MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	CRC_iTRAQ_JPST000203
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20190823\20190823183147065244^10.242.132.48^taba@jp\PeakList.PeakListMergePreMS2_CH_1\CRC_iTRAQ_01.CID.mqWzd.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20190823\20190823183147065244^10.242.132.48^taba@jp\Psearch.MaxQuantExec1\CRC_iTRAQ_01.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, ]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_mix_20181121
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C),iTRAQ4plex (K),iTRAQ4plex (N-term)
MTD	software[1]-setting	variableModifications=iTRAQ4plex (Y),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_mix_20181121
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C),iTRAQ4plex (K),iTRAQ4plex (N-term)
MTD	software[2]-setting	IT_MODS=Oxidation (M),iTRAQ4plex (Y)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=0.2
MTD	software[2]-setting	ITOLU=Daltons
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2015.02 rev. 0]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_mix_20181121
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C),iTRAQ4plex (K),iTRAQ4plex (N-term)
MTD	software[3]-setting	VarMod=iTRAQ4plex (Y),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	fixed_mod[2]	[UNIMOD, UNIMOD:214, iTRAQ4plex,]
MTD	fixed_mod[2]-site	K
MTD	fixed_mod[2]-position	Anywhere
MTD	fixed_mod[3]	[UNIMOD, UNIMOD:214, iTRAQ4plex,]
MTD	fixed_mod[3]-site	N-term
MTD	fixed_mod[3]-position	Any N-term
MTD	variable_mod[1]	[UNIMOD, UNIMOD:214, iTRAQ4plex,]
MTD	variable_mod[1]-site	Y
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[2]-site	M
MTD	variable_mod[2]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P31947-2|1433S_HUMAN	Isoform 2 of 14-3-3 protein sigma OS=Homo sapiens OX=9606 GN=SFN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	50.0	null	193-UNIMOD:214	0.12	50.0	1	1	0
PRT	sp|P01833|PIGR_HUMAN	Polymeric immunoglobulin receptor OS=Homo sapiens OX=9606 GN=PIGR PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	48.0	null	745-UNIMOD:214	0.03	48.0	3	1	0
PRT	sp|P63104-2|1433Z_HUMAN	Isoform 2 of 14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	48.0	null	148-UNIMOD:214	0.14	48.0	10	1	0
PRT	sp|P67809|YBOX1_HUMAN	Nuclease-sensitive element-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	47.0	null	305-UNIMOD:214	0.06	47.0	2	1	0
PRT	sp|P55735-2|SEC13_HUMAN	Isoform 2 of Protein SEC13 homolog OS=Homo sapiens OX=9606 GN=SEC13	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	46.0	null	292-UNIMOD:214	0.06	46.0	4	1	0
PRT	sp|Q31610|1B81_HUMAN	HLA class I histocompatibility antigen, B-81 alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	45.0	null	341-UNIMOD:214,349-UNIMOD:4	0.06	45.0	1	1	1
PRT	sp|Q95365|1B38_HUMAN	HLA class I histocompatibility antigen, B-38 alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	44.0	null	341-UNIMOD:214	0.06	44.0	2	1	0
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	43.0	null	223-UNIMOD:214,237-UNIMOD:4	0.10	43.0	3	1	0
PRT	sp|P49903-2|SPS1_HUMAN	Isoform 2 of Selenide, water dikinase 1 OS=Homo sapiens OX=9606 GN=SEPHS1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	43.0	null	301-UNIMOD:214	0.07	43.0	1	1	0
PRT	sp|Q8TAE8|G45IP_HUMAN	Growth arrest and DNA damage-inducible proteins-interacting protein 1 OS=Homo sapiens OX=9606 GN=GADD45GIP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	42.0	null	203-UNIMOD:214	0.09	42.0	2	1	0
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	42.0	null	228-UNIMOD:214	0.08	42.0	2	1	0
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41.0	null	228-UNIMOD:214	0.09	41.0	3	1	0
PRT	sp|P31946-2|1433B_HUMAN	Isoform Short of 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41.0	null	223-UNIMOD:214	0.09	41.0	4	1	0
PRT	sp|P19474-2|RO52_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase TRIM21 OS=Homo sapiens OX=9606 GN=TRIM21	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41.0	null	379-UNIMOD:214,386-UNIMOD:4	0.05	41.0	1	1	1
PRT	sp|O75122|CLAP2_HUMAN	CLIP-associating protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40.0	null	1277-UNIMOD:214	0.01	40.0	1	1	1
PRT	sp|P37108|SRP14_HUMAN	Signal recognition particle 14 kDa protein OS=Homo sapiens OX=9606 GN=SRP14 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null	108-UNIMOD:214	0.22	39.0	1	1	1
PRT	sp|P16989-2|YBOX3_HUMAN	Isoform 2 of Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null	285-UNIMOD:214	0.07	39.0	1	1	0
PRT	sp|P31947|1433S_HUMAN	14-3-3 protein sigma OS=Homo sapiens OX=9606 GN=SFN PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	39.0	null	225-UNIMOD:214	0.10	39.0	1	1	0
PRT	sp|P27816-4|MAP4_HUMAN	Isoform 4 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null	859-UNIMOD:214	0.02	38.0	2	1	0
PRT	sp|Q9UNF0|PACN2_HUMAN	Protein kinase C and casein kinase substrate in neurons protein 2 OS=Homo sapiens OX=9606 GN=PACSIN2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null	469-UNIMOD:214	0.04	38.0	1	1	1
PRT	sp|Q9UK59-2|DBR1_HUMAN	Isoform 2 of Lariat debranching enzyme OS=Homo sapiens OX=9606 GN=DBR1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null	297-UNIMOD:214	0.05	38.0	1	1	1
PRT	sp|Q7Z4W1|DCXR_HUMAN	L-xylulose reductase OS=Homo sapiens OX=9606 GN=DCXR PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null	227-UNIMOD:214,244-UNIMOD:4	0.08	38.0	2	1	0
PRT	sp|P35268|RL22_HUMAN	60S ribosomal protein L22 OS=Homo sapiens OX=9606 GN=RPL22 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	114-UNIMOD:214	0.13	38.0	3	1	0
PRT	sp|P21333|FLNA_HUMAN	Filamin-A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	38.0	null	937-UNIMOD:214	0.01	38.0	1	1	1
PRT	sp|O75436|VP26A_HUMAN	Vacuolar protein sorting-associated protein 26A OS=Homo sapiens OX=9606 GN=VPS26A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null	313-UNIMOD:214,327-UNIMOD:35	0.05	37.0	2	1	0
PRT	sp|P52888-2|THOP1_HUMAN	Isoform 2 of Thimet oligopeptidase OS=Homo sapiens OX=9606 GN=THOP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null	245-UNIMOD:214,251-UNIMOD:4,258-UNIMOD:4	0.06	37.0	1	1	1
PRT	sp|Q8TCS8|PNPT1_HUMAN	Polyribonucleotide nucleotidyltransferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PNPT1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	767-UNIMOD:214	0.02	37.0	3	1	0
PRT	sp|Q9Y342|PLLP_HUMAN	Plasmolipin OS=Homo sapiens OX=9606 GN=PLLP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	37.0	null	167-UNIMOD:214	0.09	37.0	1	1	1
PRT	sp|P35232|PHB_HUMAN	Prohibitin OS=Homo sapiens OX=9606 GN=PHB PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	37.0	null	256-UNIMOD:214	0.07	37.0	1	1	1
PRT	sp|Q96QK1|VPS35_HUMAN	Vacuolar protein sorting-associated protein 35 OS=Homo sapiens OX=9606 GN=VPS35 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	37.0	null	782-UNIMOD:214	0.02	37.0	5	1	0
PRT	sp|Q16666-3|IF16_HUMAN	Isoform 3 of Gamma-interferon-inducible protein 16 OS=Homo sapiens OX=9606 GN=IFI16	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	657-UNIMOD:214,665-UNIMOD:35	0.03	36.0	2	1	0
PRT	sp|Q9UHA3|RLP24_HUMAN	Probable ribosome biogenesis protein RLP24 OS=Homo sapiens OX=9606 GN=RSL24D1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	149-UNIMOD:214	0.10	36.0	1	1	1
PRT	sp|Q13765|NACA_HUMAN	Nascent polypeptide-associated complex subunit alpha OS=Homo sapiens OX=9606 GN=NACA PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	201-UNIMOD:214,211-UNIMOD:35,215-UNIMOD:35	0.07	36.0	5	1	0
PRT	sp|Q96AT1|K1143_HUMAN	Uncharacterized protein KIAA1143 OS=Homo sapiens OX=9606 GN=KIAA1143 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	141-UNIMOD:214	0.10	36.0	1	1	1
PRT	sp|P24386|RAE1_HUMAN	Rab proteins geranylgeranyltransferase component A 1 OS=Homo sapiens OX=9606 GN=CHM PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	641-UNIMOD:214	0.02	35.0	1	1	1
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	773-UNIMOD:214,714-UNIMOD:214	0.06	35.0	2	2	2
PRT	sp|P60228|EIF3E_HUMAN	Eukaryotic translation initiation factor 3 subunit E OS=Homo sapiens OX=9606 GN=EIF3E PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	432-UNIMOD:214	0.03	35.0	1	1	1
PRT	sp|Q8NC51-4|PAIRB_HUMAN	Isoform 4 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	370-UNIMOD:214	0.05	35.0	2	1	0
PRT	sp|Q9Y248|PSF2_HUMAN	DNA replication complex GINS protein PSF2 OS=Homo sapiens OX=9606 GN=GINS2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	172-UNIMOD:214	0.08	35.0	2	1	0
PRT	sp|P43378|PTN9_HUMAN	Tyrosine-protein phosphatase non-receptor type 9 OS=Homo sapiens OX=9606 GN=PTPN9 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35.0	null	578-UNIMOD:214	0.03	35.0	1	1	1
PRT	sp|Q92616|GCN1_HUMAN	eIF-2-alpha kinase activator GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35.0	null	2655-UNIMOD:214	0.01	35.0	2	1	0
PRT	sp|Q9NVZ3|NECP2_HUMAN	Adaptin ear-binding coat-associated protein 2 OS=Homo sapiens OX=9606 GN=NECAP2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35.0	null	246-UNIMOD:214	0.07	35.0	1	1	1
PRT	sp|Q8NCG7-2|DGLB_HUMAN	Isoform 2 of Sn1-specific diacylglycerol lipase beta OS=Homo sapiens OX=9606 GN=DAGLB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	375-UNIMOD:214,377-UNIMOD:4,380-UNIMOD:4	0.05	34.0	1	1	1
PRT	sp|Q9UQR1-2|ZN148_HUMAN	Isoform 2 of Zinc finger protein 148 OS=Homo sapiens OX=9606 GN=ZNF148	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	116-UNIMOD:214	0.13	34.0	1	1	1
PRT	sp|Q9HC35-2|EMAL4_HUMAN	Isoform 2 of Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	910-UNIMOD:214	0.02	34.0	2	1	0
PRT	sp|Q9BYX2-6|TBD2A_HUMAN	Isoform 6 of TBC1 domain family member 2A OS=Homo sapiens OX=9606 GN=TBC1D2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	453-UNIMOD:214,458-UNIMOD:4	0.04	34.0	1	1	1
PRT	sp|P27816-5|MAP4_HUMAN	Isoform 5 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	797-UNIMOD:214	0.02	34.0	1	1	1
PRT	sp|Q99611|SPS2_HUMAN	Selenide, water dikinase 2 OS=Homo sapiens OX=9606 GN=SEPHS2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	429-UNIMOD:214	0.05	34.0	1	1	1
PRT	sp|Q99460-2|PSMD1_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	904-UNIMOD:214	0.02	34.0	1	1	1
PRT	sp|Q15388|TOM20_HUMAN	Mitochondrial import receptor subunit TOM20 homolog OS=Homo sapiens OX=9606 GN=TOMM20 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	133-UNIMOD:214	0.10	34.0	3	1	0
PRT	sp|Q9UBG0|MRC2_HUMAN	C-type mannose receptor 2 OS=Homo sapiens OX=9606 GN=MRC2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	1466-UNIMOD:214	0.01	34.0	2	1	0
PRT	sp|Q14847-3|LASP1_HUMAN	Isoform 3 of LIM and SH3 domain protein 1 OS=Homo sapiens OX=9606 GN=LASP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	191-UNIMOD:214,196-UNIMOD:35	0.08	34.0	7	1	0
PRT	sp|O15120-2|PLCB_HUMAN	Isoform 2 of 1-acyl-sn-glycerol-3-phosphate acyltransferase beta OS=Homo sapiens OX=9606 GN=AGPAT2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	230-UNIMOD:214	0.07	34.0	1	1	1
PRT	sp|P49903|SPS1_HUMAN	Selenide, water dikinase 1 OS=Homo sapiens OX=9606 GN=SEPHS1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	34.0	null	372-UNIMOD:214	0.06	34.0	1	1	0
PRT	sp|Q92882|OSTF1_HUMAN	Osteoclast-stimulating factor 1 OS=Homo sapiens OX=9606 GN=OSTF1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	34.0	null	200-UNIMOD:214	0.07	34.0	1	1	1
PRT	sp|O15127|SCAM2_HUMAN	Secretory carrier-associated membrane protein 2 OS=Homo sapiens OX=9606 GN=SCAMP2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	317-UNIMOD:214	0.04	33.0	1	1	1
PRT	sp|P28331-3|NDUS1_HUMAN	Isoform 3 of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	602-UNIMOD:214,616-UNIMOD:4	0.03	33.0	2	1	0
PRT	sp|P11215|ITAM_HUMAN	Integrin alpha-M OS=Homo sapiens OX=9606 GN=ITGAM PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	1139-UNIMOD:214	0.01	33.0	1	1	1
PRT	sp|Q5JTD0-4|TJAP1_HUMAN	Isoform 4 of Tight junction-associated protein 1 OS=Homo sapiens OX=9606 GN=TJAP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	469-UNIMOD:214	0.03	33.0	1	1	1
PRT	sp|Q8N983-4|RM43_HUMAN	Isoform 4 of 39S ribosomal protein L43, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL43	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	147-UNIMOD:214	0.09	33.0	1	1	1
PRT	sp|P49841|GSK3B_HUMAN	Glycogen synthase kinase-3 beta OS=Homo sapiens OX=9606 GN=GSK3B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	406-UNIMOD:214	0.04	33.0	1	1	1
PRT	sp|Q5H9R7-4|PP6R3_HUMAN	Isoform 4 of Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	778-UNIMOD:214	0.02	33.0	1	1	1
PRT	sp|P55884|EIF3B_HUMAN	Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	33.0	null	387-UNIMOD:214	0.02	33.0	1	1	1
PRT	sp|Q8N490-2|PNKD_HUMAN	Isoform 2 of Probable hydrolase PNKD OS=Homo sapiens OX=9606 GN=PNKD	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	126-UNIMOD:214	0.13	32.0	1	1	1
PRT	sp|P46781|RS9_HUMAN	40S ribosomal protein S9 OS=Homo sapiens OX=9606 GN=RPS9 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	181-UNIMOD:214	0.08	32.0	1	1	1
PRT	sp|P01591|IGJ_HUMAN	Immunoglobulin J chain OS=Homo sapiens OX=9606 GN=JCHAIN PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	146-UNIMOD:214,156-UNIMOD:4,146-UNIMOD:35	0.09	32.0	4	1	0
PRT	sp|Q9Y676|RT18B_HUMAN	28S ribosomal protein S18b, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS18B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	242-UNIMOD:214	0.07	32.0	2	1	0
PRT	sp|Q15149-7|PLEC_HUMAN	Isoform 7 of Plectin OS=Homo sapiens OX=9606 GN=PLEC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	4499-UNIMOD:214	0.00	32.0	1	1	1
PRT	sp|Q03518|TAP1_HUMAN	Antigen peptide transporter 1 OS=Homo sapiens OX=9606 GN=TAP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32.0	null	794-UNIMOD:214,795-UNIMOD:4	0.02	32.0	1	1	1
PRT	sp|P49189|AL9A1_HUMAN	4-trimethylaminobutyraldehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH9A1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32.0	null	482-UNIMOD:214,484-UNIMOD:4	0.03	32.0	1	1	0
PRT	sp|Q7Z417|NUFP2_HUMAN	Nuclear fragile X mental retardation-interacting protein 2 OS=Homo sapiens OX=9606 GN=NUFIP2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32.0	null	683-UNIMOD:214	0.02	32.0	1	1	1
PRT	sp|P61619|S61A1_HUMAN	Protein transport protein Sec61 subunit alpha isoform 1 OS=Homo sapiens OX=9606 GN=SEC61A1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32.0	null	464-UNIMOD:214	0.03	32.0	3	1	0
PRT	sp|P41252|SYIC_HUMAN	Isoleucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=IARS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	32.0	null	1250-UNIMOD:214	0.01	32.0	3	1	0
PRT	sp|P49585|PCY1A_HUMAN	Choline-phosphate cytidylyltransferase A OS=Homo sapiens OX=9606 GN=PCYT1A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	356-UNIMOD:214	0.04	31.0	1	1	1
PRT	sp|Q16658|FSCN1_HUMAN	Fascin OS=Homo sapiens OX=9606 GN=FSCN1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	480-UNIMOD:214	0.03	31.0	3	1	0
PRT	sp|Q5TBC7|B2L15_HUMAN	Bcl-2-like protein 15 OS=Homo sapiens OX=9606 GN=BCL2L15 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	150-UNIMOD:214	0.09	31.0	1	1	1
PRT	sp|Q8WWM9|CYGB_HUMAN	Cytoglobin OS=Homo sapiens OX=9606 GN=CYGB PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	168-UNIMOD:214	0.13	31.0	1	1	1
PRT	sp|Q15654|TRIP6_HUMAN	Thyroid receptor-interacting protein 6 OS=Homo sapiens OX=9606 GN=TRIP6 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	465-UNIMOD:214,476-UNIMOD:4	0.03	31.0	1	1	1
PRT	sp|Q9UIA9|XPO7_HUMAN	Exportin-7 OS=Homo sapiens OX=9606 GN=XPO7 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	1075-UNIMOD:214	0.01	31.0	1	1	1
PRT	sp|Q86W92-3|LIPB1_HUMAN	Isoform 3 of Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	846-UNIMOD:214	0.02	31.0	1	1	1
PRT	sp|P52815|RM12_HUMAN	39S ribosomal protein L12, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL12 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31.0	null	186-UNIMOD:214	0.07	31.0	1	1	1
PRT	sp|Q9Y2G3|AT11B_HUMAN	Probable phospholipid-transporting ATPase IF OS=Homo sapiens OX=9606 GN=ATP11B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31.0	null	1165-UNIMOD:214,1177-UNIMOD:4	0.01	31.0	1	1	1
PRT	sp|P08779|K1C16_HUMAN	Keratin, type I cytoskeletal 16 OS=Homo sapiens OX=9606 GN=KRT16 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	461-UNIMOD:214	0.03	30.0	1	1	1
PRT	sp|O75688-2|PPM1B_HUMAN	Isoform Beta-2 of Protein phosphatase 1B OS=Homo sapiens OX=9606 GN=PPM1B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	375-UNIMOD:214	0.04	30.0	1	1	1
PRT	sp|Q12893|TM115_HUMAN	Transmembrane protein 115 OS=Homo sapiens OX=9606 GN=TMEM115 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	334-UNIMOD:214	0.05	30.0	1	1	1
PRT	sp|Q9Y365|STA10_HUMAN	START domain-containing protein 10 OS=Homo sapiens OX=9606 GN=STARD10 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	276-UNIMOD:214	0.06	30.0	1	1	1
PRT	sp|P09668|CATH_HUMAN	Pro-cathepsin H OS=Homo sapiens OX=9606 GN=CTSH PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	320-UNIMOD:214,322-UNIMOD:4,327-UNIMOD:4	0.05	30.0	2	1	0
PRT	sp|Q13505-3|MTX1_HUMAN	Isoform 3 of Metaxin-1 OS=Homo sapiens OX=9606 GN=MTX1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	307-UNIMOD:214	0.04	30.0	1	1	1
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	30.0	null	2-UNIMOD:214,17-UNIMOD:4,18-UNIMOD:214	0.05	30.0	1	1	1
PRT	sp|Q96T23|RSF1_HUMAN	Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30.0	null	1428-UNIMOD:214,1436-UNIMOD:4	0.01	30.0	1	1	1
PRT	sp|Q9H0E2-2|TOLIP_HUMAN	Isoform 2 of Toll-interacting protein OS=Homo sapiens OX=9606 GN=TOLLIP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	192-UNIMOD:214	0.07	29.0	1	1	0
PRT	sp|P62081|RS7_HUMAN	40S ribosomal protein S7 OS=Homo sapiens OX=9606 GN=RPS7 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	184-UNIMOD:214	0.06	29.0	6	1	0
PRT	sp|P62304|RUXE_HUMAN	Small nuclear ribonucleoprotein E OS=Homo sapiens OX=9606 GN=SNRPE PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	81-UNIMOD:214	0.14	29.0	3	1	0
PRT	sp|Q96FZ5-2|CKLF7_HUMAN	Isoform 2 of CKLF-like MARVEL transmembrane domain-containing protein 7 OS=Homo sapiens OX=9606 GN=CMTM7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	131-UNIMOD:214,133-UNIMOD:4	0.09	29.0	1	1	1
PRT	sp|Q15366-7|PCBP2_HUMAN	Isoform 7 of Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	308-UNIMOD:214,315-UNIMOD:35	0.04	29.0	2	1	0
PRT	sp|O94818-2|NOL4_HUMAN	Isoform 2 of Nucleolar protein 4 OS=Homo sapiens OX=9606 GN=NOL4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	524-UNIMOD:214	0.03	29.0	1	1	1
PRT	sp|O00178|GTPB1_HUMAN	GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=GTPBP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	658-UNIMOD:214,662-UNIMOD:4,669-UNIMOD:4	0.02	29.0	1	1	1
PRT	sp|P49914-2|MTHFS_HUMAN	Isoform 2 of 5-formyltetrahydrofolate cyclo-ligase OS=Homo sapiens OX=9606 GN=MTHFS	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	168-UNIMOD:214	0.07	29.0	1	1	1
PRT	sp|O15160|RPAC1_HUMAN	DNA-directed RNA polymerases I and III subunit RPAC1 OS=Homo sapiens OX=9606 GN=POLR1C PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29.0	null	336-UNIMOD:214,345-UNIMOD:35	0.03	29.0	1	1	1
PRT	sp|Q9HBB8|CDHR5_HUMAN	Cadherin-related family member 5 OS=Homo sapiens OX=9606 GN=CDHR5 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29.0	null	831-UNIMOD:214	0.02	29.0	1	1	1
PRT	sp|P06753-2|TPM3_HUMAN	Isoform 2 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29.0	null	237-UNIMOD:214	0.05	29.0	1	1	1
PRT	sp|Q9NQP4|PFD4_HUMAN	Prefoldin subunit 4 OS=Homo sapiens OX=9606 GN=PFDN4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29.0	null	123-UNIMOD:214	0.10	29.0	1	1	1
PRT	sp|Q9NPY3|C1QR1_HUMAN	Complement component C1q receptor OS=Homo sapiens OX=9606 GN=CD93 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	639-UNIMOD:214,652-UNIMOD:4	0.02	28.0	1	1	1
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	223-UNIMOD:214	0.05	28.0	1	1	1
PRT	sp|P36542-2|ATPG_HUMAN	Isoform Heart of ATP synthase subunit gamma, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	286-UNIMOD:214	0.04	28.0	1	1	1
PRT	sp|P46778|RL21_HUMAN	60S ribosomal protein L21 OS=Homo sapiens OX=9606 GN=RPL21 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	147-UNIMOD:214,159-UNIMOD:35	0.09	28.0	2	1	0
PRT	sp|P0DMV8-2|HS71A_HUMAN	Isoform 2 of Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	574-UNIMOD:214	0.02	28.0	2	1	0
PRT	sp|Q6Y7W6-4|GGYF2_HUMAN	Isoform 3 of GRB10-interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	1275-UNIMOD:214	0.01	28.0	1	1	1
PRT	sp|O60341|KDM1A_HUMAN	Lysine-specific histone demethylase 1A OS=Homo sapiens OX=9606 GN=KDM1A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	839-UNIMOD:214,852-UNIMOD:35	0.02	28.0	2	1	0
PRT	sp|Q96DZ9-4|CKLF5_HUMAN	Isoform 4 of CKLF-like MARVEL transmembrane domain-containing protein 5 OS=Homo sapiens OX=9606 GN=CMTM5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	62-UNIMOD:214,64-UNIMOD:35	0.19	28.0	2	1	0
PRT	sp|P49189-2|AL9A1_HUMAN	Isoform 2 of 4-trimethylaminobutyraldehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH9A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	412-UNIMOD:214,414-UNIMOD:4,417-UNIMOD:35	0.03	28.0	1	1	0
PRT	sp|Q9P2T1-3|GMPR2_HUMAN	Isoform 3 of GMP reductase 2 OS=Homo sapiens OX=9606 GN=GMPR2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	308-UNIMOD:214,320-UNIMOD:4	0.04	28.0	1	1	1
PRT	sp|Q9Y5S2|MRCKB_HUMAN	Serine/threonine-protein kinase MRCK beta OS=Homo sapiens OX=9606 GN=CDC42BPB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null	1697-UNIMOD:214,1709-UNIMOD:4	0.01	28.0	1	1	1
PRT	sp|Q9NZZ3|CHMP5_HUMAN	Charged multivesicular body protein 5 OS=Homo sapiens OX=9606 GN=CHMP5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null	204-UNIMOD:214	0.08	28.0	1	1	1
PRT	sp|Q8TF05|PP4R1_HUMAN	Serine/threonine-protein phosphatase 4 regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PPP4R1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null	938-UNIMOD:214	0.01	28.0	1	1	1
PRT	sp|P48729-3|KC1A_HUMAN	Isoform 3 of Casein kinase I isoform alpha OS=Homo sapiens OX=9606 GN=CSNK1A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	305-UNIMOD:214	0.07	27.0	1	1	1
PRT	sp|P11940-2|PABP1_HUMAN	Isoform 2 of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	537-UNIMOD:214	0.02	27.0	1	1	1
PRT	sp|P61619-3|S61A1_HUMAN	Isoform 3 of Protein transport protein Sec61 subunit alpha isoform 1 OS=Homo sapiens OX=9606 GN=SEC61A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	344-UNIMOD:214,351-UNIMOD:35	0.04	27.0	2	1	0
PRT	sp|P43897|EFTS_HUMAN	Elongation factor Ts, mitochondrial OS=Homo sapiens OX=9606 GN=TSFM PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	313-UNIMOD:214,315-UNIMOD:4	0.04	27.0	1	1	1
PRT	sp|Q96HL8-4|SH3Y1_HUMAN	Isoform 4 of SH3 domain-containing YSC84-like protein 1 OS=Homo sapiens OX=9606 GN=SH3YL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	214-UNIMOD:214	0.07	27.0	1	1	1
PRT	sp|Q9UBX1|CATF_HUMAN	Cathepsin F OS=Homo sapiens OX=9606 GN=CTSF PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	468-UNIMOD:214,472-UNIMOD:4	0.04	27.0	1	1	1
PRT	sp|P62805|H4_HUMAN	Histone H4 OS=Homo sapiens OX=9606 GN=HIST1H4A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	47-UNIMOD:214	0.11	27.0	1	1	1
PRT	sp|P38432|COIL_HUMAN	Coilin OS=Homo sapiens OX=9606 GN=COIL PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	562-UNIMOD:214	0.03	27.0	1	1	1
PRT	sp|Q14155-1|ARHG7_HUMAN	Isoform 1 of Rho guanine nucleotide exchange factor 7 OS=Homo sapiens OX=9606 GN=ARHGEF7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	635-UNIMOD:214	0.02	27.0	1	1	1
PRT	sp|Q5JPI3-2|CC038_HUMAN	Isoform 2 of Uncharacterized protein C3orf38 OS=Homo sapiens OX=9606 GN=C3orf38	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	317-UNIMOD:214	0.04	27.0	1	1	1
PRT	sp|Q8N8V4|ANS4B_HUMAN	Ankyrin repeat and SAM domain-containing protein 4B OS=Homo sapiens OX=9606 GN=ANKS4B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	404-UNIMOD:214	0.04	27.0	1	1	1
PRT	sp|Q96FV9|THOC1_HUMAN	THO complex subunit 1 OS=Homo sapiens OX=9606 GN=THOC1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	640-UNIMOD:214	0.03	27.0	1	1	1
PRT	sp|Q02388-2|CO7A1_HUMAN	Isoform 2 of Collagen alpha-1(VII) chain OS=Homo sapiens OX=9606 GN=COL7A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	2901-UNIMOD:214	0.00	27.0	1	1	1
PRT	sp|P05783|K1C18_HUMAN	Keratin, type I cytoskeletal 18 OS=Homo sapiens OX=9606 GN=KRT18 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null	302-UNIMOD:214	0.03	27.0	2	1	0
PRT	sp|Q969K7|TMM54_HUMAN	Transmembrane protein 54 OS=Homo sapiens OX=9606 GN=TMEM54 PE=2 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null	210-UNIMOD:214,214-UNIMOD:4	0.06	27.0	1	1	1
PRT	sp|P36542|ATPG_HUMAN	ATP synthase subunit gamma, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1C PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null	286-UNIMOD:214	0.05	27.0	2	1	0
PRT	sp|Q15811-2|ITSN1_HUMAN	Isoform 2 of Intersectin-1 OS=Homo sapiens OX=9606 GN=ITSN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null	1211-UNIMOD:214	0.01	27.0	1	1	1
PRT	sp|P15941|MUC1_HUMAN	Mucin-1 OS=Homo sapiens OX=9606 GN=MUC1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null	1232-UNIMOD:214	0.02	27.0	2	1	0
PRT	sp|P61247|RS3A_HUMAN	40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	253-UNIMOD:214	0.05	26.0	1	1	1
PRT	sp|P19957|ELAF_HUMAN	Elafin OS=Homo sapiens OX=9606 GN=PI3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	104-UNIMOD:214,104-UNIMOD:4,105-UNIMOD:4,109-UNIMOD:4,113-UNIMOD:4	0.13	26.0	1	1	1
PRT	sp|Q9NQH7-2|XPP3_HUMAN	Isoform 2 of Xaa-Pro aminopeptidase 3 OS=Homo sapiens OX=9606 GN=XPNPEP3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	416-UNIMOD:214,424-UNIMOD:4	0.03	26.0	1	1	1
PRT	sp|Q9GZR7-2|DDX24_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX24 OS=Homo sapiens OX=9606 GN=DDX24	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	791-UNIMOD:214	0.02	26.0	1	1	1
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	50-UNIMOD:214,330-UNIMOD:214,335-UNIMOD:4	0.08	26.0	2	2	2
PRT	sp|P62937-2|PPIA_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	96-UNIMOD:214,101-UNIMOD:4	0.10	26.0	3	1	0
PRT	sp|Q6IC98-2|GRAM4_HUMAN	Isoform 2 of GRAM domain-containing protein 4 OS=Homo sapiens OX=9606 GN=GRAMD4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	91-UNIMOD:214	0.12	26.0	1	1	1
PRT	sp|P22223|CADH3_HUMAN	Cadherin-3 OS=Homo sapiens OX=9606 GN=CDH3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	819-UNIMOD:214	0.01	26.0	2	1	0
PRT	sp|Q96B49|TOM6_HUMAN	Mitochondrial import receptor subunit TOM6 homolog OS=Homo sapiens OX=9606 GN=TOMM6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	61-UNIMOD:214,68-UNIMOD:35	0.20	26.0	2	1	0
PRT	sp|P50336|PPOX_HUMAN	Protoporphyrinogen oxidase OS=Homo sapiens OX=9606 GN=PPOX PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	465-UNIMOD:214	0.03	26.0	1	1	1
PRT	sp|O43765|SGTA_HUMAN	Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Homo sapiens OX=9606 GN=SGTA PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	303-UNIMOD:214	0.04	26.0	1	1	1
PRT	sp|O00463-3|TRAF5_HUMAN	Isoform 3 of TNF receptor-associated factor 5 OS=Homo sapiens OX=9606 GN=TRAF5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	441-UNIMOD:214	0.03	26.0	1	1	1
PRT	sp|P35228-2|NOS2_HUMAN	Isoform 2 of Nitric oxide synthase, inducible OS=Homo sapiens OX=9606 GN=NOS2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	1102-UNIMOD:214	0.01	26.0	1	1	1
PRT	sp|Q9NR50|EI2BG_HUMAN	Translation initiation factor eIF-2B subunit gamma OS=Homo sapiens OX=9606 GN=EIF2B3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	439-UNIMOD:214	0.03	26.0	1	1	1
PRT	sp|Q13228-2|SBP1_HUMAN	Isoform 2 of Methanethiol oxidase OS=Homo sapiens OX=9606 GN=SELENBP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	397-UNIMOD:214,402-UNIMOD:4	0.03	26.0	2	1	0
PRT	sp|Q15542|TAF5_HUMAN	Transcription initiation factor TFIID subunit 5 OS=Homo sapiens OX=9606 GN=TAF5 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null	789-UNIMOD:214	0.02	26.0	1	1	1
PRT	sp|P16989|YBOX3_HUMAN	Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null	354-UNIMOD:214	0.05	26.0	1	1	0
PRT	sp|P00403|COX2_HUMAN	Cytochrome c oxidase subunit 2 OS=Homo sapiens OX=9606 GN=MT-CO2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26.0	null	83-UNIMOD:214	0.05	26.0	1	1	1
PRT	sp|P05452|TETN_HUMAN	Tetranectin OS=Homo sapiens OX=9606 GN=CLEC3B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null	191-UNIMOD:214,197-UNIMOD:4	0.06	26.0	1	1	1
PRT	sp|Q8N2Z9|CENPS_HUMAN	Centromere protein S OS=Homo sapiens OX=9606 GN=CENPS PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null	127-UNIMOD:214	0.09	26.0	1	1	1
PRT	sp|Q9NYY8|FAKD2_HUMAN	FAST kinase domain-containing protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=FASTKD2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null	693-UNIMOD:214	0.03	26.0	1	1	1
PRT	sp|Q6MZQ0|PRR5L_HUMAN	Proline-rich protein 5-like OS=Homo sapiens OX=9606 GN=PRR5L PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null	355-UNIMOD:214,364-UNIMOD:4	0.04	26.0	1	1	1
PRT	sp|Q14738-3|2A5D_HUMAN	Isoform Delta-3 of Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform OS=Homo sapiens OX=9606 GN=PPP2R5D	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	485-UNIMOD:214	0.03	25.0	1	1	1
PRT	sp|Q9Y2Q5|LTOR2_HUMAN	Ragulator complex protein LAMTOR2 OS=Homo sapiens OX=9606 GN=LAMTOR2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	108-UNIMOD:214	0.15	25.0	1	1	1
PRT	sp|Q9NZD8-2|SPG21_HUMAN	Isoform 2 of Maspardin OS=Homo sapiens OX=9606 GN=SPG21	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	272-UNIMOD:214	0.04	25.0	1	1	1
PRT	sp|P04626-3|ERBB2_HUMAN	Isoform 3 of Receptor tyrosine-protein kinase erbB-2 OS=Homo sapiens OX=9606 GN=ERBB2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	553-UNIMOD:214	0.03	25.0	1	1	1
PRT	sp|O60506-5|HNRPQ_HUMAN	Isoform 5 of Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	401-UNIMOD:214	0.03	25.0	1	1	1
PRT	sp|Q4VC05|BCL7A_HUMAN	B-cell CLL/lymphoma 7 protein family member A OS=Homo sapiens OX=9606 GN=BCL7A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	200-UNIMOD:214	0.06	25.0	1	1	1
PRT	sp|Q9Y6X5|ENPP4_HUMAN	Bis(5'-adenosyl)-triphosphatase ENPP4 OS=Homo sapiens OX=9606 GN=ENPP4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	441-UNIMOD:214	0.03	25.0	1	1	1
PRT	sp|P62899|RL31_HUMAN	60S ribosomal protein L31 OS=Homo sapiens OX=9606 GN=RPL31 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	116-UNIMOD:214	0.09	25.0	1	1	1
PRT	sp|P36915-2|GNL1_HUMAN	Isoform 2 of Guanine nucleotide-binding protein-like 1 OS=Homo sapiens OX=9606 GN=GNL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	420-UNIMOD:214,430-UNIMOD:4	0.03	25.0	1	1	1
PRT	sp|Q99598|TSNAX_HUMAN	Translin-associated protein X OS=Homo sapiens OX=9606 GN=TSNAX PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	280-UNIMOD:214	0.04	25.0	1	1	1
PRT	sp|Q96DC7|TMCO6_HUMAN	Transmembrane and coiled-coil domain-containing protein 6 OS=Homo sapiens OX=9606 GN=TMCO6 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	483-UNIMOD:214	0.02	25.0	1	1	1
PRT	sp|P49720|PSB3_HUMAN	Proteasome subunit beta type-3 OS=Homo sapiens OX=9606 GN=PSMB3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25.0	null	100-UNIMOD:214	0.07	25.0	1	1	1
PRT	sp|Q13426|XRCC4_HUMAN	DNA repair protein XRCC4 OS=Homo sapiens OX=9606 GN=XRCC4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	326-UNIMOD:214	0.04	25.0	1	1	1
PRT	sp|P29323-2|EPHB2_HUMAN	Isoform 2 of Ephrin type-B receptor 2 OS=Homo sapiens OX=9606 GN=EPHB2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	976-UNIMOD:214	0.01	24.0	1	1	1
PRT	sp|Q3KQU3-3|MA7D1_HUMAN	Isoform 3 of MAP7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAP7D1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	366-UNIMOD:214	0.03	24.0	1	1	1
PRT	sp|Q5SW79-2|CE170_HUMAN	Isoform 2 of Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	1447-UNIMOD:214	0.01	24.0	1	1	1
PRT	sp|Q8N488|RYBP_HUMAN	RING1 and YY1-binding protein OS=Homo sapiens OX=9606 GN=RYBP PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	218-UNIMOD:214	0.05	24.0	1	1	1
PRT	sp|P50895|BCAM_HUMAN	Basal cell adhesion molecule OS=Homo sapiens OX=9606 GN=BCAM PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	619-UNIMOD:214,628-UNIMOD:4	0.02	24.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	197-UNIMOD:214	0.03	24.0	2	1	0
PRT	sp|P30405|PPIF_HUMAN	Peptidyl-prolyl cis-trans isomerase F, mitochondrial OS=Homo sapiens OX=9606 GN=PPIF PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	198-UNIMOD:214,203-UNIMOD:4	0.05	24.0	1	1	1
PRT	sp|Q07507|DERM_HUMAN	Dermatopontin OS=Homo sapiens OX=9606 GN=DPT PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	191-UNIMOD:214,191-UNIMOD:35,196-UNIMOD:4	0.06	24.0	2	1	0
PRT	sp|O60337-6|MARH6_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase MARCH6 OS=Homo sapiens OX=9606 GN=MARCH6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	793-UNIMOD:214	0.02	24.0	1	1	1
PRT	sp|Q32P44|EMAL3_HUMAN	Echinoderm microtubule-associated protein-like 3 OS=Homo sapiens OX=9606 GN=EML3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	885-UNIMOD:214	0.01	24.0	1	1	1
PRT	sp|Q14683|SMC1A_HUMAN	Structural maintenance of chromosomes protein 1A OS=Homo sapiens OX=9606 GN=SMC1A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	1223-UNIMOD:214	0.01	24.0	1	1	1
PRT	sp|Q9H0E2|TOLIP_HUMAN	Toll-interacting protein OS=Homo sapiens OX=9606 GN=TOLLIP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	261-UNIMOD:214	0.05	24.0	1	1	0
PRT	sp|O95182|NDUA7_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 OS=Homo sapiens OX=9606 GN=NDUFA7 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	104-UNIMOD:214	0.10	24.0	1	1	1
PRT	sp|P46782|RS5_HUMAN	40S ribosomal protein S5 OS=Homo sapiens OX=9606 GN=RPS5 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24.0	null	3-UNIMOD:214,18-UNIMOD:214	0.08	24.0	1	1	1
PRT	sp|P0C0L4|CO4A_HUMAN	Complement C4-A OS=Homo sapiens OX=9606 GN=C4A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	1725-UNIMOD:214,1727-UNIMOD:4,1742-UNIMOD:4	0.01	24.0	1	1	1
PRT	sp|Q14847|LASP1_HUMAN	LIM and SH3 domain protein 1 OS=Homo sapiens OX=9606 GN=LASP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	247-UNIMOD:214	0.06	24.0	2	1	0
PRT	sp|Q13541|4EBP1_HUMAN	Eukaryotic translation initiation factor 4E-binding protein 1 OS=Homo sapiens OX=9606 GN=EIF4EBP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	107-UNIMOD:214	0.11	23.0	1	1	1
PRT	sp|A6NK58|LIPT2_HUMAN	Putative lipoyltransferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=LIPT2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	222-UNIMOD:214,222-UNIMOD:4	0.05	23.0	1	1	1
PRT	sp|O94804|STK10_HUMAN	Serine/threonine-protein kinase 10 OS=Homo sapiens OX=9606 GN=STK10 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	959-UNIMOD:214	0.01	23.0	1	1	1
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	77-UNIMOD:214	0.12	23.0	1	1	1
PRT	sp|Q9ULJ8-2|NEB1_HUMAN	Isoform 2 of Neurabin-1 OS=Homo sapiens OX=9606 GN=PPP1R9A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	376-UNIMOD:214	0.03	23.0	1	1	1
PRT	sp|Q9Y2R5|RT17_HUMAN	28S ribosomal protein S17, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS17 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	120-UNIMOD:214	0.09	23.0	1	1	1
PRT	sp|Q14145|KEAP1_HUMAN	Kelch-like ECH-associated protein 1 OS=Homo sapiens OX=9606 GN=KEAP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	616-UNIMOD:214,622-UNIMOD:4,624-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|P57739|CLD2_HUMAN	Claudin-2 OS=Homo sapiens OX=9606 GN=CLDN2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	219-UNIMOD:214	0.06	23.0	1	1	1
PRT	sp|Q2NL82|TSR1_HUMAN	Pre-rRNA-processing protein TSR1 homolog OS=Homo sapiens OX=9606 GN=TSR1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	792-UNIMOD:214	0.02	23.0	1	1	1
PRT	sp|Q02790|FKBP4_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	446-UNIMOD:214	0.03	23.0	1	1	1
PRT	sp|P61966|AP1S1_HUMAN	AP-1 complex subunit sigma-1A OS=Homo sapiens OX=9606 GN=AP1S1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	150-UNIMOD:214	0.06	23.0	1	1	1
PRT	sp|P61086-2|UBE2K_HUMAN	Isoform 2 of Ubiquitin-conjugating enzyme E2 K OS=Homo sapiens OX=9606 GN=UBE2K	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	136-UNIMOD:214	0.10	23.0	1	1	1
PRT	sp|Q9H098-2|F107B_HUMAN	Isoform 2 of Protein FAM107B OS=Homo sapiens OX=9606 GN=FAM107B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	296-UNIMOD:214	0.04	23.0	1	1	1
PRT	sp|P49447|CY561_HUMAN	Cytochrome b561 OS=Homo sapiens OX=9606 GN=CYB561 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	241-UNIMOD:214	0.05	23.0	1	1	1
PRT	sp|Q9Y6Q1|CAN6_HUMAN	Calpain-6 OS=Homo sapiens OX=9606 GN=CAPN6 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	632-UNIMOD:214	0.02	23.0	1	1	1
PRT	sp|Q9H993|ARMT1_HUMAN	Protein-glutamate O-methyltransferase OS=Homo sapiens OX=9606 GN=ARMT1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	432-UNIMOD:214	0.02	23.0	1	1	1
PRT	sp|P00395|COX1_HUMAN	Cytochrome c oxidase subunit 1 OS=Homo sapiens OX=9606 GN=MT-CO1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23.0	null	214-UNIMOD:214	0.03	23.0	1	1	1
PRT	sp|Q96GX9|MTNB_HUMAN	Methylthioribulose-1-phosphate dehydratase OS=Homo sapiens OX=9606 GN=APIP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	227-UNIMOD:214	0.07	23.0	1	1	1
PRT	sp|P26045|PTN3_HUMAN	Tyrosine-protein phosphatase non-receptor type 3 OS=Homo sapiens OX=9606 GN=PTPN3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	901-UNIMOD:214	0.02	23.0	1	1	1
PRT	sp|Q8NHQ9|DDX55_HUMAN	ATP-dependent RNA helicase DDX55 OS=Homo sapiens OX=9606 GN=DDX55 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	588-UNIMOD:214,600-UNIMOD:4	0.02	23.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	DNLTLWTADNAGEEGGEAPQEPQS	1	sp|P31947-2|1433S_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	50	1-UNIMOD:214	ms_run[2]:scan=18276	85.063	2	2672.196	2672.1960	R	-	193	217
PSM	DFLLQSSTVAAEAQDGPQEA	2	sp|P01833|PIGR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	48	1-UNIMOD:214	ms_run[2]:scan=19905	92.249	2	2220.0668	2220.0668	K	-	745	765
PSM	DNLTLWTSDTQGDEAEAGEGGEN	3	sp|P63104-2|1433Z_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	48	1-UNIMOD:214	ms_run[2]:scan=18003	83.878	2	2552.0908	2552.0908	R	-	148	171
PSM	AADPPAENSSAPEAEQGGAE	4	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	47	1-UNIMOD:214	ms_run[2]:scan=4586	27.785	2	2040.8994	2040.8994	K	-	305	325
PSM	GQGSVSASVTEGQQNEQ	5	sp|P55735-2|SEC13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	46	1-UNIMOD:214	ms_run[2]:scan=4453	27.176	2	1848.8571	1848.8571	K	-	292	309
PSM	AADPPAENSSAPEAEQGGAE	6	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	45	1-UNIMOD:214	ms_run[2]:scan=4840	28.91	2	2040.8994	2040.8994	K	-	305	325
PSM	DNLTLWTSDTQGDEAEAGEGGEN	7	sp|P63104-2|1433Z_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	45	1-UNIMOD:214	ms_run[2]:scan=17752	82.815	2	2552.0908	2552.0908	R	-	148	171
PSM	GGSYSQAACSDSAQGSDVSLTA	8	sp|Q31610|1B81_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	45	1-UNIMOD:214,9-UNIMOD:4	ms_run[2]:scan=10361	52.032	2	2261.9828	2261.9828	K	-	341	363
PSM	DNLTLWTSDTQGDEAEAGEGGEN	9	sp|P63104-2|1433Z_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	44	1-UNIMOD:214	ms_run[2]:scan=17750	82.811	3	2552.0908	2552.0908	R	-	148	171
PSM	DNLTLWTSDTQGDEAEAGEGGEN	10	sp|P63104-2|1433Z_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	44	1-UNIMOD:214	ms_run[2]:scan=30583	153.48	3	2552.0908	2552.0908	R	-	148	171
PSM	GGSYSQAASSDSAQGSDVSLTA	11	sp|Q95365|1B38_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	44	1-UNIMOD:214	ms_run[2]:scan=10040	50.714	2	2188.9842	2188.9842	K	-	341	363
PSM	DNLTLWTSDSAGEECDAAEGAEN	12	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:214,15-UNIMOD:4	ms_run[2]:scan=18361	85.401	2	2598.0786	2598.0786	R	-	223	246
PSM	DNLTLWTSDTQGDEAEAGEGGEN	13	sp|P63104-2|1433Z_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:214	ms_run[2]:scan=18002	83.876	3	2552.0908	2552.0908	R	-	148	171
PSM	IIEVAPQVATQNVNPTPGATS	14	sp|P49903-2|SPS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:214	ms_run[2]:scan=16971	79.452	2	2250.1978	2250.1978	R	-	301	322
PSM	AAALAAAVAQDPAASGAPSS	15	sp|Q8TAE8|G45IP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	42	1-UNIMOD:214	ms_run[2]:scan=14949	71.116	2	1839.9448	1839.9448	R	-	203	223
PSM	DNLTLWTSDQQDEEAGEGN	16	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	42	1-UNIMOD:214	ms_run[2]:scan=17153	80.269	2	2264.9791	2264.9791	R	-	228	247
PSM	DNLTLWTSDTQGDEAEAGEGGEN	17	sp|P63104-2|1433Z_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	42	1-UNIMOD:214	ms_run[2]:scan=30354	151.95	3	2552.0908	2552.0908	R	-	148	171
PSM	DNLTLWTSDQQDDDGGEGNN	18	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:214	ms_run[2]:scan=16584	77.863	2	2336.9751	2336.9751	R	-	228	248
PSM	DNLTLWTSDSAGEECDAAEGAEN	19	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:214,15-UNIMOD:4	ms_run[2]:scan=18359	85.397	3	2598.0786	2598.0786	R	-	223	246
PSM	DNLTLWTSDTQGDEAEAGEGGEN	20	sp|P63104-2|1433Z_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:214	ms_run[2]:scan=18275	85.06	3	2552.0908	2552.0908	R	-	148	171
PSM	DNLTLWTSENQGDEGDAGEGEN	21	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:214	ms_run[2]:scan=16815	78.815	2	2494.049	2494.0490	R	-	223	245
PSM	NTAPLTLCPLNIGSQGSTDY	22	sp|P19474-2|RO52_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:214,8-UNIMOD:4	ms_run[2]:scan=22894	105.8	2	2265.1069	2265.1069	K	-	379	399
PSM	AQTGSGGADPTTDVSGQS	23	sp|O75122|CLAP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:214	ms_run[2]:scan=3621	23.218	2	1778.804	1778.8040	R	-	1277	1295
PSM	AAAAAAAAAPAAAATAPTTAATTAATAAQ	24	sp|P37108|SRP14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:214	ms_run[2]:scan=14542	69.121	2	2511.3051	2511.3051	K	-	108	137
PSM	AGEAPTENPAPPTQQSSAE	25	sp|P16989-2|YBOX3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:214	ms_run[2]:scan=5444	31.523	2	2024.9409	2024.9409	K	-	285	304
PSM	DNLTLWTSENQGDEGDAGEGEN	26	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:214	ms_run[2]:scan=17115	80.097	2	2494.049	2494.0490	R	-	223	245
PSM	DNLTLWTADNAGEEGGEAPQEPQS	27	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	39	1-UNIMOD:214	ms_run[1]:scan=18254	84.9637	3	2672.206514	2672.195983	R	-	225	249
PSM	EAQTLDSQIQETSI	28	sp|P27816-4|MAP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:214	ms_run[2]:scan=15704	74.288	2	1705.8492	1705.8492	R	-	859	873
PSM	LDNGQVGLYPANYVEAIQ	29	sp|Q9UNF0|PACN2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:214	ms_run[2]:scan=23539	109.04	2	2107.0708	2107.0708	R	-	469	487
PSM	NQAIYAAVDDDDDDAA	30	sp|Q9UK59-2|DBR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:214	ms_run[2]:scan=12571	61.071	2	1824.7772	1824.7772	R	-	297	313
PSM	SGMTTGSTLPVEGGFWAC	31	sp|Q7Z4W1|DCXR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:214,18-UNIMOD:4	ms_run[2]:scan=23035	106.51	2	2000.9094	2000.9094	R	-	227	245
PSM	YFQINQDEEEEEDED	32	sp|P35268|RL22_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:214	ms_run[2]:scan=14849	70.689	2	2074.8249	2074.8249	R	-	114	129
PSM	YTPVQQGPVGVNVTYGGD	33	sp|P21333|FLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	38	1-UNIMOD:214	ms_run[1]:scan=15627	73.960095	2	1993.9932	1993.9862	K	P	937	955
PSM	FESPESQASAEQPEM	34	sp|O75436|VP26A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:214,15-UNIMOD:35	ms_run[2]:scan=8552	44.606	2	1825.7798	1825.7798	R	-	313	328
PSM	GLQVGGCEPEPQVC	35	sp|P52888-2|THOP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:214,7-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=11819	57.969	2	1672.7671	1672.7671	K	-	245	259
PSM	SSIVMGEPISQSSSNSQ	36	sp|Q8TCS8|PNPT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:214	ms_run[2]:scan=11433	56.328	2	1880.8908	1880.8908	R	-	767	784
PSM	GVGSNAATSQMAGGYA	37	sp|Q9Y342|PLLP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	37	1-UNIMOD:214	ms_run[1]:scan=9663	49.19957333333333	2	1584.739173	1584.732405	R	-	167	183
PSM	NITYLPAGQSVLLQLPQ	38	sp|P35232|PHB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	37	1-UNIMOD:214	ms_run[1]:scan=26037	122.81858333333332	2	1998.135218	1998.127163	R	-	256	273
PSM	ESPESEGPIYEGLIL	39	sp|Q96QK1|VPS35_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	37	1-UNIMOD:214	ms_run[1]:scan=25481	119.559455	2	1775.902712	1775.895097	R	-	782	797
PSM	DILNPDSSMETSPDFFF	40	sp|Q16666-3|IF16_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:214,9-UNIMOD:35	ms_run[2]:scan=27662	132.79	2	2120.937	2120.9370	K	-	657	674
PSM	DNLTLWTSDQQDDDGGEGNN	41	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:214	ms_run[2]:scan=16544	77.705	3	2336.9751	2336.9751	R	-	228	248
PSM	DNLTLWTSDSAGEECDAAEGAEN	42	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:214,15-UNIMOD:4	ms_run[2]:scan=18594	86.498	3	2598.0786	2598.0786	R	-	223	246
PSM	GQGSVSASVTEGQQNEQ	43	sp|P55735-2|SEC13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:214	ms_run[2]:scan=4683	28.192	2	1848.8571	1848.8571	K	-	292	309
PSM	MVQQLQEDVDMEDAP	44	sp|Q9UHA3|RLP24_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:214	ms_run[2]:scan=21082	97.475	2	1890.8461	1890.8461	K	-	149	164
PSM	NNSNDIVNAIMELTM	45	sp|Q13765|NACA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:214,11-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=27850	134	2	1853.8621	1853.8621	K	-	201	216
PSM	NNSNDIVNAIMELTM	46	sp|Q13765|NACA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:214,15-UNIMOD:35	ms_run[2]:scan=30419	152.41	2	1837.8672	1837.8672	K	-	201	216
PSM	NSSLLSFDNEDENE	47	sp|Q96AT1|K1143_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:214	ms_run[2]:scan=16273	76.589	2	1755.7557	1755.7557	K	-	141	155
PSM	DNLTLWTSDQQDDDGGEGNN	48	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:214	ms_run[2]:scan=16797	78.739	3	2336.9751	2336.9751	R	-	228	248
PSM	ESTNLGNLEESSE	49	sp|P24386|RAE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:214	ms_run[2]:scan=10210	51.428	2	1551.7022	1551.7022	K	-	641	654
PSM	FPSGNQGGAGPSQGSGGGTGGSVYTEDNDDDLYG	50	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:214	ms_run[2]:scan=15326	72.752	3	3363.4158	3363.4158	R	-	773	807
PSM	SEAPNWATQDSGFY	51	sp|P60228|EIF3E_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:214	ms_run[2]:scan=18194	84.683	2	1715.7549	1715.7549	R	-	432	446
PSM	SSASAPDVDDPEAFPALA	52	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:214	ms_run[2]:scan=19550	90.683	2	1902.8969	1902.8969	K	-	370	388
PSM	TNLQPLESTQSQDF	53	sp|Q9Y248|PSF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:214	ms_run[2]:scan=15705	74.29	2	1750.8495	1750.8495	R	-	172	186
PSM	EGMVSSGQNLLAVESQ	54	sp|P43378|PTN9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35	1-UNIMOD:214	ms_run[1]:scan=16965	79.43899	2	1791.886940	1791.879464	K	-	578	594
PSM	LASQADSTEQVDDTILT	55	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35	1-UNIMOD:214	ms_run[1]:scan=16146	76.09152333333333	2	1949.962930	1949.955131	K	-	2655	2672
PSM	STGSTSSQTQPGTGWVQF	56	sp|Q9NVZ3|NECP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35	1-UNIMOD:214	ms_run[1]:scan=19027	88.35922333333333	2	1998.949450	1998.940484	K	-	246	264
PSM	AACVSCPAQGVSSVDVA	57	sp|Q8NCG7-2|DGLB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:214,3-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=11905	58.327	2	1820.8519	1820.8519	R	-	375	392
PSM	AGMTSSPDATTGQTFG	58	sp|Q9UQR1-2|ZN148_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:214	ms_run[2]:scan=9812	49.804	2	1671.7532	1671.7532	R	-	116	132
PSM	ATLLEDQQDPSPSS	59	sp|Q9HC35-2|EMAL4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:214	ms_run[2]:scan=10101	50.959	2	1630.7808	1630.7808	K	-	910	924
PSM	AVSEGCASEDEVEGEA	60	sp|Q9BYX2-6|TBD2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=7904	41.937	2	1781.7383	1781.7383	R	-	453	469
PSM	DNLTLWTSDQQDEEAGEGN	61	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:214	ms_run[2]:scan=17133	80.182	3	2264.9791	2264.9791	R	-	228	247
PSM	EAQTLDSQIQETN	62	sp|P27816-5|MAP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:214	ms_run[2]:scan=9028	46.59	2	1619.776	1619.7760	R	-	797	810
PSM	GATAAVLAPDSSNASSEPSS	63	sp|Q99611|SPS2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:214	ms_run[2]:scan=9050	46.672	2	1961.93	1961.9300	R	-	429	449
PSM	IEEEEQEPEPPEPFEYIDD	64	sp|Q99460-2|PSMD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:214	ms_run[2]:scan=22373	103.37	2	2477.0768	2477.0768	K	-	904	923
PSM	IVSAQSLAEDDVE	65	sp|Q15388|TOM20_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:214	ms_run[2]:scan=15389	73.002	2	1518.7535	1518.7535	R	-	133	146
PSM	NILVSDMEMNEQQE	66	sp|Q9UBG0|MRC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:214	ms_run[2]:scan=18362	85.403	2	1822.8199	1822.8199	K	-	1466	1480
PSM	TGDTGMLPANYVEAI	67	sp|Q14847-3|LASP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:214,6-UNIMOD:35	ms_run[2]:scan=19340	89.758	2	1710.8256	1710.8256	R	-	191	206
PSM	TGDTGMLPANYVEAI	68	sp|Q14847-3|LASP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:214	ms_run[2]:scan=22509	103.98	2	1694.8307	1694.8307	R	-	191	206
PSM	TPQENGATAGSGVQPAQ	69	sp|O15120-2|PLCB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:214	ms_run[2]:scan=4128	25.618	2	1755.8509	1755.8509	K	-	230	247
PSM	IIEVAPQVATQNVNPTPGATS	70	sp|P49903|SPS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	34	1-UNIMOD:214	ms_run[1]:scan=16962	79.43300166666667	3	2250.207533	2250.197761	R	-	372	393
PSM	TLSNAEDYLDDEDSD	71	sp|Q92882|OSTF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	34	1-UNIMOD:214	ms_run[1]:scan=15662	74.11343666666667	2	1844.763225	1844.755763	R	-	200	215
PSM	AASSAAQGAFQGN	72	sp|O15127|SCAM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:214	ms_run[2]:scan=5303	30.932	2	1322.6337	1322.6337	R	-	317	330
PSM	AVTEGAQAVEEPSIC	73	sp|P28331-3|NDUS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:214,15-UNIMOD:4	ms_run[2]:scan=12052	58.895	2	1703.8158	1703.8158	K	-	602	617
PSM	DFLLQSSTVAAEAQDGPQEA	74	sp|P01833|PIGR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:214	ms_run[2]:scan=19887	92.174	3	2220.0668	2220.0668	K	-	745	765
PSM	DMMSEGGPPGAEPQ	75	sp|P11215|ITAM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:214	ms_run[2]:scan=8775	45.527	2	1545.6561	1545.6561	K	-	1139	1153
PSM	DNLTLWTSENQGDEGDAGEGEN	76	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:214	ms_run[2]:scan=17046	79.789	3	2494.049	2494.0490	R	-	223	245
PSM	DSLTQAQEQGNLLN	77	sp|Q5JTD0-4|TJAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:214	ms_run[2]:scan=12639	61.341	2	1673.8342	1673.8342	K	-	469	483
PSM	EVQDPAPAQVQAQ	78	sp|Q8N983-4|RM43_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:214	ms_run[2]:scan=6674	36.74	2	1523.7702	1523.7702	R	-	147	160
PSM	GQTNNAASASASNST	79	sp|P49841|GSK3B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:214	ms_run[2]:scan=673	6.3758	2	1523.6934	1523.6934	R	-	406	421
PSM	NNSNDIVNAIMELTM	80	sp|Q13765|NACA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:214,11-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=27665	132.8	2	1853.8621	1853.8621	K	-	201	216
PSM	TGDTGMLPANYVEAI	81	sp|Q14847-3|LASP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:214	ms_run[2]:scan=22731	105.07	2	1694.8307	1694.8307	R	-	191	206
PSM	TGQPSAPGDTSVNGPV	82	sp|Q5H9R7-4|PP6R3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:214	ms_run[2]:scan=7926	42.031	2	1626.7971	1626.7971	R	-	778	794
PSM	YLVTFSPLMDTQDD	83	sp|P55884|EIF3B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:214	ms_run[1]:scan=26141	123.42491000000001	2	1787.8475	1787.8404	R	P	387	401
PSM	ASSQSAPSPDVGSGVQT	84	sp|Q8N490-2|PNKD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:214	ms_run[2]:scan=6808	37.303	2	1717.8241	1717.8241	R	-	126	143
PSM	DILNPDSSMETSPDFFF	85	sp|Q16666-3|IF16_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:214	ms_run[2]:scan=29110	142.46	2	2104.9421	2104.9421	K	-	657	674
PSM	DNLTLWTSDTQGDEAEAGEGGEN	86	sp|P63104-2|1433Z_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:214	ms_run[2]:scan=30215	150.9	3	2552.0908	2552.0908	R	-	148	171
PSM	GQGGAGAGDDEEED	87	sp|P46781|RS9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:214	ms_run[2]:scan=717	6.7265	2	1449.5614	1449.5614	K	-	181	195
PSM	MVETALTPDACYPD	88	sp|P01591|IGJ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:214,11-UNIMOD:4	ms_run[2]:scan=17236	80.634	2	1725.7712	1725.7712	K	-	146	160
PSM	TPAEASSTGQTGPQSAL	89	sp|Q9Y676|RT18B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:214	ms_run[2]:scan=8655	45.029	2	1745.8554	1745.8554	R	-	242	259
PSM	YASGSSASLGGPESAVA	90	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:214	ms_run[2]:scan=11054	54.834	2	1653.7968	1653.7968	R	-	4499	4516
PSM	YFQINQDEEEEEDED	91	sp|P35268|RL22_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:214	ms_run[2]:scan=14886	70.856	3	2074.8249	2074.8249	R	-	114	129
PSM	GCYWAMVQAPADAPE	92	sp|Q03518|TAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32	1-UNIMOD:214,2-UNIMOD:4	ms_run[1]:scan=19859	92.06121	2	1808.806932	1808.798377	K	-	794	809
PSM	TVCVEMGDVESAF	93	sp|P49189|AL9A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32	1-UNIMOD:214,3-UNIMOD:4	ms_run[1]:scan=22345	103.27301999999999	2	1586.715502	1586.707830	K	-	482	495
PSM	IITYNEAMDSPDQ	94	sp|Q7Z417|NUFP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32	1-UNIMOD:214	ms_run[1]:scan=14633	69.64047166666667	2	1639.765257	1639.752138	R	-	683	696
PSM	EQSEVGSMGALLF	95	sp|P61619|S61A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32	1-UNIMOD:214	ms_run[1]:scan=25543	119.92032666666665	2	1510.752464	1510.745930	K	-	464	477
PSM	TVYVSVLPTTADF	96	sp|P41252|SYIC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32	1-UNIMOD:214	ms_run[1]:scan=25026	116.96408999999998	2	1555.832461	1555.825561	K	-	1250	1263
PSM	AAAYDISEDEED	97	sp|P49585|PCY1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:214	ms_run[2]:scan=9146	47.103	2	1470.612	1470.6120	K	-	356	368
PSM	ASAETVDPASLWEY	98	sp|Q16658|FSCN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:214	ms_run[2]:scan=23399	108.34	2	1681.7957	1681.7957	K	-	480	494
PSM	EFIQGQGGWENLES	99	sp|Q5TBC7|B2L15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:214	ms_run[2]:scan=18901	87.831	2	1736.8128	1736.8128	R	-	150	164
PSM	EVGWVQQVPNATTPPATLPSSGP	100	sp|Q8WWM9|CYGB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:214	ms_run[2]:scan=20007	92.728	3	2476.272	2476.2720	K	-	168	191
PSM	IQELSATVTTDC	101	sp|Q15654|TRIP6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:214,12-UNIMOD:4	ms_run[2]:scan=13794	65.986	2	1480.7201	1480.7201	R	-	465	477
PSM	MVETALTPDACYPD	102	sp|P01591|IGJ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:214,11-UNIMOD:4	ms_run[2]:scan=16674	78.222	2	1725.7712	1725.7712	K	-	146	160
PSM	NSTYGVNSNDMMS	103	sp|Q9UIA9|XPO7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:214	ms_run[2]:scan=10104	50.965	2	1562.6463	1562.6463	K	-	1075	1088
PSM	SPSASITDEDSNV	104	sp|Q86W92-3|LIPB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:214	ms_run[2]:scan=8860	45.87	2	1464.6702	1464.6702	R	-	846	859
PSM	AALEAVGGTVVLE	105	sp|P52815|RM12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31	1-UNIMOD:214	ms_run[1]:scan=19361	89.85098833333333	2	1371.780168	1371.773131	K	-	186	199
PSM	SILTLSTMDSSTC	106	sp|Q9Y2G3|AT11B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31	1-UNIMOD:214,13-UNIMOD:4	ms_run[1]:scan=19244	89.29880333333334	2	1558.740610	1558.734045	R	-	1165	1178
PSM	ESPESEGPIYEGLIL	107	sp|Q96QK1|VPS35_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31	1-UNIMOD:214	ms_run[1]:scan=25298	118.52690666666666	2	1775.902712	1775.895097	R	-	782	797
PSM	DNLTLWTSENQGDEGDAGEGEN	108	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:214	ms_run[2]:scan=16794	78.733	3	2494.049	2494.0490	R	-	223	245
PSM	EQSSSSFSQGQSS	109	sp|P08779|K1C16_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:214	ms_run[2]:scan=2050	15.198	2	1488.645	1488.6450	K	-	461	474
PSM	ESDGGAGDLEDPW	110	sp|O75688-2|PPM1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:214	ms_run[2]:scan=16383	77.039	2	1490.6283	1490.6283	R	-	375	388
PSM	GAAPESSLITFEAAPPTL	111	sp|Q12893|TM115_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:214	ms_run[2]:scan=24720	115.19	2	1915.006	1915.0060	K	-	334	352
PSM	MGGAGGEGSDDDTSLT	112	sp|Q9Y365|STA10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:214	ms_run[2]:scan=7097	38.514	2	1612.6644	1612.6644	R	-	276	292
PSM	NMCGLAACASYPIPLV	113	sp|P09668|CATH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:214,3-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=25586	120.16	2	1879.9116	1879.9116	K	-	320	336
PSM	NNSNDIVNAIMELTM	114	sp|Q13765|NACA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:214,11-UNIMOD:35	ms_run[2]:scan=29388	144.45	2	1837.8672	1837.8672	K	-	201	216
PSM	SSIVMGEPISQSSSNSQ	115	sp|Q8TCS8|PNPT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:214	ms_run[2]:scan=11499	56.608	3	1880.8908	1880.8908	R	-	767	784
PSM	TLGMAEEDEEE	116	sp|Q13505-3|MTX1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:214	ms_run[2]:scan=8925	46.16	2	1395.5833	1395.5833	R	-	307	318
PSM	DDDIAALVVDNGSGMCK	117	sp|P60709|ACTB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:214,16-UNIMOD:4,17-UNIMOD:214	ms_run[1]:scan=21417	99.00115833333334	2	2067.9652	2066.9852	M	A	2	19
PSM	SSIVMGEPISQSSSNSQ	118	sp|Q8TCS8|PNPT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:214	ms_run[1]:scan=11822	57.97515166666667	2	1881.877394	1880.890757	R	-	767	784
PSM	VTDLVDYVCNSEQL	119	sp|Q96T23|RSF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:214,9-UNIMOD:4	ms_run[1]:scan=24903	116.26579333333333	2	1797.861862	1797.857666	R	-	1428	1442
PSM	ASAETVDPASLWEY	120	sp|Q16658|FSCN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:214	ms_run[2]:scan=23608	109.42	2	1681.7957	1681.7957	K	-	480	494
PSM	DAAINSLLQMGEEP	121	sp|Q9H0E2-2|TOLIP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:214	ms_run[2]:scan=23897	110.9	2	1630.7994	1630.7994	K	-	192	206
PSM	DNLTLWTSDTQGDEAEAGEGGEN	122	sp|P63104-2|1433Z_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:214	ms_run[2]:scan=31873	163.34	3	2552.0908	2552.0908	R	-	148	171
PSM	DNLTLWTSDTQGDEAEAGEGGEN	123	sp|P63104-2|1433Z_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:214	ms_run[2]:scan=31996	164.55	3	2552.0908	2552.0908	R	-	148	171
PSM	DVNFEFPEFQL	124	sp|P62081|RS7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:214	ms_run[2]:scan=29016	141.78	2	1527.7367	1527.7367	K	-	184	195
PSM	FESPESQASAEQPEM	125	sp|O75436|VP26A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:214	ms_run[2]:scan=12448	60.528	2	1809.7849	1809.7849	R	-	313	328
PSM	GDNITLLQSVSN	126	sp|P62304|RUXE_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:214	ms_run[2]:scan=16437	77.277	2	1403.7378	1403.7378	K	-	81	93
PSM	ISCVTQSTDAAV	127	sp|Q96FZ5-2|CKLF7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=10858	54.071	2	1394.6833	1394.6833	K	-	131	143
PSM	LSSETGGMGSS	128	sp|Q15366-7|PCBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:214,8-UNIMOD:35	ms_run[2]:scan=1889	14.277	2	1171.5149	1171.5149	R	-	308	319
PSM	LSSETGGMGSS	129	sp|Q15366-7|PCBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:214	ms_run[2]:scan=5384	31.264	2	1155.52	1155.5200	R	-	308	319
PSM	NILVSDMEMNEQQE	130	sp|Q9UBG0|MRC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:214	ms_run[2]:scan=18383	85.498	3	1822.8199	1822.8199	K	-	1466	1480
PSM	SADELENLILQQN	131	sp|O94818-2|NOL4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:214	ms_run[2]:scan=23062	106.64	2	1629.8332	1629.8332	R	-	524	537
PSM	SQGACVTPASGC	132	sp|O00178|GTPB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:214,5-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=2409	17.055	2	1337.5826	1337.5826	K	-	658	670
PSM	SSASAPDVDDPEAFPALA	133	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:214	ms_run[2]:scan=19801	91.799	2	1902.8969	1902.8969	K	-	370	388
PSM	TPAEASSTGQTGPQSAL	134	sp|Q9Y676|RT18B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:214	ms_run[2]:scan=8916	46.111	2	1745.8554	1745.8554	R	-	242	259
PSM	VDEVLYEDSSTA	135	sp|P49914-2|MTHFS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:214	ms_run[2]:scan=13816	66.068	2	1470.6848	1470.6848	K	-	168	180
PSM	QTNPSAMEVEEDD	136	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:214	ms_run[1]:scan=7677	40.978455	2	1607.6804	1607.6738	R	P	714	727
PSM	FLDELDAVQMD	137	sp|O15160|RPAC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:214,10-UNIMOD:35	ms_run[1]:scan=21335	98.63749333333334	2	1454.680802	1454.672097	R	-	336	347
PSM	ESPESEGPIYEGLIL	138	sp|Q96QK1|VPS35_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:214	ms_run[1]:scan=25669	120.64086166666667	2	1775.902712	1775.895097	R	-	782	797
PSM	GGGPYDAPGGDDSYI	139	sp|Q9HBB8|CDHR5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:214	ms_run[1]:scan=13505	64.82556666666666	2	1583.693345	1583.686167	R	-	831	846
PSM	MLDQTLLDLNEM	140	sp|P06753-2|TPM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:214	ms_run[1]:scan=25934	122.20932166666665	2	1578.782443	1578.775516	R	-	237	249
PSM	FGSNINLEADES	141	sp|Q9NQP4|PFD4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:214	ms_run[1]:scan=14557	69.19923166666666	2	1438.682904	1438.669788	K	-	123	135
PSM	AAALAAAVAQDPAASGAPSS	142	sp|Q8TAE8|G45IP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:214	ms_run[2]:scan=14930	71.037	3	1839.9448	1839.9448	R	-	203	223
PSM	AMENQYSPTPGTDC	143	sp|Q9NPY3|C1QR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:214,14-UNIMOD:4	ms_run[2]:scan=7595	40.64	2	1713.7096	1713.7096	R	-	639	653
PSM	AVTEGAQAVEEPSIC	144	sp|P28331-3|NDUS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:214,15-UNIMOD:4	ms_run[2]:scan=12226	59.617	2	1703.8158	1703.8158	K	-	602	617
PSM	DVNFEFPEFQL	145	sp|P62081|RS7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:214	ms_run[2]:scan=29158	142.81	2	1527.7367	1527.7367	K	-	184	195
PSM	EALQDVEDENQ	146	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:214	ms_run[2]:scan=8357	43.835	2	1432.644	1432.6440	K	-	223	234
PSM	ELIEIISGAAAL	147	sp|P36542-2|ATPG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:214	ms_run[2]:scan=29887	148.26	2	1342.783	1342.7830	K	-	286	298
PSM	EPELLEPIPYEFMA	148	sp|P46778|RL21_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:214	ms_run[2]:scan=29096	142.37	2	1820.9028	1820.9028	K	-	147	161
PSM	GGSGSGPTIEEVD	149	sp|P0DMV8-2|HS71A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:214	ms_run[2]:scan=7833	41.672	2	1347.6276	1347.6276	K	-	574	587
PSM	LNMGEIETLDDY	150	sp|Q6Y7W6-4|GGYF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:214	ms_run[2]:scan=23416	108.43	2	1555.7198	1555.7198	R	-	1275	1287
PSM	MVETALTPDACYPD	151	sp|P01591|IGJ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:214,11-UNIMOD:4	ms_run[2]:scan=17009	79.611	2	1725.7712	1725.7712	K	-	146	160
PSM	QATPGVPAQQSPSM	152	sp|O60341|KDM1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:214,14-UNIMOD:35	ms_run[2]:scan=4669	28.12	2	1557.7579	1557.7579	R	-	839	853
PSM	QATPGVPAQQSPSM	153	sp|O60341|KDM1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:214	ms_run[2]:scan=8311	43.625	2	1541.763	1541.7630	R	-	839	853
PSM	TEMAPGASQGDQQ	154	sp|Q96DZ9-4|CKLF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:214	ms_run[2]:scan=2728	18.854	2	1462.648	1462.6480	R	-	62	75
PSM	TVCVEMGDVESAF	155	sp|P49189-2|AL9A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:214,3-UNIMOD:4,6-UNIMOD:35	ms_run[2]:scan=16438	77.279	2	1602.7027	1602.7027	K	-	412	425
PSM	VTQQVNPIFSEAC	156	sp|Q9P2T1-3|GMPR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:214,13-UNIMOD:4	ms_run[2]:scan=16360	76.937	2	1635.8048	1635.8048	R	-	308	321
PSM	SQLPLEGLEQPACDT	157	sp|Q9Y5S2|MRCKB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	1-UNIMOD:214,13-UNIMOD:4	ms_run[1]:scan=18072	84.16202333333332	2	1799.856674	1800.868565	R	-	1697	1712
PSM	DGVLVDEFGLPQIPAS	158	sp|Q9NZZ3|CHMP5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	1-UNIMOD:214	ms_run[1]:scan=26437	125.19399666666665	2	1799.950163	1799.942716	K	-	204	220
PSM	ISEDAMSTASSTY	159	sp|Q8TF05|PP4R1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	1-UNIMOD:214	ms_run[1]:scan=12716	61.67859	2	1505.673763	1505.667739	K	-	938	951
PSM	AAQQAASSSGQGQQAQTPTGF	160	sp|P48729-3|KC1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:214	ms_run[2]:scan=8268	43.449	3	2164.0267	2164.0267	K	-	305	326
PSM	AVNSATGVPTV	161	sp|P11940-2|PABP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:214	ms_run[2]:scan=10208	51.425	2	1158.6366	1158.6366	K	-	537	548
PSM	EQSEVGSMGALLF	162	sp|P61619-3|S61A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:214,8-UNIMOD:35	ms_run[2]:scan=19693	91.305	2	1526.7408	1526.7408	K	-	344	357
PSM	FECGEGEEAAETE	163	sp|P43897|EFTS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=7751	41.295	2	1600.6321	1600.6321	R	-	313	326
PSM	GQTGIFPANYVTMN	164	sp|Q96HL8-4|SH3Y1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:214	ms_run[2]:scan=20595	95.305	2	1655.8099	1655.8099	R	-	214	228
PSM	GSGACGVNTMASSAVVD	165	sp|Q9UBX1|CATF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:214,5-UNIMOD:4	ms_run[2]:scan=10759	53.665	2	1725.7784	1725.7784	R	-	468	485
PSM	ISGLIYEETR	166	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:214	ms_run[2]:scan=21392	98.902	2	1323.7156	1323.7156	R	G	47	57
PSM	LIIESPSNTSSTEPA	167	sp|P38432|COIL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:214	ms_run[2]:scan=13880	66.315	2	1688.859	1688.8590	R	-	562	577
PSM	NMNDPAWDETNL	168	sp|Q14155-1|ARHG7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:214	ms_run[2]:scan=16942	79.351	2	1562.6793	1562.6793	K	-	635	647
PSM	QASDSGTGDQV	169	sp|Q5JPI3-2|CC038_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:214	ms_run[2]:scan=1393	11.286	2	1207.5439	1207.5439	K	-	317	328
PSM	QVLQQPGQLVDTSL	170	sp|Q8N8V4|ANS4B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:214	ms_run[2]:scan=19447	90.215	2	1668.9168	1668.9168	K	-	404	418
PSM	SGLSDLAESLTNDNETNS	171	sp|Q96FV9|THOC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:214	ms_run[2]:scan=20594	95.302	2	2009.9147	2009.9147	K	-	640	658
PSM	TGDTGMLPANYVEAI	172	sp|Q14847-3|LASP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:214,6-UNIMOD:35	ms_run[2]:scan=19117	88.741	2	1710.8256	1710.8256	R	-	191	206
PSM	VVQSQGTGTAQD	173	sp|Q02388-2|CO7A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:214	ms_run[2]:scan=2085	15.413	2	1333.6596	1333.6596	R	-	2901	2913
PSM	EQSEVGSMGALLF	174	sp|P61619|S61A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:214	ms_run[1]:scan=25367	118.89910333333334	2	1510.752464	1510.745930	K	-	464	477
PSM	TVQSLEIDLDSMR	175	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:214	ms_run[1]:scan=21479	99.32540333333333	2	1649.827019	1649.841622	R	N	302	315
PSM	DLLSCTSSEPLTL	176	sp|Q969K7|TMM54_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:214,5-UNIMOD:4	ms_run[1]:scan=22431	103.61630333333333	2	1578.801982	1578.793275	R	-	210	223
PSM	ELIEIISGAAALD	177	sp|P36542|ATPG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:214	ms_run[1]:scan=28990	141.59725166666666	2	1457.817474	1457.809911	K	-	286	299
PSM	DVNFEFPEFQL	178	sp|P62081|RS7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:214	ms_run[1]:scan=29213	143.18896166666667	2	1528.729266	1527.736746	K	-	184	195
PSM	LTTDMDPSQQ	179	sp|Q15811-2|ITSN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:214	ms_run[1]:scan=8928	46.16590166666666	2	1279.587112	1278.588367	K	-	1211	1221
PSM	VSAGNGGSSLSYTNPAVAATSANL	180	sp|P15941|MUC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:214	ms_run[1]:scan=18884	87.74198	2	2353.161062	2352.167918	K	-	1232	1256
PSM	ADGYEPPVQESV	181	sp|P61247|RS3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214	ms_run[2]:scan=11235	55.545	2	1433.6796	1433.6796	R	-	253	265
PSM	CCEGSCGMACFVPQ	182	sp|P19957|ELAF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214,1-UNIMOD:4,2-UNIMOD:4,6-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=15157	71.998	2	1805.6785	1805.6785	K	-	104	118
PSM	DVNFEFPEFQL	183	sp|P62081|RS7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214	ms_run[2]:scan=28870	140.76	2	1527.7367	1527.7367	K	-	184	195
PSM	EMNDIEQICSQAS	184	sp|Q9NQH7-2|XPP3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214,9-UNIMOD:4	ms_run[2]:scan=13985	66.747	2	1667.7253	1667.7253	K	-	416	429
PSM	EPQPEQPQPSTSAN	185	sp|Q9GZR7-2|DDX24_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214	ms_run[2]:scan=3647	23.337	2	1652.7764	1652.7764	K	-	791	805
PSM	EQSEVGSMGALLF	186	sp|P61619-3|S61A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214	ms_run[2]:scan=25412	119.15	3	1510.7459	1510.7459	K	-	344	357
PSM	GVDEVTIVNILTNR	187	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214	ms_run[2]:scan=27693	132.99	3	1685.9434	1685.9434	K	S	50	64
PSM	ITIADCGQLE	188	sp|P62937-2|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=14632	69.639	2	1262.6298	1262.6298	K	-	96	106
PSM	ITSAAASGGDS	189	sp|Q6IC98-2|GRAM4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214	ms_run[2]:scan=2875	19.599	2	1079.5217	1079.5217	K	-	91	102
PSM	LADMYGGGEDD	190	sp|P22223|CADH3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214	ms_run[2]:scan=11404	56.234	2	1285.5254	1285.5254	K	-	819	830
PSM	NLSDIDLMAPQPGV	191	sp|Q96B49|TOM6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214,8-UNIMOD:35	ms_run[2]:scan=18696	86.94	2	1628.8202	1628.8202	R	-	61	75
PSM	QAAVSVLGTEPNS	192	sp|P50336|PPOX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214	ms_run[2]:scan=10983	54.565	2	1415.7378	1415.7378	R	-	465	478
PSM	TEMAPGASQGDQQ	193	sp|Q96DZ9-4|CKLF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214,3-UNIMOD:35	ms_run[2]:scan=1062	9.1536	2	1478.6429	1478.6429	R	-	62	75
PSM	TGDTGMLPANYVEAI	194	sp|Q14847-3|LASP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214	ms_run[2]:scan=30262	151.26	2	1694.8307	1694.8307	R	-	191	206
PSM	TPSASNDDQQE	195	sp|O43765|SGTA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214	ms_run[2]:scan=924	8.1912	2	1334.5708	1334.5708	R	-	303	314
PSM	VAVDLTDLEDL	196	sp|O00463-3|TRAF5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214	ms_run[2]:scan=26284	124.28	2	1345.7099	1345.7099	K	-	441	452
PSM	VAVQPSSLEMSAL	197	sp|P35228-2|NOS2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214	ms_run[2]:scan=20306	94.044	2	1474.7823	1474.7823	R	-	1102	1115
PSM	VNEVIVGNDQLMEI	198	sp|Q9NR50|EI2BG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214	ms_run[2]:scan=23535	109.03	2	1715.8886	1715.8886	R	-	439	453
PSM	YPGGDCSSDIWI	199	sp|Q13228-2|SBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=21662	100.18	2	1512.6677	1512.6677	R	-	397	409
PSM	NLVLAAGAYSPQ	200	sp|Q15542|TAF5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:214	ms_run[1]:scan=16569	77.79449	2	1346.739582	1346.731601	R	-	789	801
PSM	ESPESEGPIYEGLIL	201	sp|Q96QK1|VPS35_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:214	ms_run[1]:scan=25804	121.43751833333333	2	1775.902712	1775.895097	R	-	782	797
PSM	AGEAPTENPAPPTQQSSAE	202	sp|P16989|YBOX3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:214	ms_run[1]:scan=5428	31.445766666666668	3	2024.950654	2024.940878	K	-	354	373
PSM	ILYMTDEVND	203	sp|P00403|COX2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:214	ms_run[1]:scan=17688	82.54972833333333	2	1355.6430	1355.6395	R	P	83	93
PSM	DQLPYICQFGIV	204	sp|P05452|TETN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:214,7-UNIMOD:4	ms_run[1]:scan=26895	127.97884833333335	2	1595.819677	1595.813950	R	-	191	203
PSM	QPAEAGVVESEN	205	sp|Q8N2Z9|CENPS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:214	ms_run[1]:scan=5460	31.606923333333334	2	1372.669171	1372.659224	R	-	127	139
PSM	IYSVEALPVAAVNVQSTQ	206	sp|Q9NYY8|FAKD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:214	ms_run[1]:scan=22079	102.08037833333333	3	2033.109793	2032.096256	K	-	693	711
PSM	GSQEGSELNCASLS	207	sp|Q6MZQ0|PRR5L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:214,10-UNIMOD:4	ms_run[1]:scan=8576	44.69904666666667	2	1581.713514	1581.706251	R	-	355	369
PSM	AEEFLTASQEAL	208	sp|Q14738-3|2A5D_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214	ms_run[2]:scan=20262	93.866	2	1451.7266	1451.7266	R	-	485	497
PSM	AQALVQYLEEPLTQVAAS	209	sp|Q9Y2Q5|LTOR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214	ms_run[2]:scan=29098	142.38	2	2074.1068	2074.1068	K	-	108	126
PSM	DFLLQSSTVAAEAQDGPQEA	210	sp|P01833|PIGR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214	ms_run[2]:scan=20119	93.228	3	2220.0668	2220.0668	K	-	745	765
PSM	GSLGISQEEQ	211	sp|Q9NZD8-2|SPG21_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214	ms_run[2]:scan=6366	35.378	2	1190.5901	1190.5901	K	-	272	282
PSM	GTPTAENPEYLGLDVPV	212	sp|P04626-3|ERBB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214	ms_run[2]:scan=22905	105.86	2	1914.9697	1914.9697	K	-	553	570
PSM	GVEAGPDLLQ	213	sp|O60506-5|HNRPQ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214	ms_run[2]:scan=13940	66.57	2	1141.6101	1141.6101	K	-	401	411
PSM	ITIADCGQLE	214	sp|P62937-2|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=14446	68.623	2	1262.6298	1262.6298	K	-	96	106
PSM	ITIADCGQLE	215	sp|P62937-2|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=14845	70.681	2	1262.6298	1262.6298	K	-	96	106
PSM	IVSAQSLAEDDVE	216	sp|Q15388|TOM20_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214	ms_run[2]:scan=14073	67.078	2	1518.7535	1518.7535	R	-	133	146
PSM	LEASQQNSEEM	217	sp|Q4VC05|BCL7A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214	ms_run[2]:scan=6751	37.062	2	1408.6262	1408.6262	K	-	200	211
PSM	LQLQEDDDDPLIG	218	sp|Q9Y6X5|ENPP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214	ms_run[2]:scan=19817	91.881	2	1613.7906	1613.7906	R	-	441	454
PSM	NLQTVNVDEN	219	sp|P62899|RL31_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214	ms_run[2]:scan=7631	40.801	2	1288.6381	1288.6381	K	-	116	126
PSM	NNSNDIVNAIMELTM	220	sp|Q13765|NACA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214,11-UNIMOD:35	ms_run[2]:scan=29170	142.89	2	1837.8672	1837.8672	K	-	201	216
PSM	NPYALLGEDEC	221	sp|P36915-2|GNL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214,11-UNIMOD:4	ms_run[2]:scan=17792	82.978	2	1423.6411	1423.6411	R	-	420	431
PSM	SGMTTGSTLPVEGGFWAC	222	sp|Q7Z4W1|DCXR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214,18-UNIMOD:4	ms_run[2]:scan=23061	106.64	3	2000.9094	2000.9094	R	-	227	245
PSM	TEMIDQEEGIS	223	sp|Q99598|TSNAX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214	ms_run[2]:scan=10714	53.486	2	1394.6357	1394.6357	K	-	280	291
PSM	TNLQPLESTQSQDF	224	sp|Q9Y248|PSF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214	ms_run[2]:scan=15753	74.471	3	1750.8495	1750.8495	R	-	172	186
PSM	VYALQQTALQG	225	sp|Q96DC7|TMCO6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214	ms_run[2]:scan=14890	70.864	2	1334.7316	1334.7316	R	-	483	494
PSM	YFQINQDEEEEEDED	226	sp|P35268|RL22_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:214	ms_run[1]:scan=15582	73.77729666666667	2	2075.820375	2074.824905	R	-	114	129
PSM	FGPYYTEPVIAGLD	227	sp|P49720|PSB3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:214	ms_run[1]:scan=24527	114.14745833333332	2	1684.8507	1684.8465	R	P	100	114
PSM	EQSEVGSMGALLF	228	sp|P61619|S61A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:214	ms_run[1]:scan=25730	120.98449666666666	2	1510.752464	1510.745930	K	-	464	477
PSM	ELIEIISGAAALD	229	sp|P36542|ATPG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:214	ms_run[1]:scan=28844	140.57671666666667	2	1457.817474	1457.809911	K	-	286	299
PSM	NSSPEDLFDEI	230	sp|Q13426|XRCC4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:214	ms_run[1]:scan=24149	112.20142666666666	2	1408.654478	1408.647990	R	-	326	337
PSM	ALLYLCGGDD	231	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=18494	86.01	2	1239.5927	1239.5927	K	-	330	340
PSM	AQMNQIQSVEV	232	sp|P29323-2|EPHB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214	ms_run[2]:scan=13504	64.824	2	1389.7044	1389.7044	R	-	976	987
PSM	ATLLEDQQDPSPSS	233	sp|Q9HC35-2|EMAL4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214	ms_run[2]:scan=9649	49.127	2	1630.7808	1630.7808	K	-	910	924
PSM	AVVQSPQVTEVL	234	sp|Q3KQU3-3|MA7D1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214	ms_run[2]:scan=17362	81.164	2	1412.7997	1412.7997	K	-	366	378
PSM	FNPDGEEEDVTVQE	235	sp|Q5SW79-2|CE170_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214	ms_run[2]:scan=12422	60.434	2	1750.7655	1750.7655	R	-	1447	1461
PSM	GDMSAVNDESF	236	sp|Q8N488|RYBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214	ms_run[2]:scan=11947	58.49	2	1314.552	1314.5520	K	-	218	229
PSM	GGSGGFGDEC	237	sp|P50895|BCAM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214,10-UNIMOD:4	ms_run[2]:scan=3246	21.38	2	1085.4206	1085.4206	R	-	619	629
PSM	GQGSVSASVTEGQQNEQ	238	sp|P55735-2|SEC13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214	ms_run[2]:scan=4452	27.174	3	1848.8571	1848.8571	K	-	292	309
PSM	GQGSVSASVTEGQQNEQ	239	sp|P55735-2|SEC13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214	ms_run[2]:scan=4685	28.197	3	1848.8571	1848.8571	K	-	292	309
PSM	GYSFTTTAER	240	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214	ms_run[2]:scan=9566	48.804	2	1275.6217	1275.6217	R	E	197	207
PSM	GYSFTTTAER	241	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214	ms_run[2]:scan=10588	52.961	2	1275.6217	1275.6217	R	E	197	207
PSM	IVITDCGQLS	242	sp|P30405|PPIF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=14467	68.741	2	1248.6506	1248.6506	K	-	198	208
PSM	IVSAQSLAEDDVE	243	sp|Q15388|TOM20_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214	ms_run[2]:scan=15752	74.469	2	1518.7535	1518.7535	R	-	133	146
PSM	MTEYDCEFANV	244	sp|Q07507|DERM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214,1-UNIMOD:35,6-UNIMOD:4	ms_run[2]:scan=14647	69.699	2	1537.6187	1537.6187	R	-	191	202
PSM	MVETALTPDACYPD	245	sp|P01591|IGJ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214,1-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=13900	66.402	2	1741.7661	1741.7661	K	-	146	160
PSM	QGSSPPPPQSSQE	246	sp|O60337-6|MARH6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214	ms_run[2]:scan=1073	9.2263	2	1468.6916	1468.6916	K	-	793	806
PSM	TGDTGMLPANYVEAI	247	sp|Q14847-3|LASP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214	ms_run[2]:scan=23214	107.41	2	1694.8307	1694.8307	R	-	191	206
PSM	TPSLSPASSLDV	248	sp|Q32P44|EMAL3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214	ms_run[2]:scan=17131	80.178	2	1316.6945	1316.6945	R	-	885	897
PSM	YPDANPNPNEQ	249	sp|Q14683|SMC1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214	ms_run[2]:scan=5634	32.367	2	1401.6283	1401.6283	K	-	1223	1234
PSM	ASAETVDPASLWEY	250	sp|Q16658|FSCN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:214	ms_run[1]:scan=23880	110.801225	2	1681.803288	1681.795717	K	-	480	494
PSM	ESPESEGPIYEGLIL	251	sp|Q96QK1|VPS35_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:214	ms_run[1]:scan=25874	121.84744666666666	2	1775.902712	1775.895097	R	-	782	797
PSM	DAAINSLLQMGEEP	252	sp|Q9H0E2|TOLIP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:214	ms_run[1]:scan=23981	111.32664333333334	2	1630.795686	1630.799422	K	-	261	275
PSM	DVNFEFPEFQL	253	sp|P62081|RS7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:214	ms_run[1]:scan=29131	142.60233333333332	2	1527.744703	1527.736746	K	-	184	195
PSM	DVNFEFPEFQL	254	sp|P62081|RS7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:214	ms_run[1]:scan=28296	136.87222833333334	2	1527.746688	1527.736746	K	-	184	195
PSM	WELSSDQPYL	255	sp|O95182|NDUA7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:214	ms_run[1]:scan=21599	99.871135	2	1380.675235	1380.668332	R	-	104	114
PSM	VSAGNGGSSLSYTNPAVAATSANL	256	sp|P15941|MUC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:214	ms_run[1]:scan=18837	87.52962166666667	3	2353.161960	2352.167918	K	-	1232	1256
PSM	EWETAAPAVAETPDIK	257	sp|P46782|RS5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:214,16-UNIMOD:214	ms_run[1]:scan=29831	147.81252	2	2015.0182	2015.0452	T	L	3	19
PSM	AACAQLNDFLQEYGTQGCQV	258	sp|P0C0L4|CO4A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:214,3-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=21016	97.19324666666667	3	2417.085417	2416.090930	R	-	1725	1745
PSM	TGDTGMLPANYVEAI	259	sp|Q14847|LASP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:214	ms_run[1]:scan=23569	109.18633	2	1695.827801	1694.830723	R	-	247	262
PSM	TGDTGMLPANYVEAI	260	sp|Q14847|LASP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:214	ms_run[1]:scan=23610	109.42645833333333	2	1695.827801	1694.830723	R	-	247	262
PSM	GDNITLLQSVSN	261	sp|P62304|RUXE_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:214	ms_run[1]:scan=16572	77.80068666666666	3	1405.748496	1403.737808	K	-	81	93
PSM	AGGEESQFEMDI	262	sp|Q13541|4EBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214	ms_run[2]:scan=17963	83.716	2	1455.631	1455.6310	R	-	107	119
PSM	CTLISEDSPN	263	sp|A6NK58|LIPT2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214,1-UNIMOD:4	ms_run[2]:scan=8617	44.866	2	1278.5884	1278.5884	K	-	222	232
PSM	EAQTLDSQIQETSI	264	sp|P27816-4|MAP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214	ms_run[2]:scan=15725	74.368	3	1705.8492	1705.8492	R	-	859	873
PSM	EPELLEPIPYEFMA	265	sp|P46778|RL21_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214,13-UNIMOD:35	ms_run[2]:scan=26590	126.12	2	1836.8977	1836.8977	K	-	147	161
PSM	FFPYSSADAS	266	sp|O94804|STK10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214	ms_run[2]:scan=16441	77.285	2	1234.5628	1234.5628	K	-	959	969
PSM	GDNITLLQSVSN	267	sp|P62304|RUXE_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214	ms_run[2]:scan=16710	78.381	2	1403.7378	1403.7378	K	-	81	93
PSM	GGSGSGPTIEEVD	268	sp|P0DMV8-2|HS71A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214	ms_run[2]:scan=8085	42.698	2	1347.6276	1347.6276	K	-	574	587
PSM	GGSYSQAASSDSAQGSDVSLTA	269	sp|Q95365|1B38_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214	ms_run[2]:scan=10058	50.79	3	2188.9842	2188.9842	K	-	341	363
PSM	LADMYGGGEDD	270	sp|P22223|CADH3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214	ms_run[2]:scan=11655	57.29	2	1285.5254	1285.5254	K	-	819	830
PSM	LEATINELV	271	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214	ms_run[2]:scan=23119	106.93	2	1144.6461	1144.6461	K	-	77	86
PSM	MTEYDCEFANV	272	sp|Q07507|DERM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=17692	82.558	2	1521.6238	1521.6238	R	-	191	202
PSM	MTSTTAEGAGEQ	273	sp|Q9ULJ8-2|NEB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214	ms_run[2]:scan=2958	19.979	2	1325.5891	1325.5891	K	-	376	388
PSM	NLEELNISSAQ	274	sp|Q9Y2R5|RT17_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214	ms_run[2]:scan=14381	68.301	2	1360.6956	1360.6956	K	-	120	131
PSM	NLSDIDLMAPQPGV	275	sp|Q96B49|TOM6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214	ms_run[2]:scan=21725	100.45	2	1612.8252	1612.8252	R	-	61	75
PSM	NMCGLAACASYPIPLV	276	sp|P09668|CATH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214,3-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=25591	120.18	3	1879.9116	1879.9116	K	-	320	336
PSM	QIDQQNCTC	277	sp|Q14145|KEAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214,7-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=1583	12.466	2	1309.5513	1309.5513	K	-	616	625
PSM	SEFNSYSLTGYV	278	sp|P57739|CLD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214	ms_run[2]:scan=21247	98.247	2	1509.7109	1509.7109	K	-	219	231
PSM	SEISSTVPQGGME	279	sp|Q2NL82|TSR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214	ms_run[2]:scan=9684	49.285	2	1464.6888	1464.6888	K	-	792	805
PSM	SNTAGSQSQVETEA	280	sp|Q02790|FKBP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214	ms_run[2]:scan=2715	18.789	2	1551.7134	1551.7134	K	-	446	460
PSM	SVLEEMGLA	281	sp|P61966|AP1S1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214	ms_run[2]:scan=23268	107.71	2	1091.5654	1091.5654	R	-	150	159
PSM	SWDVETATELLLSN	282	sp|P61086-2|UBE2K_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214	ms_run[2]:scan=28716	139.7	2	1720.8641	1720.8641	K	-	136	150
PSM	TGDTGMLPANYVEAI	283	sp|Q14847-3|LASP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214	ms_run[2]:scan=23010	106.39	2	1694.8307	1694.8307	R	-	191	206
PSM	TGQEVAQAQES	284	sp|Q9H098-2|F107B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214	ms_run[2]:scan=1890	14.279	2	1290.6174	1290.6174	R	-	296	307
PSM	TLTEGDSPGSQ	285	sp|P49447|CY561_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214	ms_run[2]:scan=3694	23.56	2	1234.5799	1234.5799	K	-	241	252
PSM	TVYVSVLPTTADF	286	sp|P41252|SYIC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214	ms_run[2]:scan=24924	116.39	3	1555.8256	1555.8256	K	-	1250	1263
PSM	VISSDDLTEL	287	sp|Q9Y6Q1|CAN6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214	ms_run[2]:scan=19112	88.73	2	1234.6414	1234.6414	K	-	632	642
PSM	YGIFQYDGPL	288	sp|Q9H993|ARMT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214	ms_run[2]:scan=25469	119.5	2	1315.657	1315.6570	K	-	432	442
PSM	YPGGDCSSDIWI	289	sp|Q13228-2|SBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=21905	101.27	2	1512.6677	1512.6677	R	-	397	409
PSM	NLNTTFFDPAGGGD	290	sp|P00395|COX1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:214	ms_run[1]:scan=19433	90.13640666666666	2	1568.7294	1568.7224	R	P	214	228
PSM	LASQADSTEQVDDTILT	291	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:214	ms_run[1]:scan=16170	76.17620666666666	3	1949.963471	1949.955131	K	-	2655	2672
PSM	TVQSLEIDLDSMR	292	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:214	ms_run[1]:scan=25138	117.60995333333335	3	1649.848687	1649.841622	R	N	302	315
PSM	TVYVSVLPTTADF	293	sp|P41252|SYIC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:214	ms_run[1]:scan=24844	115.93881499999999	2	1555.832461	1555.825561	K	-	1250	1263
PSM	VGLDPSQLPVGENGIV	294	sp|Q96GX9|MTNB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:214	ms_run[1]:scan=22371	103.36754166666667	2	1737.934781	1736.943050	K	-	227	243
PSM	VYEEGLVQMLDPS	295	sp|P26045|PTN3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:214	ms_run[1]:scan=25325	118.65956666666668	2	1622.806249	1622.798360	R	-	901	914
PSM	TVDLGISDLEDDC	296	sp|Q8NHQ9|DDX55_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:214,13-UNIMOD:4	ms_run[1]:scan=19552	90.68758666666668	2	1594.722574	1594.715418	K	-	588	601