMPK 3967 sp|Q71DI3|H32_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6650.6 69.6683 2 843.5002 843.5000 K D 117 124 PSM TVLDQQQTPSR 3968 sp|P42704|LPPRC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6813.6 74.13618 3 1271.6455 1271.6470 K L 1129 1140 PSM GPGPLQER 3969 sp|P43243|MATR3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6619.8 68.82402 2 852.4316 852.4454 R S 256 264 PSM TAVAPIER 3970 sp|P12236|ADT3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6692.8 70.82159 2 855.4800 855.4814 K V 24 32 PSM VLATVTKPVGGDK 3971 sp|Q02878|RL6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6876.6 75.8358 3 1283.7451 1283.7449 K N 88 101 PSM TAVAPIER 3972 sp|P12236|ADT3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6668.6 70.16042 2 855.4800 855.4814 K V 24 32 PSM VISELNGK 3973 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6848.5 75.06675 2 858.4806 858.4811 K N 42 50 PSM ILTTASSHEFEHTKK 3974 sp|Q16851|UGPA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6889.5 76.18829 4 1727.8805 1727.8842 K D 39 54 PSM TGSAVAPVHPPNR 3975 sp|Q8IZL8|PELP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6696.6 70.928 3 1301.6818 1301.6840 R S 49 62 PSM ISSSSFSR 3976 sp|P05787-2|K2C8_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6903.7 76.55645 2 869.4214 869.4243 R V 61 69 PSM QAILAAQR 3977 sp|O60869-3|EDF1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6813.7 74.13785 2 869.5068 869.5083 K R 26 34 PSM QILDEAGK 3978 sp|P18206|VINC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6890.6 76.2166 2 872.4584 872.4603 R V 301 309 PSM QILDEAGK 3979 sp|P18206|VINC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6910.6 76.7356 2 872.4582 872.4603 R V 301 309 PSM MGANSLER 3980 sp|P52272|HNRPM_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6651.3 69.69057 2 876.4122 876.4123 R M 571 579 PSM GDKEEVAYEER 3981 sp|Q9NRV9|HEBP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6526.6 66.27568 3 1323.5971 1323.5942 K A 24 35 PSM ADTQTYQPYNK 3982 sp|P84090|ERH_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6892.7 76.271 3 1327.6018 1327.6044 R D 74 85 PSM AETLVQAR 3983 sp|Q01860|PO5F1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6696.7 70.92966 2 886.4874 886.4872 K K 223 231 PSM SVQTFADK 3984 sp|P47756-2|CAPZB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6713.7 71.39565 2 894.4448 894.4447 R S 245 253 PSM LAQLEEAK 3985 sp|P24539|AT5F1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6867.5 75.58701 2 900.4894 900.4916 K Q 132 140 PSM LAQLEEAK 3986 sp|P24539|AT5F1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6852.9 75.18265 2 900.4894 900.4916 K Q 132 140 PSM EAADPLASK 3987 sp|P53618|COPB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6759.7 72.65898 2 900.4566 900.4552 K L 704 713 PSM RLASSVLR 3988 sp|P84098|RL19_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.6785.7 73.36951 2 900.544647 900.550499 K C 9 17 PSM DGYSYGSR 3989 sp|Q13247|SRSF6_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6616.7 68.74216 2 903.3726 903.3723 R S 78 86 PSM VISSIEQK 3990 sp|P27348|1433T_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6567.10 67.40857 2 902.5074 902.5073 R T 61 69 PSM EDGSGDRGDGPFR 3991 sp|P13010|XRCC5_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6768.3 72.89702 3 1363.5733 1363.5753 K L 172 185 PSM LSVDYGKK 3992 sp|P68366-2|TBA4A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6704.2 71.14065 3 908.4952 908.4967 R S 142 150 PSM EIVAEAER 3993 sp|P55010|IF5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6589.7 68.0088 2 915.4648 915.4661 K L 262 270 PSM LNSGVDYR 3994 sp|P62312|LSM6_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6821.10 74.35762 2 922.4498 922.4508 K G 24 32 PSM ELEVAEGGK 3995 sp|Q16543|CDC37_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6646.9 69.5642 2 930.4658 930.4658 K A 70 79 PSM DDNPNLPR 3996 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6769.8 72.93269 2 939.4400 939.4410 K L 131 139 PSM IIVGDATEK 3997 sp|Q96I25|SPF45_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6910.9 76.7406 2 944.5132 944.5179 K D 277 286 PSM AQCPIVER 3998 sp|P46782|RS5_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 3-UNIMOD:4 ms_run[1]:scan=1.1.6664.8 70.05425 2 971.4878 971.4858 K L 64 72 PSM IGKPAPDFK 3999 sp|P32119|PRDX2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6859.2 75.36245 3 971.5429 971.5440 R A 8 17 PSM LDGTEINGR 4000 sp|Q13247|SRSF6_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6737.10 72.06062 2 973.4828 973.4829 K N 166 175 PSM LVEDMENK 4001 sp|P47756-2|CAPZB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6706.6 71.20208 2 976.4566 976.4535 R I 216 224 PSM TEISEMNR 4002 sp|P05787-2|K2C8_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6806.7 73.94603 2 978.4434 978.4440 K N 333 341 PSM EYTAAVEAK 4003 sp|Q99623|PHB2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6563.8 67.29559 2 980.4794 980.4814 R Q 192 201 PSM FEESMSEK 4004 sp|Q92896|GSLG1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6732.5 71.91433 2 985.4064 985.4062 K C 343 351 PSM ATFNPAQDK 4005 sp|O00592-2|PODXL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6784.9 73.34544 2 990.4762 990.4771 K C 354 363 PSM ADDKETCFAEEGK 4006 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 7-UNIMOD:4 ms_run[1]:scan=1.1.6819.10 74.30465 3 1498.6255 1498.6246 K K 585 598 PSM TIIGQQGDQSCANK 4007 sp|P35251-2|RFC1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 11-UNIMOD:4 ms_run[1]:scan=1.1.6584.10 67.87572 3 1518.7072 1518.7097 K L 597 611 PSM TVEACPVVR 4008 sp|P11717|MPRI_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 5-UNIMOD:4 ms_run[1]:scan=1.1.6880.8 75.94887 2 1029.5260 1029.5277 R V 1213 1222 PSM LQELEQQREEQK 4009 sp|Q02040|AK17A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6527.10 66.30981 3 1556.7769 1556.7794 K R 278 290 PSM AMNGESLDGR 4010 sp|P98179|RBM3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6858.8 75.34509 2 1048.4612 1048.4607 R Q 66 76 PSM WGASTATTQK 4011 sp|Q9UKV3|ACINU_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6588.9 67.98444 2 1049.5128 1049.5142 R K 851 861 PSM IAPPETPDSK 4012 sp|Q9NZI8|IF2B1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6872.10 75.73257 2 1053.5326 1053.5342 K V 441 451 PSM VYSTSVTGSR 4013 sp|Q9H299|SH3L3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6555.10 67.07917 2 1055.5236 1055.5248 R E 6 16 PSM NGAVQTIAQR 4014 sp|P82675|RT05_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6735.8 72.00205 2 1056.5660 1056.5676 K S 151 161 PSM VVNDEEVVR 4015 sp|O75691|UTP20_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6855.8 75.26293 2 1057.5406 1057.5404 K V 1812 1821 PSM AHIAQLCEK 4016 sp|Q00610-2|CLH1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 7-UNIMOD:4 ms_run[1]:scan=1.1.6563.10 67.29892 2 1068.5354 1068.5386 R A 611 620 PSM ETCFAEEGK 4017 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 3-UNIMOD:4 ms_run[1]:scan=1.1.6623.9 68.93525 2 1069.4364 1069.4386 K K 589 598 PSM ITITNDQNR 4018 sp|P11021|BIP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6608.11 68.53703 2 1073.5438 1073.5465 K L 524 533 PSM SPAAECLSEK 4019 sp|Q12931|TRAP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 6-UNIMOD:4 ms_run[1]:scan=1.1.6530.9 66.39062 2 1090.4956 1090.4964 R E 568 578 PSM AALRPLVKPK 4020 sp|P62910|RL32_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6628.6 69.06763 3 1091.7178 1091.7179 M I 2 12 PSM QQQEELEAEHGTGDKPAAPR 4021 sp|Q13895|BYST_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6844.7 74.96117 4 2190.0269 2190.0301 R E 64 84 PSM SPPGQVTEAVK 4022 sp|P15121|ALDR_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6817.10 74.25117 2 1111.5858 1111.5873 K V 23 34 PSM LEQGGTADGLR 4023 sp|O43290|SNUT1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6687.11 70.68977 2 1115.5552 1115.5571 R E 351 362 PSM NCLALADDKK 4024 sp|O75367-3|H2AY_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 2-UNIMOD:4 ms_run[1]:scan=1.1.6830.11 74.59415 2 1146.5666 1146.5703 K L 295 305 PSM QSTGSAPQGPAYHGVNR 4025 sp|O14497|ARI1A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6712.10 71.37328 3 1725.8182 1725.8183 R T 1512 1529 PSM ANSSVVSVNCK 4026 sp|O60502-2|OGA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 10-UNIMOD:4 ms_run[1]:scan=1.1.6546.11 66.83335 2 1163.5602 1163.5605 R G 534 545 PSM AIEENNNFSK 4027 sp|P16949|STMN1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6776.11 73.12943 2 1164.5400 1164.5411 K M 86 96 PSM SSVDLEESSTK 4028 sp|Q8NFC6|BD1L1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6737.11 72.06229 2 1180.5476 1180.5459 R S 537 548 PSM QVENAGAIGPSR 4029 sp|Q9UHD8|SEPT9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6752.11 72.4755 2 1197.6084 1197.6102 K F 118 130 PSM QTEEQVNDLK 4030 sp|P12270|TPR_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6684.11 70.60767 2 1202.5772 1202.5779 R E 943 953 PSM VLANPGNSQVAR 4031 sp|Q14974|IMB1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6722.11 71.64903 2 1224.6566 1224.6575 R V 43 55 PSM NHEAQIQDMR 4032 sp|P35580-3|MYH10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6756.8 72.57972 3 1240.5628 1240.5618 K Q 1210 1220 PSM EELEQTYHAK 4033 sp|P20700|LMNB1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6594.11 68.15345 2 1246.5776 1246.5829 K L 262 272 PSM TYGEPESAGPSR 4034 sp|P50402|EMD_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6537.11 66.58636 2 1249.5558 1249.5575 R A 104 116 PSM TQIQSQESDLK 4035 sp|Q9UBC2-2|EP15R_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6855.11 75.26794 2 1275.6276 1275.6306 K S 482 493 PSM GQVSESEDSITK 4036 sp|O95239-2|KIF4A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6701.11 71.0736 2 1278.5890 1278.5939 R Q 807 819 PSM LCVQNSPQEAR 4037 sp|P33240-2|CSTF2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 2-UNIMOD:4 ms_run[1]:scan=1.1.6700.11 71.04613 2 1300.6222 1300.6194 K N 149 160 PSM VQEGETIEDGAR 4038 sp|P36639-3|8ODP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6867.11 75.59702 2 1302.6044 1302.6052 K R 54 66 PSM SGAQASSTPLSPTR 4039 sp|P02545-2|LMNA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6807.11 73.98015 2 1358.6778 1358.6790 R I 12 26 PSM EELEEEQRTEE 4040 sp|P84157-2|MXRA7_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6714.11 71.42968 2 1419.6014 1419.6001 K - 160 171 PSM VEQATKPSFESGR 4041 sp|P38159-2|RBMX_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6769.11 72.93768 2 1434.7110 1434.7103 K R 68 81 PSM AGEVFIHK 4042 sp|Q15233-2|NONO_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7048.2 80.43037 3 899.4853 899.4865 K D 11 19 PSM TAAYGHFGR 4043 sp|P31153|METK2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7071.3 81.05042 3 978.4678 978.4672 R D 374 383 PSM IRIEDPPR 4044 sp|P61160-2|ARP2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7195.3 84.37421 3 994.5547 994.5560 K R 347 355 PSM ERGTVYFK 4045 sp|Q02790|FKBP4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7215.2 84.91507 3 998.5183 998.5185 K E 275 283 PSM DYGNSPLHR 4046 sp|P26599-2|PTBP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6957.2 77.98167 3 1057.4929 1057.4941 K F 448 457 PSM DGDILGK 4047 sp|P61604|CH10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7062.3 80.8115 2 716.3692 716.3705 R Y 93 100 PSM AAQLAIR 4048 sp|P62910|RL32_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7129.4 82.61755 2 741.4502 741.4497 R V 115 122 PSM CCTESLVNR 4049 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 1-UNIMOD:4,2-UNIMOD:4 ms_run[1]:scan=1.1.7024.3 79.78655 3 1137.4891 1137.4907 K R 500 509 PSM GGPTPQEAIQR 4050 sp|Q9H444|CHM4B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7209.3 84.75504 3 1152.5992 1152.5887 K L 18 29 PSM LQAVTDDHIR 4051 sp|P30043|BLVRB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7265.5 86.28457 3 1166.6026 1166.6044 R M 125 135 PSM VHELNEEIGK 4052 sp|Q9Y383-3|LC7L2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7177.5 83.89671 3 1166.5939 1166.5931 R L 123 133 PSM LLEVQGSRPGK 4053 sp|P62136|PP1A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6975.6 78.47615 3 1182.6706 1182.6721 R N 16 27 PSM GRPYDYNGPR 4054 sp|P13667|PDIA4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7252.5 85.92793 3 1193.5567 1193.5578 K E 261 271 PSM RGDTVATLSER 4055 sp|P22102|PUR2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6985.4 78.7466 3 1203.6172 1203.6208 K V 965 976 PSM GKGEGDLSQLSK 4056 sp|Q9P013|CWC15_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7062.5 80.81483 3 1217.6272 1217.6252 R Q 17 29 PSM HEQEYMEVR 4057 sp|Q15363|TMED2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7279.4 86.66891 3 1219.5262 1219.5291 K E 146 155 PSM VLLGETGK 4058 sp|P62280|RS11_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7162.5 83.50903 2 815.4744 815.4753 R E 23 31 PSM NHEEEISTLR 4059 sp|P08727|K1C19_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7219.5 85.02773 3 1226.5879 1226.5891 K G 217 227 PSM VGFAEAAR 4060 sp|P07339|CATD_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7298.3 87.18847 2 819.4214 819.4239 R L 404 412 PSM VGFAEAAR 4061 sp|P07339|CATD_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7296.8 87.14217 2 819.4214 819.4239 R L 404 412 PSM LNVCVSK 4062 sp|P14866|HNRPL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 4-UNIMOD:4 ms_run[1]:scan=1.1.7018.2 79.62772 2 818.4312 818.4320 R Q 449 456 PSM IQVDYDGHCK 4063 sp|Q12841|FSTL1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 9-UNIMOD:4 ms_run[1]:scan=1.1.7183.4 84.05178 3 1233.5509 1233.5448 K E 90 100 PSM VGEVIVTK 4064 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7054.6 80.60072 2 843.5070 843.5066 K D 345 353 PSM RESQSVEEALK 4065 sp|P49915|GUAA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7051.7 80.52077 3 1274.6446 1274.6466 K K 278 289 PSM YLAEVAAGDDKK 4066 sp|P63104|1433Z_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7115.7 82.2484 3 1278.6454 1278.6456 R G 128 140 PSM GTLDPVEK 4067 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6937.6 77.44905 2 857.4492 857.4494 R A 312 320 PSM MDSTEPPYSQK 4068 sp|Q5VTE0|EF1A3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6920.4 76.99263 3 1281.5539 1281.5547 K R 155 166 PSM GNDIIAAAK 4069 sp|P18206|VINC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7178.3 83.91932 2 871.4776 871.4763 K R 984 993 PSM NMSVIAHVDHGK 4070 sp|P13639|EF2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7232.5 85.38084 3 1306.6429 1306.6452 R S 21 33 PSM GNDIIAAAK 4071 sp|P18206|VINC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7185.6 84.10812 2 871.4776 871.4763 K R 984 993 PSM TSVETALR 4072 sp|P47755-2|CAZA2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7239.5 85.57214 2 875.4706 875.4712 R A 122 130 PSM VLTPTQVK 4073 sp|P30086|PEBP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6928.8 77.2104 2 884.5316 884.5331 K N 40 48 PSM AAIAQLNGK 4074 sp|Q96PK6|RBM14_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7039.7 80.19405 2 884.5050 884.5079 K E 127 136 PSM ELTAVVQK 4075 sp|P23396-2|RS3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7045.7 80.35699 2 886.5118 886.5124 R R 68 76 PSM TQQVVAIK 4076 sp|Q9P289|STK26_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6947.5 77.71748 2 885.5322 885.5284 R I 46 54 PSM SAHATAPVNIAGSR 4077 sp|Q9UQ35|SRRM2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7080.7 81.29708 3 1350.6985 1350.7004 R T 2343 2357 PSM SYSDPPLK 4078 sp|P52597|HNRPF_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7084.8 81.40781 2 905.4484 905.4494 R F 193 201 PSM SYSDPPLK 4079 sp|P52597|HNRPF_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7065.9 80.90118 2 905.4484 905.4494 R F 193 201 PSM VNSMVAYK 4080 sp|Q13257|MD2L1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7277.8 86.62048 2 910.4594 910.4582 K I 193 201 PSM IISSIEQK 4081 sp|P62258|1433E_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7012.10 79.4837 2 916.5232 916.5229 R E 62 70 PSM VVFDSAQR 4082 sp|P13798|ACPH_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7231.7 85.35693 2 920.4720 920.4716 R S 376 384 PSM QVNITVQK 4083 sp|Q9P035|HACD3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7094.7 81.67823 2 928.5342 928.5342 R K 77 85 PSM IDDVVNTR 4084 sp|P50991|TCPD_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7019.11 79.66887 2 930.4788 930.4771 K - 532 540 PSM YSDSLVQK 4085 sp|P52701-3|MSH6_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7136.6 82.80907 2 938.4662 938.4709 R G 339 347 PSM LAHEVGWK 4086 sp|P40429|RL13A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7288.2 86.91327 3 938.4958 938.4974 R Y 141 149 PSM TLLVNNNR 4087 sp|P09661|RU2A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6996.11 79.05962 2 942.5236 942.5247 K I 68 76 PSM TISETIER 4088 sp|P26639-2|SYTC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7255.6 86.01192 2 947.4914 947.4924 R L 733 741 PSM MINTDLSR 4089 sp|P36578|RL4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 1-UNIMOD:35 ms_run[1]:scan=1.1.7128.7 82.59582 2 964.4688 964.4648 K I 284 292 PSM LTEGCSFR 4090 sp|Q71UM5|RS27L_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 5-UNIMOD:4 ms_run[1]:scan=1.1.7180.10 83.98307 2 968.4384 968.4386 R R 73 81 PSM ILNDVQDR 4091 sp|Q13838-2|DX39B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6959.6 78.04176 2 971.5016 971.5036 K F 414 422 PSM VNFEDDSR 4092 sp|O94979-2|SC31A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7089.10 81.54726 2 980.4214 980.4199 K G 479 487 PSM TYETTLEK 4093 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7133.6 82.7281 2 983.4814 983.4811 K C 376 384 PSM TYETTLEK 4094 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7152.9 83.25155 2 983.4814 983.4811 K C 376 384 PSM TYETTLEK 4095 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7114.8 82.22328 2 983.4814 983.4811 K C 376 384 PSM TVVAPSAVAGK 4096 sp|Q9NX14-2|NDUBB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7025.8 79.82114 2 998.5768 998.5761 R R 36 47 PSM YGMGTSVER 4097 sp|P08559-2|ODPA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7278.7 86.64643 2 998.4470 998.4491 R A 234 243 PSM ELSEQIQR 4098 sp|P15311|EZRI_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7018.7 79.63605 2 1001.5144 1001.5141 R A 364 372 PSM HNTYLQECTGQR 4099 sp|Q5T4S7-2|UBR4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 8-UNIMOD:4 ms_run[1]:scan=1.1.7120.8 82.38348 3 1505.6704 1505.6681 R E 4939 4951 PSM VHPVSTMIK 4100 sp|P00338-3|LDHA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7067.3 80.94435 3 1010.5576 1010.5583 R G 299 308 PSM LPEVQQATK 4101 sp|Q13428-3|TCOF_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6983.6 78.69518 2 1012.5520 1012.5553 K A 1130 1139 PSM EHTAYYIK 4102 sp|P31930|QCR1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7039.3 80.18739 3 1023.5041 1023.5025 R A 127 135 PSM DHFEEAMR 4103 sp|P55072|TERA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7219.9 85.0344 2 1033.4282 1033.4287 R F 734 742 PSM NGRVEIIANDQGNR 4104 sp|P11021|BIP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7237.9 85.52406 3 1554.7867 1554.7862 K I 47 61 PSM DIDENAYAK 4105 sp|Q13200|PSMD2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7154.8 83.30425 2 1037.4662 1037.4665 K V 220 229 PSM SSGGREDLESSGLQR 4106 sp|Q9UK76-2|JUPI1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7224.9 85.16963 3 1576.7449 1576.7441 K R 70 85 PSM QVSDDLTER 4107 sp|P35232|PHB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7136.7 82.81073 2 1061.4982 1061.4989 R A 149 158 PSM VATNPSFDGR 4108 sp|Q8NHH9-3|ATLA2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7231.8 85.3586 2 1062.5064 1062.5094 K L 132 142 PSM AANGVVLATEK 4109 sp|P25787|PSA2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7297.8 87.1695 2 1071.5922 1071.5924 K K 40 51 PSM QIPQATASMK 4110 sp|O43175|SERA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7191.8 84.27385 2 1073.5548 1073.5539 R D 120 130 PSM RISAVSVAER 4111 sp|Q08211|DHX9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6923.3 77.06965 3 1086.6106 1086.6145 R V 447 457 PSM RISAVSVAER 4112 sp|Q08211|DHX9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6942.3 77.57909 3 1086.6106 1086.6145 R V 447 457 PSM ESEFDDEPK 4113 sp|Q9Y2W1|TR150_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7034.6 80.057 2 1094.4432 1094.4404 K F 443 452 PSM LASAGVDTNVR 4114 sp|Q13112|CAF1B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7170.10 83.72385 2 1101.5764 1101.5778 R I 32 43 PSM QQEVETELK 4115 sp|P08621|RU17_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7036.8 80.1146 2 1102.5514 1102.5506 R M 79 88 PSM LLEVEHPAAK 4116 sp|P17987|TCPA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7211.9 84.81902 2 1105.6116 1105.6131 K V 64 74 PSM LTQEETNFK 4117 sp|Q9NTJ3|SMC4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7102.9 81.89945 2 1108.5386 1108.5400 K S 565 574 PSM EYAENIGDGR 4118 sp|Q8WYA6-2|CTBL1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7230.7 85.32955 2 1122.4940 1122.4941 K S 348 358 PSM CCTESLVNR 4119 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 1-UNIMOD:4,2-UNIMOD:4 ms_run[1]:scan=1.1.7010.9 79.4294 2 1137.4912 1137.4907 K R 500 509 PSM IQINQEEER 4120 sp|P42696|RBM34_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7032.9 80.0081 2 1157.5696 1157.5676 K L 172 181 PSM LCTVNSVEEK 4121 sp|P51532-2|SMCA4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 2-UNIMOD:4 ms_run[1]:scan=1.1.6978.11 78.5666 2 1177.5634 1177.5649 R I 1204 1214 PSM DLPVSEQQER 4122 sp|Q9UNM6-2|PSD13_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7251.11 85.91048 2 1199.5778 1199.5782 K A 189 199 PSM HQGVMVGMGQK 4123 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 5-UNIMOD:35,8-UNIMOD:35 ms_run[1]:scan=1.1.6944.8 77.64156 3 1202.5534 1202.5536 R D 40 51 PSM ASREEILAQAK 4124 sp|P35579|MYH9_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7186.11 84.14328 2 1214.6626 1214.6618 R E 1659 1670 PSM ASRDEIFAQSK 4125 sp|P35580-3|MYH10_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7307.5 87.43785 3 1250.6230 1250.6255 R E 1687 1698 PSM NTLANSCGTGIR 4126 sp|Q96RE7|NACC1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 7-UNIMOD:4 ms_run[1]:scan=1.1.7056.9 80.66025 2 1262.6022 1262.6037 R S 410 422 PSM NAPNDASYDAVR 4127 sp|Q92616|GCN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7227.11 85.25463 2 1291.5718 1291.5793 K Q 1305 1317 PSM VQIAANEETQER 4128 sp|P49321|NASP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6963.11 78.15736 2 1386.6844 1386.6739 K E 456 468 PSM YHPGYFGK 4129 sp|P46776|RL27A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7673.2 97.24575 3 967.4545 967.4552 K V 48 56 PSM FNEADSEVAQAGK 4130 sp|Q9UPN9-2|TRI33_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7543.10 93.72192 2 1364.6162 1364.6208 R A 1038 1051 PSM FRPSLEER 4131 sp|P35221|CTNA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1000663, ProteinPilot, ] 18 ms_run[1]:scan=1.1.7639.3 96.3176 3 1032.53257064349 1032.5352430500798 R L 301 309 PSM VGLIAAR 4132 sp|P62917|RL8_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7607.3 95.45012 2 698.4410 698.4439 K R 235 242 PSM RLEVLDSTK 4133 sp|P0C7P4|UCRIL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7701.2 98.0077 3 1059.5902 1059.5924 R S 102 111 PSM AEISFEDRK 4134 sp|P21333-2|FLNA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7582.3 94.77843 3 1093.5385 1093.5404 K D 2273 2282 PSM NGVMPSHFSR 4135 sp|P39019|RS19_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7670.3 97.16463 3 1130.5273 1130.5291 R G 85 95 PSM VVIIGAGK 4136 sp|Q14697|GANAB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7638.2 96.2886 2 755.4896 755.4905 R P 892 900 PSM KWPQQVVQK 4137 sp|P52926|HMGA2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7641.2 96.37057 3 1139.6497 1139.6451 R K 82 91 PSM VLAAVYK 4138 sp|P04075-2|ALDOA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7568.2 94.39307 2 762.4624 762.4640 K A 263 270 PSM YIDQEELNK 4139 sp|P07900-2|HS90A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7671.2 97.19062 3 1150.5490 1150.5506 K T 406 415 PSM VLIAAHGNSLR 4140 sp|P18669|PGAM1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7607.5 95.45345 3 1149.6589 1149.6618 R G 181 192 PSM IKEENFVSPK 4141 sp|O00425|IF2B3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7589.6 94.97442 3 1189.6321 1189.6343 K E 474 484 PSM VAAGLQIK 4142 sp|Q14974|IMB1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7679.2 97.41015 2 798.4940 798.4963 R N 55 63 PSM TNEAQAIETAR 4143 sp|Q5JXB2|UE2NL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7463.6 91.53688 3 1202.5891 1202.5891 K A 132 143 PSM LRDTEEMLSK 4144 sp|Q9H444|CHM4B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7536.5 93.52267 3 1220.6062 1220.6071 R K 29 39 PSM LRDTEEMLSK 4145 sp|Q9H444|CHM4B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7534.5 93.4682 3 1220.6062 1220.6071 R K 29 39 PSM SNVSDAVAQSTR 4146 sp|P60174|TPIS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7342.6 88.38603 3 1233.5929 1233.5949 K I 232 244 PSM IDVSVAAGHTDR 4147 sp|Q4V328-4|GRAP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7606.3 95.42355 3 1239.6172 1239.6208 R S 728 740 PSM TNQELQEINR 4148 sp|P07355-2|ANXA2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7691.4 97.73955 3 1243.6159 1243.6156 R V 154 164 PSM VVDVIGTK 4149 sp|P31323|KAP3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7581.4 94.7527 2 829.4884 829.4909 K V 288 296 PSM KEEELQGALAR 4150 sp|P35580-3|MYH10_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7672.5 97.22311 3 1242.6559 1242.6568 K G 1109 1120 PSM FGALTAEK 4151 sp|O95372|LYPA2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7640.2 96.34313 2 835.4422 835.4440 R L 183 191 PSM HLQLAVR 4152 sp|Q8IUE6|H2A2B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.7372.3 89.1784 2 835.502047 835.502821 R N 83 90 PSM YYPTEDVPRK 4153 sp|Q02878|RL6_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7567.5 94.37072 3 1266.6202 1266.6244 R L 115 125 PSM ASMGVLSGK 4154 sp|Q12888-2|TP53B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7650.5 96.62067 2 848.4322 848.4426 R R 1664 1673 PSM HLILPEK 4155 sp|O75643|U520_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7568.4 94.3964 2 848.5070 848.5120 R Y 1288 1295 PSM ASTTLDIK 4156 sp|P46821|MAP1B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7362.4 88.91323 2 847.4642 847.4651 K D 1233 1241 PSM LYHNEVEIEK 4157 sp|Q14683|SMC1A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7688.4 97.65816 3 1272.6334 1272.6350 K L 228 238 PSM QEPERNECFLQHK 4158 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 8-UNIMOD:4 ms_run[1]:scan=1.1.7358.6 88.81049 4 1713.7897 1713.7893 K D 118 131 PSM ELNITAAK 4159 sp|P62081|RS7_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7597.4 95.18655 2 858.4804 858.4810 R E 42 50 PSM NCNDFQYESK 4160 sp|Q04917|1433F_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 2-UNIMOD:4 ms_run[1]:scan=1.1.7508.5 92.76102 3 1303.5118 1303.5139 K V 111 121 PSM SPAPKPSDLRPGDVSSK 4161 sp|Q05682|CALD1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7552.5 93.9594 4 1736.9001 1736.9057 K R 759 776 PSM EVVAEVVK 4162 sp|O60832|DKC1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7461.5 91.48109 2 871.4998 871.5015 K A 426 434 PSM AVVIVDDR 4163 sp|P23246|SFPQ_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7637.5 96.26622 2 885.4900 885.4920 R G 400 408 PSM ASLENSLR 4164 sp|P05783|K1C18_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7688.5 97.65984 2 888.4652 888.4665 K E 318 326 PSM MPSGEFAR 4165 sp|P12004|PCNA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7595.8 95.13987 2 893.4052 893.4065 K I 139 147 PSM TQLVSNLK 4166 sp|P00505|AATM_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7655.6 96.75875 2 901.5220 901.5233 R K 356 364 PSM EATNPPVIQEEK 4167 sp|P30101|PDIA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7459.4 91.42555 3 1353.6736 1353.6776 R P 483 495 PSM DCLINAAK 4168 sp|P17987|TCPA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 2-UNIMOD:4 ms_run[1]:scan=1.1.7616.6 95.69489 2 903.4460 903.4484 R T 146 154 PSM DCLINAAK 4169 sp|P17987|TCPA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 2-UNIMOD:4 ms_run[1]:scan=1.1.7627.6 95.99403 2 903.4460 903.4484 R T 146 154 PSM IRVDVADQAQDK 4170 sp|P23588|IF4B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7563.6 94.2626 3 1356.6970 1356.6997 R D 166 178 PSM EDMAALEK 4171 sp|P68366-2|TBA4A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7515.4 92.94998 2 905.4144 905.4164 R D 408 416 PSM ASGNYATVISHNPETKK 4172 sp|P62917|RL8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7699.6 97.96007 4 1815.9077 1815.9115 R T 129 146 PSM TGFQAVTGK 4173 sp|P20042|IF2B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7379.7 89.3671 2 907.4754 907.4763 K R 316 325 PSM SYAEELAK 4174 sp|Q53GQ0|DHB12_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7667.6 97.08725 2 909.4426 909.4443 K H 65 73 PSM SYAEELAK 4175 sp|Q53GQ0|DHB12_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7648.7 96.56948 2 909.4426 909.4443 K H 65 73 PSM EEAGGEAAAAAAAER 4176 sp|O14497|ARI1A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7658.6 96.84071 3 1372.6219 1372.6218 R G 33 48 PSM ALQEEIDRESGK 4177 sp|Q1ED39|KNOP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7683.6 97.52585 3 1373.6797 1373.6786 K T 334 346 PSM VQVVGTYR 4178 sp|P25205-2|MCM3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7469.6 91.69962 2 920.5078 920.5080 R C 280 288 PSM FSELTAEK 4179 sp|P48643|TCPE_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7509.8 92.79321 2 923.4582 923.4600 R L 345 353 PSM FSELTAEK 4180 sp|P48643|TCPE_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7490.7 92.27457 2 923.4582 923.4600 R L 345 353 PSM VVEIVDEK 4181 sp|Q6PKG0|LARP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7627.8 95.99737 2 929.5050 929.5070 K V 466 474 PSM DAFPVAGQK 4182 sp|P54727|RD23B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7713.5 98.3401 2 931.4742 931.4763 R L 37 46 PSM INEEISVK 4183 sp|Q9BUJ2-2|HNRL1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7608.10 95.48827 2 930.4996 930.5022 K H 263 271 PSM VLEPYPSK 4184 sp|Q9P2J5-2|SYLC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7555.6 94.04325 2 931.4992 931.5015 K L 217 225 PSM VVDSLYNK 4185 sp|O00231-2|PSD11_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7346.8 88.49532 2 936.4922 936.4916 K A 411 419 PSM LYEQLSGK 4186 sp|P30086|PEBP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7593.6 95.08268 2 936.4892 936.4916 K - 180 188 PSM TETVTSFR 4187 sp|P78527|PRKDC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7694.5 97.8228 2 939.4642 939.4662 R K 3865 3873 PSM TETVTSFR 4188 sp|P78527|PRKDC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7675.3 97.30228 2 939.4642 939.4662 R K 3865 3873 PSM ENQVLSVR 4189 sp|Q10589-2|BST2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7522.5 93.14191 2 943.5066 943.5087 R I 128 136 PSM GGYTSGTFR 4190 sp|P25205-2|MCM3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7386.5 89.54265 2 944.4340 944.4352 K T 294 303 PSM SIDDLEEK 4191 sp|P09493-3|TPM1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7622.6 95.8575 2 947.4440 947.4447 K V 252 260 PSM CIIVEEGK 4192 sp|P60981-2|DEST_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 1-UNIMOD:4 ms_run[1]:scan=1.1.7489.7 92.24709 2 946.4784 946.4794 K E 29 37 PSM DQNVFDSK 4193 sp|O76094|SRP72_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7455.8 91.32629 2 951.4286 951.4298 K K 276 284 PSM GEDEEENNLEVR 4194 sp|P04843|RPN1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7689.7 97.69037 3 1431.6100 1431.6113 K E 90 102 PSM YLSNAYAR 4195 sp|O00299|CLIC1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7326.6 87.95847 2 956.4720 956.4715 R E 209 217 PSM IASNVLNTK 4196 sp|Q12789-3|TF3C1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7365.7 88.99805 2 958.5388 958.5447 R V 1278 1287 PSM TIDDLEEK 4197 sp|P67936|TPM4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7362.11 88.9249 2 961.4600 961.4604 K L 216 224 PSM AQYDELAR 4198 sp|P05783|K1C18_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7694.6 97.82446 2 964.4600 964.4614 R K 254 262 PSM EANEILQR 4199 sp|P12268|IMDH2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7337.6 88.2537 2 971.5016 971.5036 K S 196 204 PSM STFSTNYR 4200 sp|P05783|K1C18_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7559.8 94.1563 2 974.4436 974.4458 R S 7 15 PSM FSATEVTNK 4201 sp|Q8N163|CCAR2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7337.8 88.25703 2 995.4924 995.4924 R T 847 856 PSM DYDDMSPR 4202 sp|P61978|HNRPK_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7402.10 89.95866 2 997.3810 997.3811 R R 279 287 PSM VLNTNIDGR 4203 sp|P62269|RS18_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7527.2 93.27298 3 1000.5301 1000.5302 R R 15 24 PSM SETDTSLIR 4204 sp|P40227-2|TCPZ_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7702.6 98.04153 2 1020.5130 1020.5087 K G 155 164 PSM YRPGTVALR 4205 sp|Q71DI3|H32_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7380.9 89.39616 2 1031.5854 1031.5876 R E 42 51 PSM ESKEETPGTEWEK 4206 sp|P09497-2|CLCB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7561.8 94.21107 3 1548.6862 1548.6944 K V 164 177 PSM YRPGTVALR 4207 sp|Q71DI3|H32_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7353.8 88.68092 2 1031.5852 1031.5876 R E 42 51 PSM LFDDDETGK 4208 sp|Q12798|CETN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7682.7 97.50027 2 1038.4510 1038.4506 R I 112 121 PSM QQLLEEER 4209 sp|Q9NSI2-2|F207A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7580.8 94.73212 2 1043.5222 1043.5247 R T 172 180 PSM YSTSAPAISR 4210 sp|P56747|CLD6_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7415.10 90.29752 2 1051.5276 1051.5298 R G 200 210 PSM NDNDTFTVK 4211 sp|P21333-2|FLNA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7468.6 91.67255 2 1052.4736 1052.4775 R Y 829 838 PSM IAELCDDPK 4212 sp|P18206|VINC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 5-UNIMOD:4 ms_run[1]:scan=1.1.7365.9 89.00138 2 1059.4924 1059.4906 K E 418 427 PSM ESAATDVLQK 4213 sp|Q9NVH1-2|DJC11_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7472.7 91.78271 2 1060.5396 1060.5400 R K 425 435 PSM ISSELEMLR 4214 sp|Q86V48-2|LUZP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7350.9 88.603 2 1076.5442 1076.5536 K V 151 160 PSM AQYEDIANR 4215 sp|P05787-2|K2C8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7467.3 91.64024 3 1078.5019 1078.5043 K S 293 302 PSM VEQLGAEGNVEESQK 4216 sp|Q9Y383-3|LC7L2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7564.8 94.29343 3 1615.7662 1615.7689 K V 137 152 PSM VTMQNLNDR 4217 sp|P13645|K1C10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7563.11 94.27094 2 1089.5212 1089.5237 K L 148 157 PSM GTVEPQLEAR 4218 sp|P21333-2|FLNA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7635.10 96.21982 2 1098.5658 1098.5669 K G 428 438 PSM VNEVGVDVNR 4219 sp|Q7KZ85|SPT6H_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7483.10 92.08783 2 1099.5608 1099.5622 R A 966 976 PSM EAALEPSMEK 4220 sp|Q9H3K2|GHITM_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7632.9 96.13625 2 1103.5168 1103.5168 K I 64 74 PSM FGTDLNQGEK 4221 sp|Q9NRL3-3|STRN4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7480.10 92.00573 2 1107.5194 1107.5197 K K 137 147 PSM VANLCGINQK 4222 sp|Q05655-2|KPCD_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 5-UNIMOD:4 ms_run[1]:scan=1.1.7634.8 96.18916 2 1115.5592 1115.5757 K L 276 286 PSM EKPTTALLDK 4223 sp|Q12906-7|ILF3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7390.8 89.65115 2 1114.6220 1114.6234 K V 118 128 PSM YVGESEANIR 4224 sp|P46459|NSF_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7673.11 97.26075 2 1136.5406 1136.5462 K K 294 304 PSM QEPERNECFLQHK 4225 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 8-UNIMOD:4 ms_run[1]:scan=1.1.7356.11 88.76562 3 1713.7870 1713.7893 K D 118 131 PSM LQESVMEASR 4226 sp|O60216|RAD21_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7647.10 96.54735 2 1148.5492 1148.5495 R T 451 461 PSM GESPVDYDGGR 4227 sp|Q15084-2|PDIA6_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7385.10 89.52717 2 1150.4892 1150.4891 K T 298 309 PSM NDQCYDDIR 4228 sp|Q9ULV4-2|COR1C_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 4-UNIMOD:4 ms_run[1]:scan=1.1.7521.9 93.12137 2 1197.4686 1197.4720 K V 26 35 PSM NDQCYDDIR 4229 sp|Q9ULV4-2|COR1C_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 4-UNIMOD:4 ms_run[1]:scan=1.1.7540.9 93.63838 2 1197.4686 1197.4720 K V 26 35 PSM LTDQVMQNPR 4230 sp|Q99733-2|NP1L4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7576.9 94.62438 2 1200.5896 1200.5921 K V 27 37 PSM TNEAQAIETAR 4231 sp|Q5JXB2|UE2NL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7459.9 91.43388 2 1202.5852 1202.5891 K A 132 143 PSM PSDAASEAARPATSTLNR 4232 sp|Q04637-9|IF4G1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7528.11 93.31519 3 1813.8883 1813.8918 K F 1112 1130 PSM GIPHLVTHDAR 4233 sp|P62701|RS4X_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7453.9 91.2755 2 1214.6508 1214.6520 K T 135 146 PSM QAASSLQQASLK 4234 sp|P38646|GRP75_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7395.9 89.77832 2 1230.6562 1230.6568 R L 635 647 PSM AGSVATCQAVMR 4235 sp|O94906|PRP6_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 7-UNIMOD:4 ms_run[1]:scan=1.1.7336.10 88.23385 2 1249.5880 1249.5907 R A 516 528 PSM GFSSGSAVVSGGSR 4236 sp|P35908|K22E_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7546.11 93.8055 2 1253.5980 1253.6001 R R 21 35 PSM ISSDLDGHPVPK 4237 sp|P29401-2|TKT_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7594.9 95.11463 2 1263.6430 1263.6459 K Q 103 115 PSM FQASQGENLEGK 4238 sp|Q7Z3K3-2|POGZ_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7413.10 90.24523 2 1306.6122 1306.6153 R Y 957 969 PSM DTEMLATGAQDGK 4239 sp|Q2TAY7|SMU1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7665.11 97.0407 2 1335.5974 1335.5976 R I 275 288 PSM SLEEQDQETLR 4240 sp|P48681|NEST_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7659.11 96.87638 2 1346.6296 1346.6314 R T 746 757 PSM EQESCNMANIR 4241 sp|Q9NYH9|UTP6_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 5-UNIMOD:4 ms_run[1]:scan=1.1.7524.11 93.2064 2 1350.5686 1350.5656 K E 520 531 PSM YLAEVACGDDRK 4242 sp|P27348|1433T_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 7-UNIMOD:4 ms_run[1]:scan=1.1.7383.5 89.4662 3 1395.6463 1395.6452 R Q 128 140 PSM VPPPPPIAR 4243 sp|P07910-2|HNRPC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7737.3 98.99288 3 942.5623 942.5651 R A 130 139 PSM LQAEAFQAR 4244 sp|P02649|APOE_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8037.2 107.1524 3 1032.5281 1032.5352 R L 270 279 PSM QELELSVKK 4245 sp|Q16851|UGPA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7821.2 101.2442 3 1072.6111 1072.6128 R E 26 35 PSM VNEVNQFAAK 4246 sp|Q13813|SPTN1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7734.3 98.91077 3 1118.5711 1118.5720 R L 205 215 PSM RQAVDVSPLR 4247 sp|P46782|RS5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7767.3 99.79888 3 1139.6374 1139.6411 R R 136 146 PSM TSYEEFTHK 4248 sp|Q6P2Q9|PRP8_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7745.4 99.21347 3 1140.5053 1140.5087 R D 1202 1211 PSM PVLGKDEDFK 4249 sp|P07814|SYEP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7915.5 103.8238 3 1146.5863 1146.5921 K Q 633 643 PSM DPELGLK 4250 sp|P49411|EFTU_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8115.3 109.2029 2 770.4156 770.4174 R S 228 235 PSM AACLLPK 4251 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 3-UNIMOD:4 ms_run[1]:scan=1.1.7858.4 102.2569 2 771.4306 771.4313 K L 199 206 PSM AACLLPK 4252 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 3-UNIMOD:4 ms_run[1]:scan=1.1.7839.3 101.7355 2 771.4306 771.4313 K L 199 206 PSM AACLLPK 4253 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 3-UNIMOD:4 ms_run[1]:scan=1.1.7801.3 100.7015 2 771.4306 771.4313 K L 199 206 PSM AACLLPK 4254 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 3-UNIMOD:4 ms_run[1]:scan=1.1.7820.3 101.2187 2 771.4306 771.4313 K L 199 206 PSM PFAIAKE 4255 sp|P23284|PPIB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8057.3 107.6898 2 774.4248 774.4276 K - 210 217 PSM RVDALNDEIR 4256 sp|Q9UQE7|SMC3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8040.4 107.2373 3 1199.6239 1199.6258 K Q 796 806 PSM VGVNGFGR 4257 sp|P04406|G3P_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7925.3 104.0948 2 804.4228 804.4243 K I 6 14 PSM VGVNGFGR 4258 sp|P04406|G3P_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7906.3 103.574 2 804.4228 804.4243 K I 6 14 PSM ILGPGLNK 4259 sp|P62906|RL10A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7834.3 101.599 2 810.4942 810.4963 R A 123 131 PSM ILGPGLNK 4260 sp|P62906|RL10A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7815.4 101.0846 2 810.4942 810.4963 R A 123 131 PSM GKLDGNQDLIR 4261 sp|P48735|IDHP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7949.3 104.7515 3 1227.6547 1227.6571 R F 383 394 PSM QVSSHIQVLAR 4262 sp|P28347-2|TEAD1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8046.4 107.4005 3 1236.6892 1236.6939 K R 74 85 PSM HCNMVLENVK 4263 sp|P62316|SMD2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 2-UNIMOD:4 ms_run[1]:scan=1.1.8000.4 106.1457 3 1242.5836 1242.5849 R E 62 72 PSM IGVLDEGK 4264 sp|P46781|RS9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7925.4 104.0965 2 829.4530 829.4545 R M 84 92 PSM RVGTASVLQPVK 4265 sp|Q2TAL8|QRIC1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7774.5 99.98515 3 1253.7412 1253.7456 R K 235 247 PSM HILANFK 4266 sp|P13693-2|TCTP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7878.4 102.8072 2 841.4780 841.4810 K N 90 97 PSM STVAQLVK 4267 sp|P25705-3|ATPA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7868.7 102.5366 2 844.4988 844.5018 R R 232 240 PSM AFLDNGPK 4268 sp|P78344|IF4G2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7949.4 104.7532 2 860.4394 860.4392 K T 314 322 PSM GSSASLVLK 4269 sp|Q00325-2|MPCP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7773.4 99.95725 2 860.4938 860.4967 K R 295 304 PSM HRPELIEYDK 4270 sp|O43707|ACTN4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7817.6 101.1422 3 1298.6578 1298.6619 R L 205 215 PSM FVIATSTK 4271 sp|Q02878|RL6_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8103.4 108.8801 2 865.4882 865.4909 K I 193 201 PSM QDLSAIAR 4272 sp|Q9UBW8|CSN7A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 18 ms_run[1]:scan=1.1.7908.5 103.6322 2 872.4672 872.4711 R T 165 173 PSM TETLALTK 4273 sp|Q5UIP0|RIF1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7752.5 99.40726 2 875.4930 875.4964 R L 331 339 PSM ACLYAGVK 4274 sp|P15104|GLNA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 2-UNIMOD:4 ms_run[1]:scan=1.1.7876.5 102.7539 2 880.4464 880.4477 R I 182 190 PSM ILVPEGTR 4275 sp|P10515|ODP2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7862.4 102.3665 2 883.5096 883.5127 K D 275 283 PSM VINSVDIK 4276 sp|O75083|WDR1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7734.8 98.9191 2 886.5112 886.5124 K Q 148 156 PSM SVCLIGDK 4277 sp|O60264|SMCA5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 3-UNIMOD:4 ms_run[1]:scan=1.1.8073.3 108.1016 2 890.4516 890.4532 R E 257 265 PSM EAILAIHK 4278 sp|O43707|ACTN4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7976.6 105.4962 2 893.5310 893.5334 R E 585 593 PSM TTIFTDAK 4279 sp|Q15370-2|ELOB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8033.6 107.0515 2 895.4620 895.4651 K E 12 20 PSM ELGLNPEK 4280 sp|Q9BWD1-2|THIC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7883.4 102.9444 2 898.4724 898.4760 K V 363 371 PSM QELSHALYQHDAACR 4281 sp|Q9UMS4|PRP19_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 14-UNIMOD:4 ms_run[1]:scan=1.1.7924.4 104.0691 4 1797.8193 1797.8216 R V 101 116 PSM TTAQVLIR 4282 sp|P15121|ALDR_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7915.7 103.8272 2 900.5370 900.5393 K F 244 252 PSM AAVAWEAGK 4283 sp|P11766|ADHX_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7877.5 102.7813 2 901.4634 901.4657 K P 10 19 PSM LEVLDSTK 4284 sp|P0C7P4|UCRIL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8028.6 106.9162 2 903.4850 903.4913 R S 103 111 PSM LNWTGTSK 4285 sp|O95433|AHSA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8052.6 107.5646 2 905.4594 905.4607 K S 87 95 PSM AFTELQAK 4286 sp|O60925|PFD1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7989.3 105.845 2 906.4794 906.4811 K V 12 20 PSM EVEEEPGIHSLK 4287 sp|Q9Y4L1|HYOU1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8051.4 107.5343 3 1365.6754 1365.6776 R H 452 464 PSM VIVLSSSHSYQR 4288 sp|Q969U7-2|PSMG2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8084.4 108.3854 3 1374.7246 1374.7256 R N 87 99 PSM QHYIDLK 4289 sp|P22392-2|NDKB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7748.3 99.29393 3 915.4813 915.4814 K D 165 172 PSM IFEPPPPK 4290 sp|O43143|DHX15_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7938.6 104.4557 2 923.5106 923.5116 R K 400 408 PSM DDGGFEYK 4291 sp|Q9UBF2-2|COPG2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7881.6 102.8928 2 929.3772 929.3767 R R 407 415 PSM VNGGLNLSR 4292 sp|O15355|PPM1G_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7720.8 98.53643 2 928.5060 928.5090 R A 390 399 PSM VELSPMQK 4293 sp|Q14839-2|CHD4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7842.6 101.8225 2 930.4764 930.4844 R K 976 984 PSM CLSVMEAK 4294 sp|P49588|SYAC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 1-UNIMOD:4 ms_run[1]:scan=1.1.7985.8 105.7443 2 936.4382 936.4409 K V 773 781 PSM TNFIEADK 4295 sp|Q9Y6D6|BIG1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7757.5 99.54242 2 936.4526 936.4552 K Y 72 80 PSM LYSESLAR 4296 sp|P50395|GDIB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7791.6 100.4352 2 937.4844 937.4869 K Y 211 219 PSM LVVVGGGGVGK 4297 sp|P62070-4|RRAS2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8013.2 106.4974 2 940.5674 940.5706 R S 17 28 PSM GAVVEVIQK 4298 sp|A1X283|SPD2B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7901.9 103.4469 2 941.5530 941.5546 R N 245 254 PSM VIQEIVDK 4299 sp|P51114|FXR1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7831.7 101.5239 2 942.5482 942.5386 K S 303 311 PSM ELVLDNSR 4300 sp|P39687|AN32A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7790.6 100.4082 2 944.4892 944.4927 K S 21 29 PSM ISQLEMAR 4301 sp|P26038|MOES_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8049.7 107.4858 2 946.4860 946.4906 R Q 428 436 PSM MINTDLSR 4302 sp|P36578|RL4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7918.4 103.9044 2 948.4662 948.4698 K I 284 292 PSM ISDDLMQK 4303 sp|O43242|PSMD3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8018.8 106.6444 2 948.4594 948.4586 K I 187 195 PSM MINTDLSR 4304 sp|P36578|RL4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7899.6 103.3868 2 948.4662 948.4698 K I 284 292 PSM AEFTVETR 4305 sp|P21333-2|FLNA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8040.8 107.244 2 951.4650 951.4662 R S 302 310 PSM ETYGEMADCCAK 4306 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 9-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.8000.7 106.1507 3 1433.5225 1433.5261 R Q 106 118 PSM QVDAESWK 4307 sp|P26639-2|SYTC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7814.6 101.0607 2 961.4512 961.4505 K T 92 100 PSM MINTDLSR 4308 sp|P36578|RL4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 1-UNIMOD:35 ms_run[1]:scan=1.1.7901.11 103.4502 2 964.4660 964.4648 K I 284 292 PSM QPTIFQNK 4309 sp|P62280|RS11_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8064.7 107.8772 2 974.5176 974.5185 K K 13 21 PSM IGSVAPDTINNHVK 4310 sp|Q9UHY1|NRBP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7954.8 104.8971 3 1463.7718 1463.7732 K T 218 232 PSM ETAEAYLGK 4311 sp|P11021|BIP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8055.6 107.643 2 980.4794 980.4814 K K 155 164 PSM ETAEAYLGK 4312 sp|P11021|BIP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8036.7 107.1337 2 980.4794 980.4814 K K 155 164 PSM LTPEEIER 4313 sp|P11021|BIP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8083.8 108.3661 2 985.5050 985.5080 R M 533 541 PSM ALQLEEER 4314 sp|P15311|EZRI_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7949.9 104.7615 2 986.5020 986.5032 R K 372 380 PSM NVVAECLGK 4315 sp|Q86VP6|CAND1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 6-UNIMOD:4 ms_run[1]:scan=1.1.7936.7 104.4025 2 988.4994 988.5012 R L 949 958 PSM SLPCDICK 4316 sp|P07602-2|SAP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 4-UNIMOD:4,7-UNIMOD:4 ms_run[1]:scan=1.1.7922.7 104.0193 2 991.4456 991.4467 K D 60 68 PSM VLPTYDASK 4317 sp|O75369-2|FLNB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7731.7 98.83548 2 992.5124 992.5179 K V 1511 1520 PSM LTEIYSDR 4318 sp|Q9UPN9-2|TRI33_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7899.7 103.3885 2 995.4894 995.4924 K T 1060 1068 PSM ASSELFSQK 4319 sp|Q01581|HMCS1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7835.6 101.6313 2 995.4914 995.4924 K T 322 331 PSM ASSELFSQK 4320 sp|Q01581|HMCS1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7854.8 102.154 2 995.4914 995.4924 K T 322 331 PSM QQAADLISR 4321 sp|O75533|SF3B1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7724.10 98.64902 2 1000.5302 1000.5301 R T 949 958 PSM NQEFLQAR 4322 sp|P48681|NEST_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8049.8 107.4874 2 1004.4998 1004.5039 K T 374 382 PSM LQQLQMEK 4323 sp|P46937-2|YAP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7885.9 103.0077 2 1016.5214 1016.5324 R E 308 316 PSM DDQLLDDGK 4324 sp|Q15370-2|ELOB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7723.8 98.61822 2 1017.4608 1017.4615 K T 47 56 PSM NCLALADDK 4325 sp|O75367-3|H2AY_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 2-UNIMOD:4 ms_run[1]:scan=1.1.7771.10 99.91497 2 1018.4740 1018.4753 K K 295 304 PSM AEELLAEEK 4326 sp|O00429-2|DNM1L_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7947.8 104.7049 2 1030.5180 1030.5182 K S 587 596 PSM GTVVTGTLER 4327 sp|P49411|EFTU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7730.8 98.80985 2 1031.5588 1031.5611 R G 272 282 PSM LEVEYEQK 4328 sp|Q9Y2W2|WBP11_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7793.8 100.4927 2 1036.4980 1036.5077 K R 110 118 PSM SNTPILVDGK 4329 sp|P06744-2|G6PI_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8013.4 106.5007 2 1042.5636 1042.5659 R D 146 156 PSM LYPTSCHTACTLR 4330 sp|Q08431-2|MFGM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 6-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.7854.10 102.1573 3 1578.7276 1578.7283 R F 95 108 PSM EPAAPVSIQR 4331 sp|Q14847-2|LASP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7890.8 103.1431 2 1066.5746 1066.5771 K S 188 198 PSM ATLDEYTTR 4332 sp|Q16656-4|NRF1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8074.4 108.1287 2 1068.5056 1068.5087 R V 117 126 PSM MLQHIDYR 4333 sp|P14678-3|RSMB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7980.3 105.6 3 1074.5266 1074.5280 K M 9 17 PSM SLGPSLATDKS 4334 sp|Q9H3N1|TMX1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8055.8 107.6464 2 1074.5572 1074.5557 R - 270 281 PSM YLAEVATGEK 4335 sp|P61981|1433G_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7899.10 103.3935 2 1079.5482 1079.5499 R R 133 143 PSM EAVAMESYAK 4336 sp|P78371-2|TCPB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8041.10 107.2745 2 1097.5050 1097.5063 K A 385 395 PSM LQQENSILR 4337 sp|Q9P2E9|RRBP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8023.10 106.7854 2 1099.5948 1099.5985 K N 798 807 PSM IVTVVPQDTK 4338 sp|O95163|ELP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7987.7 105.7973 2 1098.6268 1098.6285 R L 697 707 PSM DGTISEDTIR 4339 sp|Q99816-2|TS101_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7911.9 103.7209 2 1105.5254 1105.5251 R A 113 123 PSM SLESTTLTEK 4340 sp|Q16527|CSRP2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7867.7 102.509 2 1107.5618 1107.5659 K E 152 162 PSM VEYSEEELK 4341 sp|P12956-2|XRCC6_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8084.8 108.3921 2 1124.5228 1124.5237 K T 516 525 PSM IPGSPPESMGR 4342 sp|P50395|GDIB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7722.9 98.5926 2 1126.5450 1126.5441 K G 58 69 PSM VNVPGSQAQLK 4343 sp|Q02818|NUCB1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7902.8 103.4726 2 1139.6278 1139.6299 K E 219 230 PSM ELALQQEEGK 4344 sp|Q9Y276|BCS1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7749.11 99.33475 2 1143.5746 1143.5771 R T 156 166 PSM ALLANQDSGEVQQDPK 4345 sp|Q9NP81|SYSM_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8008.11 106.3755 3 1711.8352 1711.8377 R Y 119 135 PSM FTEYETQVK 4346 sp|Q13148|TADBP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7962.8 105.1169 2 1143.5458 1143.5448 R V 152 161 PSM GTDLTDEQIR 4347 sp|Q8IXT5|RB12B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8044.10 107.3562 2 1146.5400 1146.5517 R F 306 316 PSM EQVYDAMGEK 4348 sp|P49321|NASP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8020.6 106.6961 2 1168.5072 1168.5070 R E 145 155 PSM TIQGDEEDLR 4349 sp|P54920|SNAA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7762.8 99.67702 2 1174.5450 1174.5466 K - 286 296 PSM ELEIGQAGSQR 4350 sp|Q15021|CND1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7838.8 101.7167 2 1186.5920 1186.5942 K A 1302 1313 PSM ELGVSTNANYK 4351 sp|Q8WVY7|UBCP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7853.10 102.13 2 1194.5854 1194.5880 K I 196 207 PSM EISPGSGPGEIR 4352 sp|O43491-4|E41L2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7884.10 102.982 2 1197.5938 1197.5990 K K 643 655 PSM VIDQQNGLYR 4353 sp|P27694|RFA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7926.10 104.1339 2 1204.6164 1204.6200 K C 490 500 PSM VVAEVYDQER 4354 sp|Q9UHX1-2|PUF60_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7796.11 100.5791 2 1206.5854 1206.5881 K F 525 535 PSM DFEEYPEHR 4355 sp|O14980|XPO1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7919.11 103.9435 2 1220.5116 1220.5098 K T 837 846 PSM LIEDNEYTAR 4356 sp|P12931-2|SRC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8018.11 106.6495 2 1222.5830 1222.5829 R Q 419 429 PSM VGLNAQAACAPR 4357 sp|P48681|NEST_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 9-UNIMOD:4 ms_run[1]:scan=1.1.7717.9 98.45615 2 1226.6162 1226.6190 R C 149 161 PSM NNTQVLINCR 4358 sp|P62316|SMD2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 9-UNIMOD:4 ms_run[1]:scan=1.1.7979.8 105.581 2 1230.6132 1230.6139 K N 38 48 PSM RCQLPDGSFR 4359 sp|O75643|U520_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 2-UNIMOD:4 ms_run[1]:scan=1.1.8038.10 107.1929 2 1234.5824 1234.5877 K R 427 437 PSM SLDGAAAVDSADR 4360 sp|P11171-2|41_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7774.11 99.99515 2 1246.5774 1246.5789 R S 542 555 PSM GTVEGFEPADNK 4361 sp|P37108|SRP14_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8098.10 108.7585 2 1262.5770 1262.5779 K C 44 56 PSM NLQEIQQAGER 4362 sp|Q8N1F7|NUP93_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8040.11 107.249 2 1284.6422 1284.6422 R L 32 43 PSM LREYEAALNSK 4363 sp|P20700|LMNB1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7850.11 102.0495 2 1292.6686 1292.6724 K D 135 146 PSM GTNIQENEYVK 4364 sp|Q9BRX2|PELO_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7859.9 102.2926 2 1293.6190 1293.6201 K M 85 96 PSM NGTLSVSDTTVGSK 4365 sp|Q9BSC4-2|NOL10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8007.10 106.3464 2 1364.6764 1364.6784 K Q 578 592 PSM ISVYYNEASSHK 4366 sp|Q13509|TBB3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7955.11 104.9296 2 1396.6604 1396.6623 R Y 47 59 PSM EDLQLDKPASGVK 4367 sp|P78347-2|GTF2I_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8065.3 107.8963 3 1398.7333 1398.7354 R E 403 416 PSM ETVEEQVSTTER 4368 sp|Q13619-2|CUL4A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8001.10 106.1829 2 1406.6528 1406.6525 K V 576 588 PSM LHYCVSCAIHSK 4369 sp|Q5JNZ5|RS26L_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 4-UNIMOD:4,7-UNIMOD:4 ms_run[1]:scan=1.1.8049.10 107.4908 2 1473.6788 1473.6857 K V 71 83 PSM SGNYPSSLSNETDR 4370 sp|Q9NS86|LANC2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7997.11 106.0755 2 1525.6680 1525.6645 R L 303 317 PSM DTALTIAADK 4371 sp|O75179-7|ANR17_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8512.7 119.9965 2 1017.5344 1017.5342 R G 1208 1218 PSM CLSEQSVAISR 4372 sp|P41134-2|ID1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 1-UNIMOD:4 ms_run[1]:scan=1.1.8503.11 119.7568 2 1248.6146 1248.6132 R C 34 45 PSM SHGFAAEFK 4373 sp|P55265-4|DSRAD_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8168.2 110.6446 3 992.4676 992.4716 R L 780 789 PSM VHIDIGADGR 4374 sp|P31942-2|HNRH3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8227.2 112.2479 3 1051.5382 1051.5411 R A 208 218 PSM QGVLGIK 4375 sp|P23396-2|RS3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8206.3 111.6793 2 713.4418 713.4436 R V 195 202 PSM GVVVVIK 4376 sp|P46779|RL28_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8385.3 116.5427 2 712.4836 712.4847 K R 59 66 PSM KFYEQFSK 4377 sp|P07900-2|HS90A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8274.2 113.5324 3 1075.5316 1075.5338 K N 558 566 PSM TLGLYGK 4378 sp|P09211|GSTP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8420.2 117.4797 2 750.4264 750.4276 R D 76 83 PSM DPLNPIK 4379 sp|Q15181|IPYR_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8181.5 111.0044 2 795.4464 795.4490 K Q 64 71 PSM DLAALGDK 4380 sp|Q13813|SPTN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8159.4 110.4029 2 801.4214 801.4232 R V 1281 1289 PSM FAAATGATPIAGR 4381 sp|P08865|RSSA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8385.4 116.5444 3 1202.6401 1202.6408 K F 90 103 PSM ESVFTVEGGHR 4382 sp|Q99623|PHB2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8319.2 114.7436 3 1216.5814 1216.5837 R A 38 49 PSM HIYYITGETK 4383 sp|P07900-2|HS90A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8431.2 117.7765 3 1223.6176 1223.6186 K D 612 622 PSM TGIGVQLK 4384 sp|Q07954|LRP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8508.3 119.8802 2 814.4854 814.4913 R D 2136 2144 PSM GANQWIK 4385 sp|P08559-2|ODPA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8123.4 109.4223 2 815.4264 815.4290 R F 386 393 PSM GVVEVTHDLQK 4386 sp|P50454|SERPH_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8263.4 113.2372 3 1223.6488 1223.6510 K H 309 320 PSM HIYYITGETK 4387 sp|P07900-2|HS90A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8450.4 118.2974 3 1223.6176 1223.6186 K D 612 622 PSM VQEVLLK 4388 sp|Q9Y4L1|HYOU1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8134.5 109.7241 2 827.5090 827.5116 R A 392 399 PSM SVHFPGQAVGTR 4389 sp|Q06210|GFPT1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8415.3 117.3463 3 1254.6463 1254.6469 K R 191 203 PSM HLQLAIR 4390 sp|P16104|H2AX_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8281.5 113.7265 2 849.5174 849.5184 R N 83 90 PSM LTGVSISQVNHK 4391 sp|O75955|FLOT1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8118.5 109.2878 3 1281.7021 1281.7041 R P 411 423 PSM LNTLLQR 4392 sp|Q00839|HNRPU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8472.4 118.9004 2 856.5112 856.5130 K A 552 559 PSM LNTLLQR 4393 sp|Q00839|HNRPU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8491.4 119.418 2 856.5112 856.5130 K A 552 559 PSM SRYEQVDLVGK 4394 sp|Q9BQ39|DDX50_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8471.4 118.873 3 1292.6722 1292.6725 K M 343 354 PSM VVEDGILK 4395 sp|P35221-2|CTNA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8229.3 112.3041 2 871.5008 871.5015 K L 156 164 PSM KGSSLEIVSACR 4396 sp|Q5T7N2|LITD1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 11-UNIMOD:4 ms_run[1]:scan=1.1.8167.3 110.6189 3 1305.6688 1305.6711 K V 734 746 PSM GLDVEDVK 4397 sp|Q92841-1|DDX17_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8321.4 114.8009 2 873.4442 873.4444 R F 402 410 PSM GVQVETISPGDGR 4398 sp|P62942|FKB1A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8449.3 118.2684 3 1313.6554 1313.6576 M T 2 15 PSM DLYDAGVK 4399 sp|P07355-2|ANXA2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8259.3 113.1263 2 879.4324 879.4338 R R 215 223 PSM RGAEIIVCTPGR 4400 sp|Q7L014|DDX46_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 8-UNIMOD:4 ms_run[1]:scan=1.1.8334.6 115.1564 3 1327.7005 1327.7030 K M 494 506 PSM ACQIFVR 4401 sp|P52272|HNRPM_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 2-UNIMOD:4 ms_run[1]:scan=1.1.8446.6 118.1911 2 892.4558 892.4589 K N 652 659 PSM QSTWEKPDDLK 4402 sp|O75400-3|PR40A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8249.6 112.8573 3 1345.6447 1345.6514 K T 165 176 PSM TDAPLNIR 4403 sp|Q12931|TRAP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8316.5 114.6676 2 898.4896 898.4872 K S 333 341 PSM IGCIITAR 4404 sp|Q12904-2|AIMP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 3-UNIMOD:4 ms_run[1]:scan=1.1.8483.5 119.2022 2 902.4884 902.5008 R K 183 191 PSM FNTTSVIK 4405 sp|Q15029-2|U5S1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8420.6 117.4864 2 908.4936 908.4967 K I 547 555 PSM AVIDLNNR 4406 sp|P0DN76|U2AF5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8418.6 117.4323 2 913.4970 913.4981 K W 126 134 PSM VAVYVPGSK 4407 sp|Q9BY44-3|EIF2A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8394.4 116.7891 2 918.5138 918.5175 K G 159 168 PSM ELAVQIQK 4408 sp|P38919|IF4A3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8238.8 112.5584 2 927.5354 927.5389 R G 117 125 PSM EAVLNAYR 4409 sp|Q15021|CND1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8118.6 109.2895 2 934.4852 934.4872 R Q 691 699 PSM YLQEEVNINRK 4410 sp|Q9UHD8|SEPT9_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8380.7 116.4119 3 1404.7333 1404.7361 K K 390 401 PSM LSIVPVRR 4411 sp|P15880|RS2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8416.7 117.3799 2 938.6004 938.6025 K G 160 168 PSM ADNLIPGSR 4412 sp|Q9NPH2|INO1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8155.6 110.2972 2 941.4902 941.4930 R A 192 201 PSM TVSPALISR 4413 sp|Q86VP6|CAND1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8474.7 118.9601 2 942.5478 942.5498 K F 374 383 PSM ALGDYDYK 4414 sp|O75688-2|PPM1B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8392.4 116.7353 2 943.4284 943.4287 R C 201 209 PSM DLGEENFK 4415 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8411.6 117.2432 2 950.4336 950.4345 K A 37 45 PSM DLGEENFK 4416 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8392.5 116.737 2 950.4336 950.4345 K A 37 45 PSM YELISETGGSHDK 4417 sp|Q12906-7|ILF3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8168.7 110.6529 3 1434.6616 1434.6627 K R 545 558 PSM GLTDLSACK 4418 sp|O00567|NOP56_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 8-UNIMOD:4 ms_run[1]:scan=1.1.8354.7 115.7002 2 963.4690 963.4695 K A 135 144 PSM QILNDQLK 4419 sp|Q15811-8|ITSN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8380.8 116.4136 2 970.5426 970.5447 K Q 546 554 PSM ISSVSEVMK 4420 sp|Q16891-2|MIC60_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8338.6 115.2636 2 978.5028 978.5056 K E 111 120 PSM ETLFNDSR 4421 sp|Q4V328-4|GRAP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8380.9 116.4153 2 980.4680 980.4563 K N 250 258 PSM GELSGDFEK 4422 sp|P08133-2|ANXA6_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8121.6 109.3712 2 980.4424 980.4451 R L 200 209 PSM LLLDQEQK 4423 sp|O75937|DNJC8_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8141.6 109.9163 2 985.5422 985.5444 K K 109 117 PSM NECVVVIR 4424 sp|P05198|IF2A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 3-UNIMOD:4 ms_run[1]:scan=1.1.8508.7 119.8869 2 987.5200 987.5172 R V 68 76 PSM ETQIFVEK 4425 sp|Q5T8P6-2|RBM26_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8428.8 117.7054 2 992.5144 992.5179 K L 64 72 PSM DIDIHEVR 4426 sp|Q00839|HNRPU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8234.2 112.4389 3 995.5003 995.5036 K I 353 361 PSM DIDIHEVR 4427 sp|Q00839|HNRPU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8253.3 112.962 3 995.5003 995.5036 K I 353 361 PSM SSFYPDGGDQETAK 4428 sp|Q9NYF8-2|BCLF1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8301.8 114.2684 3 1500.6355 1500.6369 R T 317 331 PSM LMQLVDHR 4429 sp|Q92841-1|DDX17_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8238.2 112.5484 3 1010.5297 1010.5331 K G 469 477 PSM EYTINIHK 4430 sp|P62899|RL31_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8225.8 112.2032 2 1016.5298 1016.5291 R R 24 32 PSM TLNEWDSR 4431 sp|O15371-2|EIF3D_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8439.9 118.0052 2 1019.4642 1019.4672 K H 346 354 PSM LHPFHVIR 4432 sp|P27635|RL10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8260.2 113.152 3 1017.5857 1017.5872 R I 91 99 PSM TIAQAVYGAK 4433 sp|Q6UB35|C1TM_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8478.7 119.0695 2 1020.5560 1020.5604 R D 871 881 PSM GTGIVSAPVPK 4434 sp|P15880|RS2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8254.9 112.9994 2 1024.5898 1024.5917 R K 201 212 PSM DNVVCLSPK 4435 sp|Q96D46|NMD3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 5-UNIMOD:4 ms_run[1]:scan=1.1.8375.4 116.2697 2 1030.5008 1030.5117 K L 252 261 PSM TGLAVTVGQAK 4436 sp|Q13428-3|TCOF_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8233.7 112.42 2 1043.5960 1043.5975 K S 706 717 PSM SLLDACESR 4437 sp|Q01082-3|SPTB2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 6-UNIMOD:4 ms_run[1]:scan=1.1.8496.6 119.5577 2 1049.4796 1049.4811 K R 1882 1891 PSM NFGDQPDIR 4438 sp|Q15393|SF3B3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8400.8 116.9548 2 1060.4944 1060.4938 K C 260 269 PSM RPAEDMEEEQAFK 4439 sp|P61978|HNRPK_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 6-UNIMOD:35 ms_run[1]:scan=1.1.8304.8 114.3488 3 1594.6894 1594.6933 K R 22 35 PSM SVLGGQDQLR 4440 sp|Q9BV38|WDR18_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8283.11 113.7905 2 1071.5654 1071.5673 K V 390 400 PSM TAAYVNAIEK 4441 sp|P00367|DHE3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8377.8 116.3312 2 1078.5642 1078.5658 R V 536 546 PSM LEEYITTSK 4442 sp|Q14683|SMC1A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8228.8 112.285 2 1082.5434 1082.5495 K Q 438 447 PSM VHIEIGPDGR 4443 sp|P31943|HNRH1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8457.10 118.4991 2 1091.5710 1091.5724 R V 317 327 PSM NADGTICYDSTHYK 4444 sp|P14550|AK1A1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 7-UNIMOD:4 ms_run[1]:scan=1.1.8264.11 113.2759 3 1643.6902 1643.6886 K E 128 142 PSM QYTGINAISK 4445 sp|P61158|ARP3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8387.8 116.606 2 1093.5742 1093.5768 K K 255 265 PSM GNNVYCLDR 4446 sp|P53621-2|COPA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 6-UNIMOD:4 ms_run[1]:scan=1.1.8333.8 115.1327 2 1109.4942 1109.4924 K E 584 593 PSM LQDEIQNMK 4447 sp|P08670|VIME_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8158.11 110.3871 2 1117.5416 1117.5437 R E 365 374 PSM LCFSTAQHAS 4448 sp|P14866|HNRPL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 2-UNIMOD:4 ms_run[1]:scan=1.1.8138.8 109.838 2 1120.4938 1120.4971 K - 580 590 PSM VSEFYEETK 4449 sp|O95671-2|ASML_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8216.11 111.9633 2 1130.5112 1130.5132 R V 125 134 PSM VLVTTNVCAR 4450 sp|Q9NUU7|DD19A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 8-UNIMOD:4 ms_run[1]:scan=1.1.8142.10 109.9503 2 1131.6044 1131.6070 K G 385 395 PSM LAALEQNVER 4451 sp|Q9UIF9-2|BAZ2A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8337.9 115.2417 2 1141.6118 1141.6091 R R 1563 1573 PSM EGIVQTEQIR 4452 sp|Q6P1J9|CDC73_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8386.7 116.5768 2 1171.6178 1171.6197 K S 162 172 PSM KGEFETGFEK 4453 sp|Q8IYD1|ERF3B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8294.11 114.086 2 1170.5522 1170.5557 R G 316 326 PSM LEHTAQTYSELQGER 4454 sp|O95071-2|UBR5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8266.10 113.3286 3 1760.8294 1760.8329 K I 458 473 PSM NQMLISEDSR 4455 sp|Q13308-6|PTK7_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8368.10 116.0876 2 1191.5548 1191.5554 R F 456 466 PSM TEEGPTLSYGR 4456 sp|P43243|MATR3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8486.10 119.2922 2 1208.5642 1208.5673 R D 150 161 PSM ALVDGPCTQVR 4457 sp|P50914|RL14_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 7-UNIMOD:4 ms_run[1]:scan=1.1.8408.10 117.1697 2 1214.6074 1214.6078 R R 36 47 PSM ELQSVEQEVR 4458 sp|Q969Z0|FAKD4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8434.10 117.8711 2 1215.6072 1215.6095 K W 164 174 PSM ALVDGPCTQVR 4459 sp|P50914|RL14_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 7-UNIMOD:4 ms_run[1]:scan=1.1.8351.10 115.6235 2 1214.6074 1214.6078 R R 36 47 PSM GVVEVTHDLQK 4460 sp|P50454|SERPH_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8305.6 114.3725 3 1223.6488 1223.6510 K H 309 320 PSM NFGEDMDDER 4461 sp|P11940-2|PABP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8312.9 114.5662 2 1226.4506 1226.4510 K L 197 207 PSM NNNSNQNFFK 4462 sp|O60763-2|USO1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8190.11 111.2601 2 1225.5456 1225.5476 K E 246 256 PSM GIVEFSGKPAAR 4463 sp|Q15233-2|NONO_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8420.11 117.4947 2 1230.6702 1230.6721 K K 102 114 PSM KLETEETVPETDVETK 4464 sp|Q03701|CEBPZ_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8443.10 118.1158 3 1846.9000 1846.9048 K K 659 675 PSM DIQEESTFSSR 4465 sp|P42704|LPPRC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8398.11 116.9072 2 1297.5774 1297.5786 K K 67 78 PSM DGVIEASINHEK 4466 sp|O43242|PSMD3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8447.11 118.2268 2 1310.6434 1310.6466 R G 444 456 PSM AEFAAPSTDAPDK 4467 sp|Q96B26|EXOS8_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8174.11 110.8234 2 1318.6048 1318.6041 K G 64 77 PSM LNQPPEDGISSVK 4468 sp|O43684-2|BUB3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8324.9 114.8905 2 1382.7040 1382.7041 K F 9 22 PSM SSHETLNIVEEK 4469 sp|O43491-4|E41L2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8187.11 111.1783 2 1384.6750 1384.6834 K K 612 624 PSM EQYEALQEETR 4470 sp|Q9UPN3|MACF1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8380.11 116.4186 2 1394.6312 1394.6313 K V 3708 3719 PSM ASQQEIQHIVNR 4471 sp|A5YKK6-2|CNOT1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8239.7 112.5842 3 1421.7328 1421.7375 R H 27 39 PSM EYAEDDNIYQQK 4472 sp|Q96FW1|OTUB1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8360.11 115.8705 2 1514.6546 1514.6525 K I 60 72 PSM KEEELQGALAR 4473 sp|P35580-3|MYH10_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7672.6 97.22478 3 1242.6559 1242.6568 K G 1109 1120 PSM NSLQEQQEEEEEARK 4474 sp|P35580-3|MYH10_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6778.8 73.17927 4 1845.8337 1845.8340 K N 1367 1382 PSM IVGPSGAAVPCK 4475 sp|P21333-2|FLNA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 11-UNIMOD:4 ms_run[1]:scan=1.1.7749.4 99.32308 3 1154.6092 1154.6118 K V 1008 1020 PSM ILSSDDYGK 4476 sp|Q01082-3|SPTB2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7052.8 80.5496 2 996.4798 996.4764 K D 647 656 PSM GLEAAQIK 4477 sp|Q14980|NUMA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7190.5 84.24168 2 828.4670 828.4705 R E 1071 1079 PSM SLEQLQK 4478 sp|Q14980|NUMA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6871.5 75.69685 2 844.4636 844.4654 R E 1637 1644 PSM IHGTEEGQQILK 4479 sp|Q14980|NUMA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7521.7 93.11803 3 1351.7071 1351.7096 R Q 43 55 PSM HPSSPECLVSAQK 4480 sp|Q14980|NUMA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 7-UNIMOD:4 ms_run[1]:scan=1.1.7669.6 97.14217 3 1438.6825 1438.6875 K V 74 87 PSM LAQGHTTVDELAR 4481 sp|Q15149|PLEC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7750.6 99.35394 3 1409.7217 1409.7263 R R 2809 2822 PSM FEPYANPTK 4482 sp|P52272|HNRPM_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7949.10 104.7632 2 1065.5110 1065.5131 R R 61 70 PSM VVIQSNDDIASR 4483 sp|Q93008-1|USP9X_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7937.2 104.4215 3 1315.6711 1315.6732 R A 777 789 PSM EATNPPVIQEEKPK 4484 sp|P30101|PDIA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7220.9 85.06136 3 1578.8248 1578.8253 R K 483 497 PSM AQVADVVVSR 4485 sp|P49327|FAS_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8062.9 107.8289 2 1042.5760 1042.5771 K W 1073 1083 PSM HIYYITGETK 4486 sp|P07900-2|HS90A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8412.2 117.2635 3 1223.6176 1223.6186 K D 612 622 PSM HIYYITGETK 4487 sp|P07900-2|HS90A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8393.3 116.7607 3 1223.6176 1223.6186 K D 612 622 PSM GLSEDTTEETLK 4488 sp|P19338|NUCL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8346.7 115.4826 3 1321.6225 1321.6249 K E 578 590 PSM RETGVDLTK 4489 sp|P38646|GRP75_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6369.2 62.04832 3 1017.5512 1017.5455 K D 292 301 PSM SPPPGMGLNQNR 4490 sp|P23246|SFPQ_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7621.6 95.83018 3 1266.6244 1266.6139 R G 33 45 PSM RLSELLR 4491 sp|P08238|HS90B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8425.4 117.6177 2 885.5378 885.5396 R Y 450 457 PSM STAGDTHLGGEDFDNR 4492 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8323.9 114.8634 3 1690.7176 1690.7183 K M 221 237 PSM VRELISDNQYR 4493 sp|P25205-2|MCM3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8299.5 114.21 3 1391.7160 1391.7157 K L 81 92 PSM ASGFEESMK 4494 sp|Q6P2Q9|PRP8_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7449.5 91.16445 2 984.4224 984.4222 K W 1506 1515 PSM IMGPNYTPGKK 4495 sp|P13639|EF2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7192.5 84.29604 3 1204.6309 1204.6274 R E 429 440 PSM DAQHYGGWEHR 4496 sp|Q14697|GANAB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7479.6 91.97173 3 1354.6024 1354.5803 K D 559 570 PSM AQMVQEDLEK 4497 sp|P26038|MOES_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7953.4 104.863 3 1189.5631 1189.5649 K T 449 459 PSM LTDCVVMR 4498 sp|P22626-2|ROA2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 4-UNIMOD:4 ms_run[1]:scan=1.1.8336.5 115.2083 2 992.4762 992.4783 K D 35 43 PSM MQVDQEEPHVEEQQQQTPAENK 4499 sp|P34932|HSP74_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8237.11 112.536 3 2621.1697 2621.1664 K A 522 544 PSM RLVEVDSSR 4500 sp|Q03252|LMNB2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6497.2 65.47205 3 1059.5644 1059.5673 R Q 240 249 PSM ILGATIENSR 4501 sp|P08727|K1C19_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8484.9 119.2361 2 1072.5862 1072.5876 K I 141 151 PSM LDQDLNEVK 4502 sp|Q9UQE7|SMC3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7588.8 94.95052 2 1072.5364 1072.5400 K A 437 446 PSM ASAVSELSPR 4503 sp|Q9Y2W1|TR150_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7857.6 102.2329 2 1015.5278 1015.5298 R E 236 246 PSM HTEMITTLK 4504 sp|O75475|PSIP1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7748.10 99.3056 2 1072.5654 1072.5587 K K 393 402 PSM NICQQVNIK 4505 sp|Q14152-2|EIF3A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 3-UNIMOD:4 ms_run[1]:scan=1.1.8237.9 112.5327 2 1115.5960 1115.5757 K S 42 51 PSM VNTPTTTVYR 4506 sp|P26639-2|SYTC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7526.7 93.25412 2 1150.5964 1150.5983 K C 277 287 PSM SAGQENLETLK 4507 sp|P48681|NEST_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7972.5 105.3855 3 1188.5878 1188.5986 K S 831 842 PSM TLENQSHETLER 4508 sp|P48681|NEST_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6749.8 72.38808 3 1455.6919 1455.6954 K E 559 571 PSM TVFAEHISDECKR 4509 sp|P39023|RL3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 11-UNIMOD:4 ms_run[1]:scan=1.1.8045.10 107.3833 3 1590.7405 1590.7460 K R 104 117 PSM KHEAFESDLAAHQDR 4510 sp|O43707|ACTN4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7344.7 88.44064 4 1752.8181 1752.8179 K V 455 470 PSM GVYSEETLR 4511 sp|Q16891-2|MIC60_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8083.10 108.3695 2 1052.5112 1052.5138 R A 613 622 PSM TQLAVCQQR 4512 sp|Q02790|FKBP4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 6-UNIMOD:4 ms_run[1]:scan=1.1.6790.4 73.50185 3 1102.5541 1102.5553 K I 391 400 PSM GAESPFEEK 4513 sp|P46821|MAP1B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7507.7 92.73717 2 992.4570 992.4451 R S 1424 1433 PSM EKEDLLCGATDGK 4514 sp|P11717|MPRI_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 7-UNIMOD:4 ms_run[1]:scan=1.1.8111.9 109.1041 3 1434.6619 1434.6660 K K 469 482 PSM VHIEIGPDGR 4515 sp|P31943|HNRH1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8443.2 118.1024 3 1091.5711 1091.5724 R V 317 327 PSM LGPLVEQGR 4516 sp|P02649|APOE_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8218.5 112.0078 2 967.5428 967.5451 R V 199 208 PSM IKQEILPEER 4517 sp|O75534-2|CSDE1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8062.5 107.8223 3 1253.6941 1253.6979 K M 90 100 PSM GTEITHAVVIK 4518 sp|B5ME19|EIFCL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8074.7 108.1371 2 1166.6622 1166.6659 K K 322 333 PSM GDTVLLK 4519 sp|P55072|TERA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7499.3 92.51328 2 744.4366 744.4382 R G 54 61 PSM QEYVDYSESAKK 4520 sp|O60832|DKC1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7219.8 85.03273 3 1445.6665 1445.6674 K E 414 426 PSM SVDPDSPAEASGLR 4521 sp|O14745|NHRF1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8494.6 119.5033 3 1399.6648 1399.6579 R A 181 195 PSM TAVCDIPPR 4522 sp|Q9BVA1|TBB2B_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 4-UNIMOD:4 ms_run[1]:scan=1.1.7809.8 100.9278 2 1027.5132 1027.5121 K G 351 360 PSM SGVSLAALKK 4523 sp|P10412|H14_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8420.8 117.4897 2 972.5950 972.5968 R A 55 65 PSM RYIETDPANR 4524 sp|P06396-2|GELS_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6613.5 68.65997 3 1233.5944 1233.6102 K D 678 688 PSM SGGTALHVAAAK 4525 sp|O14974-2|MYPT1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6296.4 60.06165 3 1081.5880 1081.5880 K G 198 210 PSM VAQGVSGAVQDK 4526 sp|P12268|IMDH2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6319.10 60.70383 2 1157.6046 1157.6041 K G 439 451 PSM AFHNEAQVNPER 4527 sp|P17987|TCPA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6635.5 69.25771 3 1410.6643 1410.6640 R K 469 481 PSM QASVADYEETVKK 4528 sp|P49419-2|AL7A1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8358.11 115.8159 2 1466.7250 1466.7253 R A 54 67 PSM INSITVDNCK 4529 sp|Q01518-2|CAP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 9-UNIMOD:4 ms_run[1]:scan=1.1.7304.10 87.36404 2 1162.5652 1162.5652 K K 366 376 PSM IAPAEGPDVSER 4530 sp|Q9Y6M1-1|IF2B2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7243.11 85.69157 2 1239.6098 1239.6095 K M 420 432 PSM SHEGETSYIR 4531 sp|Q13242|SRSF9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6619.6 68.82069 3 1177.5373 1177.5363 R V 172 182 PSM TCSNVNWAR 4532 sp|O95218-2|ZRAB2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 2-UNIMOD:4 ms_run[1]:scan=1.1.7558.10 94.13215 2 1106.4902 1106.4927 K R 73 82 PSM TSSGDASSLSIEETNK 4533 sp|O43290|SNUT1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8113.6 109.1535 3 1624.7425 1624.7428 K L 110 126 PSM ADIDVSGPK 4534 sp|Q09666|AHNK_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7137.7 82.83798 2 900.4576 900.4553 K V 1281 1290 PSM RGAEIIVCTPGR 4535 sp|Q7L014|DDX46_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 8-UNIMOD:4 ms_run[1]:scan=1.1.8346.8 115.4842 3 1327.7005 1327.7030 K M 494 506 PSM TATQLAVNK 4536 sp|Q99832-3|TCPH_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6402.8 62.92355 2 944.5296 944.5291 R I 83 92 PSM EIGGLTQVNK 4537 sp|O14497|ARI1A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7988.7 105.8245 2 1057.5746 1057.5768 K N 1060 1070 PSM KPGLPGQPAVS 4538 sp|Q9NP81|SYSM_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7715.11 98.4047 2 1049.5778 1049.5869 R - 508 519 PSM IDASQTEFEK 4539 sp|O94979-2|SC31A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7936.10 104.4075 2 1166.5420 1166.5455 K N 462 472 PSM VIQHNALEDR 4540 sp|O60313-10|OPA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6522.3 66.16088 3 1193.6122 1193.6153 R S 779 789 PSM IGKPAPDFK 4541 sp|P32119|PRDX2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6868.8 75.61951 2 971.5436 971.5440 R A 8 17 PSM SAINEVVTR 4542 sp|P62899|RL31_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7894.2 103.243 3 987.5314 987.5349 R E 15 24 PSM TEGDGVYTLNNEK 4543 sp|P00738|HPT_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8364.6 115.9715 3 1438.6552 1438.6576 R Q 119 132 PSM LRTEGDGVYTLNNEK 4544 sp|P00738|HPT_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7852.6 102.0959 4 1707.8741 1707.8428 K Q 117 132 PSM IFEPPPPK 4545 sp|O43143|DHX15_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7942.8 104.5682 2 923.5106 923.5116 R K 400 408 PSM VLIGGDETPEGQR 4546 sp|O60701|UGDH_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8399.6 116.9252 3 1369.6795 1369.6838 R A 178 191 PSM TCVSLAVSR 4547 sp|O95782-2|AP2A1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 2-UNIMOD:4 ms_run[1]:scan=1.1.8097.8 108.729 2 991.5298 991.5121 K L 224 233 PSM QQDLDGELR 4548 sp|Q99459|CDC5L_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7850.10 102.0478 2 1072.5232 1072.5149 R S 244 253 PSM ITHQIVDRPGQQTSVIGR 4549 sp|O00541-2|PESC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8227.7 112.2562 4 2004.0849 2004.0865 R C 368 386 PSM VSVADHSLHLSK 4550 sp|Q13162|PRDX4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8032.4 107.0213 3 1291.6858 1291.6884 R A 67 79 PSM GAEQLAEGGR 4551 sp|Q08J23-2|NSUN2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6581.10 67.79315 2 986.4768 986.4781 R M 271 281 PSM ETPHSPGVEDAPIAK 4552 sp|Q9UHB6-4|LIMA1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7749.8 99.32975 3 1546.7542 1546.7627 R V 487 502 PSM PHSVSLNDTETR 4553 sp|Q9P0L0|VAPA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6724.9 71.70065 3 1354.6738 1354.6477 K K 162 174 PSM NREEFEDQSLEK 4554 sp|Q12830-2|BPTF_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7854.9 102.1556 3 1522.6846 1522.6899 K D 593 605 PSM CTGGEVGATSALAPK 4555 sp|P30050-2|RL12_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 1-UNIMOD:4 ms_run[1]:scan=1.1.8132.7 109.6729 3 1417.6825 1417.6871 R I 17 32 PSM YRPGTVALR 4556 sp|Q71DI3|H32_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7456.3 91.34427 3 1031.5864 1031.5876 R E 42 51 PSM GADVNAPPVPSSR 4557 sp|O75179-7|ANR17_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7614.5 95.63975 3 1265.6482 1265.6364 K D 1195 1208 PSM QFLSETEK 4558 sp|P09936|UCHL1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7628.9 96.02645 2 980.4794 980.4815 K M 116 124 PSM NNTQVLINCR 4559 sp|P62316|SMD2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 9-UNIMOD:4 ms_run[1]:scan=1.1.7991.6 105.9043 3 1230.6115 1230.6139 K N 38 48 PSM TVLAAAYGEK 4560 sp|Q9H583|HEAT1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8400.6 116.9515 2 1021.5438 1021.5444 K D 1427 1437 PSM SYENQKPPFDAK 4561 sp|P16435|NCPR_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7918.4 103.9044 3 1422.6736 1422.6779 K N 268 280 PSM IGNCPFSQR 4562 sp|O00299|CLIC1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 4-UNIMOD:4 ms_run[1]:scan=1.1.7782.8 100.1986 2 1077.5010 1077.5026 K L 21 30 PSM QTESLVEK 4563 sp|Q15021|CND1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6373.4 62.1561 2 932.4898 932.4815 K L 1202 1210 PSM AVGFSSGTENPHGVK 4564 sp|Q32P28-3|P3H1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7278.6 86.64477 3 1485.7171 1485.7212 R A 648 663 PSM DRVHHEPQLSDK 4565 sp|O43852-2|CALU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6047.3 53.2339 4 1459.7157 1459.7168 K V 26 38 PSM ELLENAEK 4566 sp|O75487|GPC4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7142.7 82.97445 2 944.4814 944.4814 K S 111 119 PSM QAANLQDCYR 4567 sp|P43246-2|MSH2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 8-UNIMOD:4 ms_run[1]:scan=1.1.7467.4 91.6419 3 1237.5496 1237.5509 R L 331 341 PSM FDDDVVSR 4568 sp|Q93009-3|UBP7_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7865.7 102.454 2 951.4274 951.4298 K C 464 472 PSM LATELYHQK 4569 sp|Q06210|GFPT1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7246.4 85.7619 3 1101.5776 1101.5818 K S 548 557 PSM GQVCVMIHSGSR 4570 sp|Q9Y3I0|RTCB_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 4-UNIMOD:4 ms_run[1]:scan=1.1.7675.2 97.30061 3 1329.6178 1329.6282 K G 252 264 PSM RPSAPVDFSK 4571 sp|Q14696|MESD_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7547.3 93.81945 3 1102.5700 1102.5771 K I 86 96 PSM STSIQSFK 4572 sp|P13797-2|PLST_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7436.8 90.83317 2 896.4580 896.4603 K D 525 533 PSM ERLEQEQLER 4573 sp|Q8N8S7|ENAH_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7107.8 82.03368 3 1328.6689 1328.6684 R E 184 194 PSM RQQVEALYR 4574 sp|Q9Y399|RT02_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7316.4 87.68195 3 1161.6277 1161.6254 K L 264 273 PSM EQAQQIELK 4575 sp|Q5JRX3-2|PREP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7489.11 92.25375 2 1085.5826 1085.5717 R T 634 643 PSM DTEMLATGAQDGK 4576 sp|Q2TAY7|SMU1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7671.11 97.20562 2 1335.5974 1335.5976 R I 275 288 PSM LLADQAEAR 4577 sp|P84098|RL19_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6779.5 73.20161 3 985.5184 985.5192 K R 154 163 PSM KALQEAAAR 4578 sp|Q96L73-2|NSD1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6582.8 67.81735 2 956.5282 956.5403 K F 1567 1576 PSM AQAAAPASVPAQAPK 4579 sp|P47914|RL29_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7089.8 81.54393 3 1376.7403 1376.7412 K R 135 150 PSM SLVDYENANK 4580 sp|Q9UNH7|SNX6_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8475.9 118.9907 2 1151.5422 1151.5458 R A 316 326 PSM TGQLAAIK 4581 sp|Q9UKE5-2|TNIK_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6894.3 76.31668 2 800.4726 800.4756 K V 47 55 PSM EENGTWEK 4582 sp|P55735-2|SEC13_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6413.10 63.22645 2 991.4302 991.4247 R S 74 82 PSM RLEVLDSTK 4583 sp|P0C7P4|UCRIL_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7702.8 98.04487 2 1059.5898 1059.5924 R S 102 111 PSM ALQATVGNSYK 4584 sp|P11279-2|LAMP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7519.3 93.05698 3 1150.5958 1150.5982 R C 274 285 PSM IYFTDSSSK 4585 sp|Q9HDC9-2|APMAP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8284.9 113.8141 2 1046.4908 1046.4920 K W 212 221 PSM LENGELEHIRPK 4586 sp|Q15102|PA1B3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8111.9 109.1041 3 1433.7604 1433.7626 R I 84 96 PSM YRPEEVDIDAK 4587 sp|Q9HAU0-2|PKHA5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8289.4 113.9404 3 1333.6468 1333.6514 K L 686 697 PSM ASPLFSQHTAADK 4588 sp|Q2NL82|TSR1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7744.7 99.1911 3 1371.6742 1371.6783 R H 625 638 PSM EGMEAAVEK 4589 sp|Q9H0D6-2|XRN2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6696.9 70.933 2 962.4414 962.4379 K Q 48 57 PSM STEVLPEK 4590 sp|P46939-2|UTRO_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6586.7 67.92593 2 901.4746 901.4756 K T 1263 1271 PSM QLSSGVSEIR 4591 sp|P04792|HSPB1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7894.9 103.2547 2 1074.5642 1074.5669 R H 80 90 PSM VSGTLDTPEK 4592 sp|Q9BYG3|MK67I_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6542.8 66.71838 2 1045.5290 1045.5292 K T 217 227 PSM NCPHVVVGTPGR 4593 sp|O00148|DX39A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 2-UNIMOD:4 ms_run[1]:scan=1.1.6987.7 78.80652 3 1291.6438 1291.6456 K I 163 175 PSM VAVLSQNR 4594 sp|Q9BWD1-2|THIC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6632.5 69.17565 2 885.5022 885.5032 K T 210 218 PSM RGVSCQFGPDVTK 4595 sp|P53041|PPP5_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 5-UNIMOD:4 ms_run[1]:scan=1.1.8152.7 110.2175 3 1449.6859 1449.7035 K A 400 413 PSM CNTDDTIGDLKK 4596 sp|Q9BZL1|UBL5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 1-UNIMOD:4 ms_run[1]:scan=1.1.7486.7 92.16497 3 1378.6396 1378.6398 K L 18 30 PSM LSANQQNILK 4597 sp|P57088|TMM33_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8214.9 111.9056 2 1127.6280 1127.6298 K F 149 159 PSM HCLLTCEECK 4598 sp|Q56VL3|OCAD2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 2-UNIMOD:4,6-UNIMOD:4,9-UNIMOD:4 ms_run[1]:scan=1.1.7172.6 83.7688 3 1348.5532 1348.5574 R I 129 139 PSM KDPGVPNSAPFK 4599 sp|Q9BVP2-2|GNL3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8126.5 109.5059 3 1255.6576 1255.6561 R E 34 46 PSM HLVGVCYTEDEAK 4600 sp|P08574|CY1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 6-UNIMOD:4 ms_run[1]:scan=1.1.8478.6 119.0678 3 1519.6960 1519.6977 R E 134 147 PSM VLSHQDDTALLK 4601 sp|Q93034|CUL5_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8364.4 115.9681 3 1338.7093 1338.7143 R A 80 92 PSM QPGNETADTVLK 4602 sp|P61758|PFD3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7675.8 97.31062 2 1271.6350 1271.6357 K K 40 52 PSM VALENDDRSEEEK 4603 sp|Q99700-2|ATX2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6289.7 59.87307 3 1532.6947 1532.6954 R Y 458 471 PSM AHSGAQGLLAAQK 4604 sp|Q9Y2Z4|SYYM_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7036.4 80.10793 3 1250.6710 1250.6731 K A 31 44 PSM TLESGMAETR 4605 sp|Q8WY07|CTR3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7217.8 84.97881 2 1093.5078 1093.5074 R L 18 28 PSM VMGSGSALSR 4606 sp|Q9UHJ6|SHPK_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6736.7 72.02803 2 963.4768 963.4808 R N 427 437 PSM SQLGAHHTTPVGDGAAGTR 4607 sp|Q5BJD5-2|TM41B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6329.7 60.9669 4 1831.8957 1831.8925 R G 10 29 PSM ITSEIPQTER 4608 sp|P82979|SARNP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7543.4 93.71191 3 1172.6005 1172.6037 K M 93 103 PSM GHQDLDPDNEGELR 4609 sp|Q9ULF5|S39AA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7874.8 102.7037 3 1593.7063 1593.7019 R H 293 307 PSM DKEEIVICDR 4610 sp|Q9NRR5|UBQL4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 8-UNIMOD:4 ms_run[1]:scan=1.1.8130.5 109.6149 3 1275.6106 1275.6129 K A 22 32 PSM DHPLPEVAHVK 4611 sp|P13073|COX41_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7541.3 93.6556 3 1240.6531 1240.6564 R H 43 54 PSM YASETLQAQSEEAR 4612 sp|Q9ULR0-1|ISY1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7757.11 99.55241 2 1581.7106 1581.7270 K R 267 281 PSM NLGESATLR 4613 sp|Q15649|ZNHI3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7340.11 88.34143 2 959.5022 959.5036 K S 94 103 PSM EVQSALSTAAADDSK 4614 sp|Q9Y232-4|CDYL_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8151.8 110.1921 3 1491.6904 1491.7053 R L 188 203 PSM NVQLQENEIR 4615 sp|P36873-2|PP1G_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8468.7 118.7962 2 1241.6354 1241.6364 K G 27 37 PSM DRDSQITAIEK 4616 sp|Q8N7H5-2|PAF1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7529.4 93.33057 3 1274.6443 1274.6466 K T 161 172 PSM KLGLMDNEIK 4617 sp|O14763-2|TR10B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 5-UNIMOD:35 ms_run[1]:scan=1.1.7966.6 105.2232 3 1175.6008 1175.6220 R V 331 341 PSM GHQQLYWSHPR 4618 sp|P62273-2|RS29_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8200.8 111.5259 3 1407.6739 1407.6796 M K 2 13 PSM RGDTYELQVR 4619 sp|Q9H0U3|MAGT1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.8087.3 108.4622 3 1235.6242 1235.6258 K G 150 160 PSM LDDCGLTEAR 4620 sp|P13489|RINI_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 4-UNIMOD:4 ms_run[1]:scan=1.1.8286.9 113.868 2 1148.5140 1148.5132 R C 35 45 PSM VESGGPGTSAASAR 4621 sp|Q9BU76-4|MMTA2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7530.9 93.36607 2 1245.5754 1245.5949 R R 153 167 PSM KNNDDSGAEIK 4622 sp|Q5VU43-13|MYOME_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7972.5 105.3855 3 1189.5796 1189.5575 R A 99 110 PSM VPQDVLQK 4623 sp|P49903-2|SPS1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7248.7 85.82169 2 925.5126 925.5233 K L 33 41 PSM NQLESLQR 4624 sp|L0R6Q1|S35U4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7571.9 94.48711 2 986.5086 986.5145 K R 19 27 PSM NEEENENSISQYK 4625 sp|P82673|RT35_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.7797.8 100.6011 3 1582.7020 1582.6747 K E 301 314 PSM NIVHMLVKALDR 4626 sp|Q92845-2|KIFA3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001207, Mascot, ] 18 ms_run[1]:scan=1.1.6032.6 52.82488 4 1407.7825 1407.8020 K D 259 271 PSM CMLQDREDQSILCTGESGAGK 4627 sp|P35580|MYH10_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 1-UNIMOD:4,13-UNIMOD:4 ms_run[1]:scan=1.1.8221.10 112.0976 4 2356.006894 2354.030080 R T 164 185 PSM ETYGEMADCCAK 4628 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 6-UNIMOD:35,9-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.6419.10 63.3898 2 1450.519847 1449.521052 R Q 106 118 PSM EQLEEEEEAK 4629 sp|P35579|MYH9_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.6526.11 66.28402 2 1233.541847 1232.540842 R H 1343 1353 PSM ADEASELACPTPK 4630 sp|P49327|FAS_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 9-UNIMOD:4 ms_run[1]:scan=1.1.7957.7 104.978 3 1388.630771 1387.628946 K E 2194 2207 PSM ASNGDAWVEAHGK 4631 sp|P38646|GRP75_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.7756.4 99.51511 3 1341.603971 1340.610928 R L 147 160 PSM GRPYDYNGPR 4632 sp|P13667|PDIA4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.7271.2 86.4446 3 1194.557171 1193.557770 K E 261 271 PSM YHTVNGHNCEVR 4633 sp|P09651|ROA1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 9-UNIMOD:4 ms_run[1]:scan=1.1.6214.5 57.7947 4 1485.645294 1484.657895 K K 167 179 PSM HPGSFDVVHVK 4634 sp|P62701|RS4X_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.8264.4 113.2642 3 1221.633371 1220.630206 R D 201 212 PSM LNGGLGTSMGCK 4635 sp|Q16851|UGPA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 11-UNIMOD:4 ms_run[1]:scan=1.1.8415.8 117.3547 2 1194.538647 1193.553278 K G 113 125 PSM CTHWAEGGK 4636 sp|P11586|C1TC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 18 1-UNIMOD:385,1-UNIMOD:4 ms_run[1]:scan=1.1.8472.8 118.9071 2 1027.4165 1027.4176 K G 785 794 PSM MEVKPPPGRPQPDSGR 4637 sp|P51991|ROA3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 18 1-UNIMOD:1 ms_run[1]:scan=1.1.8190.10 111.2585 3 1788.8882 1788.8936 - R 1 17 PSM LSDLDSETR 4638 sp|Q9Y266|NUDC_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.6873.9 75.75838 2 1035.503647 1034.488018 K S 276 285 PSM CLIATGGTPR 4639 sp|O95831|AIFM1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 1-UNIMOD:4 ms_run[1]:scan=1.1.7862.8 102.3732 2 1045.537847 1044.538614 K S 256 266 PSM RPSTYGIPR 4640 sp|P78347|GTF2I_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.7317.2 87.70599 3 1046.568071 1045.566878 R L 410 419 PSM TPTQTNGSNVPFKPR 4641 sp|P78347|GTF2I_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.8039.10 107.2202 3 1643.820371 1642.842718 R G 703 718 PSM VDREQLVQK 4642 sp|P61981|1433G_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 18 1-UNIMOD:1 ms_run[1]:scan=1.1.8045.3 107.3717 3 1155.6215 1155.6243 M A 2 11 PSM YLAEVAAGDDK 4643 sp|P63104|1433Z_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.7916.9 103.8578 2 1150.549647 1150.550619 R K 128 139 PSM QTYSTEPNNLK 4644 sp|P46779|RL28_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 18 1-UNIMOD:28 ms_run[1]:scan=1.1.8374.11 116.2539 2 1276.5909 1276.5930 K A 23 34 PSM CGESGHLAR 4645 sp|P62633|CNBP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 18 1-UNIMOD:385,1-UNIMOD:4 ms_run[1]:scan=1.1.6448.8 64.16238 2 968.4131 968.4129 R E 161 170 PSM VAVCDIPPR 4646 sp|Q9H4B7|TBB1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 4-UNIMOD:4 ms_run[1]:scan=1.1.7957.9 104.9813 2 1028.560247 1025.532801 K G 351 360 PSM VAVCDIPPR 4647 sp|Q9H4B7|TBB1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 4-UNIMOD:4 ms_run[1]:scan=1.1.7824.7 101.3341 2 1028.558247 1025.532801 K G 351 360 PSM VAVCDIPPR 4648 sp|Q9H4B7|TBB1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 4-UNIMOD:4 ms_run[1]:scan=1.1.7469.8 91.70295 2 1026.532647 1025.532801 K G 351 360 PSM QHGDVVSAIR 4649 sp|O14745|NHRF1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 18 1-UNIMOD:28 ms_run[1]:scan=1.1.8350.8 115.593 2 1063.5272 1063.5402 K A 211 221 PSM CGGAGHIASDCK 4650 sp|Q15637-4|SF01_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 18 1-UNIMOD:385,1-UNIMOD:4,11-UNIMOD:4 ms_run[1]:scan=1.1.6542.10 66.72172 2 1214.4821 1214.4803 K F 282 294 PSM LEVQAEEERK 4651 sp|Q9H307|PININ_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.6435.5 63.80128 3 1230.620171 1229.625181 K Q 177 187 PSM EFTEAVEAK 4652 sp|P35232|PHB_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.7566.10 94.35145 2 1023.493447 1022.492041 K Q 178 187 PSM TGVHHYSGNNIELGTACGK 4653 sp|P62888|RL30_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 17-UNIMOD:4 ms_run[1]:scan=1.1.8220.6 112.0637 4 2014.916494 2013.932673 K Y 69 88 PSM SDKLPYK 4654 sp|P23526|SAHH_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 18 1-UNIMOD:1 ms_run[1]:scan=1.1.7817.7 101.1439 2 891.4676 891.4697 M V 2 9 PSM SDKLPYK 4655 sp|P23526|SAHH_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 18 1-UNIMOD:1 ms_run[1]:scan=1.1.7836.6 101.6586 2 891.4692 891.4697 M V 2 9 PSM LAAVTYNGVDNNK 4656 sp|Q16181|SEPT7_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.8135.10 109.7594 2 1378.672247 1377.688844 K N 314 327 PSM GAVTDDEVIRK 4657 sp|Q6I9Y2|THOC7_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 18 1-UNIMOD:1 ms_run[1]:scan=1.1.8424.11 117.6025 2 1243.6381 1243.6403 M R 2 13 PSM ASSLNEDPEGSR 4658 sp|Q9Y530|OARD1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 18 1-UNIMOD:1 ms_run[1]:scan=1.1.8180.10 110.9855 2 1302.5678 1302.5683 M I 2 14 PSM LTEIVASAPK 4659 sp|O60524|NEMF_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 18 ms_run[1]:scan=1.1.8332.5 115.1007 2 1027.5742 1027.5912 R G 170 180 PSM NVPNLHVMK 4660 sp|Q9NQ39|RS10L_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 18 ms_run[1]:scan=1.1.8494.2 119.4966 3 1051.5632 1050.5642 K A 39 48 PSM WVWGGGLSPR 4661 sp|P0CZ25|D10OS_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 18 ms_run[1]:scan=1.1.7480.3 91.99406 3 1113.5502 1113.5712 K N 65 75 PSM ANIAVQR 4662 sp|P61086|UBE2K_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 18 1-UNIMOD:1 ms_run[1]:scan=1.1.7906.4 103.5757 2 812.4479 812.4499 M I 2 9 PSM TGDEFLVMKR 4663 sp|Q9P243|ZFAT_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 18 ms_run[1]:scan=1.1.6832.9 74.64314 2 1194.5862 1194.6062 K K 63 73 PSM FQNSDNPYYYPR 4664 sp|Q86US8|EST1A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 18 ms_run[1]:scan=1.1.6331.5 61.0171 4 1562.6860 1562.6785 K T 501 513 PSM EVKSPGAR 4665 sp|Q8WX93|PALLD_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1001476, X!Tandem, ] 18 ms_run[1]:scan=1.1.7739.7 99.05427 2 842.4553 842.4605 R H 233 241 PSM RQQPGPSEHIER 4666 sp|P50552|VASP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.6084.7 54.24238 3 1431.717371 1432.717124 K R 143 155 PSM GAGGFGGGGGTR 4667 sp|Q86V81|THOC4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.6184.8 56.96652 2 948.441647 949.436592 R R 205 217 PSM PAPAVGEAEDK 4668 sp|P16989|YBOX3_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.6280.9 59.62772 2 1082.524847 1082.524404 R E 301 312 PSM KQQQLSALK 4669 sp|P35580|MYH10_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.6393.2 62.67713 3 1043.615171 1042.613494 K V 809 818 PSM QTEDSLASER 4670 sp|Q86UP2|KTN1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.6464.10 64.59832 2 1133.520247 1134.515296 K D 618 628 PSM LGPNDQYK 4671 sp|O00483|NDUA4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.6632.7 69.17899 2 932.453047 933.455596 K F 56 64 PSM RQGGLGPIR 4672 sp|Q13162|PRDX4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.6765.2 72.81322 3 954.544571 952.556647 R I 165 174 PSM EGETVEPYK 4673 sp|Q08211|DHX9_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.6781.8 73.26133 2 1049.499047 1050.486956 K V 267 276 PSM DSAQCAAIAER 4674 sp|Q96RS6|NUDC1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 5-UNIMOD:4 ms_run[1]:scan=1.1.6852.5 75.17598 3 1189.554971 1190.534986 R L 372 383 PSM GTLDALLAGER 4675 sp|P0DPD8|EFCE2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.7059.2 80.72965 3 1116.590471 1114.598238 K D 131 142 PSM LGNSCEFR 4676 sp|P55265|DSRAD_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 5-UNIMOD:4 ms_run[1]:scan=1.1.7096.9 81.73598 2 982.439247 981.433815 K L 626 634 PSM KLPEYNPR 4677 sp|Q9P258|RCC2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.7124.2 82.48035 3 1014.534971 1015.545080 K T 513 521 PSM TAVCDIPPR 4678 sp|Q13885|TBB2A_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 4-UNIMOD:4 ms_run[1]:scan=1.1.7236.8 85.49505 2 1028.506847 1027.512065 K G 351 360 PSM SQDATFSPGSEQAEK 4679 sp|Q86WB0|NIPA_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.7275.11 86.57021 2 1579.712247 1580.695445 R S 329 344 PSM YRPGTVALR 4680 sp|Q16695|H31T_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.7350.2 88.59135 3 1030.574471 1031.587613 R E 42 51 PSM GAAACDLVQR 4681 sp|Q8IZ83|A16A1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 5-UNIMOD:4 ms_run[1]:scan=1.1.7365.9 89.00138 2 1058.530447 1059.513128 R F 346 356 PSM RAEFTVETR 4682 sp|P21333|FLNA_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.7397.2 89.81752 3 1106.567471 1107.567272 K S 301 310 PSM STSLETQDDDNIR 4683 sp|Q6IA86|ELP2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.7557.10 94.1047 3 1491.666371 1492.664145 K L 242 255 PSM PSILPSK 4684 sp|P27816|MAP4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.7575.4 94.58855 2 740.441047 740.443240 R D 763 770 PSM CCTESLVNR 4685 sp|P02768|ALBU_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 1-UNIMOD:4,2-UNIMOD:4 ms_run[1]:scan=1.1.7602.10 95.32935 2 1138.471447 1137.490678 K R 500 509 PSM PSGLLAQER 4686 sp|Q9Y2W1|TR150_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.7604.7 95.37724 2 969.520247 969.524344 R K 583 592 PSM AANGVVLATEK 4687 sp|P25787|PSA2_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.7659.8 96.87138 2 1072.574647 1071.592424 K K 40 51 PSM VEIIANDQGNR 4688 sp|P11021|BIP_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.7740.11 99.08813 2 1228.603047 1227.620764 R I 50 61 PSM RVDATAGWSAAGK 4689 sp|Q10570|CPSF1_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.7890.5 103.1381 3 1287.644471 1288.652398 K S 423 436 PSM LVEVNGENVEK 4690 sp|O14745|NHRF1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.7940.11 104.5187 2 1229.612247 1228.629932 R E 59 70 PSM LEAAHTLEDCASR 4691 sp|Q9H0B6|KLC2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 10-UNIMOD:4 ms_run[1]:scan=1.1.7944.7 104.6213 3 1470.668771 1471.672542 K N 465 478 PSM VQEAREGPVAEAAR 4692 sp|Q96D98|EID2B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.8243.8 112.6957 3 1483.738871 1481.758654 R S 42 56 PSM VVIVDPETNK 4693 sp|P15924|DESP_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.8258.10 113.1107 2 1114.594847 1112.607740 R E 2466 2476 PSM KPHIYYGSLEEK 4694 sp|O43172|PRP4_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.8290.8 113.9739 3 1461.740171 1462.745630 K E 27 39 PSM EQVANSAFVER 4695 sp|Q58FF7|H90B3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.8336.9 115.215 2 1249.592647 1248.609865 K V 365 376 PSM EQVANSAFVER 4696 sp|Q58FF7|H90B3_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.8355.10 115.7325 2 1249.592647 1248.609865 K V 365 376 PSM ANGHLLLNSEK 4697 sp|Q9P2J5|SYLC_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.8358.4 115.8043 3 1195.617671 1194.635686 R M 706 717 PSM EAAENSLVAYK 4698 sp|P62258|1433E_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.8364.10 115.9781 2 1194.574647 1193.592818 K A 143 154 PSM SRFVTPFK 4699 sp|Q06481|APLP2_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.8401.10 116.9845 2 982.563847 980.544351 K C 125 133 PSM HIYYITGETK 4700 sp|Q58FG0|HS905_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.8412.4 117.2668 3 1226.624171 1223.618639 K D 175 185 PSM NSAELTVIK 4701 sp|O60566|BUB1B_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.8439.8 118.0035 2 972.533247 973.544411 R V 787 796 PSM AADLNGDLTATR 4702 sp|Q15293|RCN1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.8456.11 118.4734 2 1217.586447 1216.604780 K E 177 189 PSM IGCIITAR 4703 sp|Q12904|AIMP1_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 3-UNIMOD:4 ms_run[1]:scan=1.1.8477.7 119.0422 2 903.498047 902.500772 R K 159 167 PSM RLNDFASTVR 4704 sp|P20674|COX5A_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.8479.3 119.09 3 1176.604271 1177.620370 R I 98 108 PSM ADTLTLEER 4705 sp|Q9UHD8|SEPT9_HUMAN 1 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.8503.9 119.7535 2 1048.534247 1046.524404 K V 446 455 PSM IQALQQQADEAEDR 4706 sp|P67936|TPM4_HUMAN 0 userFasta.sprot_human_mix_20181121 userFasta.sprot_human_mix_20181121 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.8504.10 119.7824 3 1616.756171 1613.764528 K A 14 28